HHsearch alignment for GI: 254780484 and conserved domain: KOG0464

>KOG0464 consensus.
Probab=97.96  E-value=8.2e-06  Score=52.54  Aligned_cols=138  Identities=15%  Similarity=0.188  Sum_probs=94.5

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHH---CCC-CEEEECCCCCEE------EECCEEEEEEEEEEEECCCEEEEEECCHHHHH
Q ss_conf             68689997489988989999973---897-379873888414------52120266555678508964999976001011
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILV---NRK-NLARTSNAPGRT------QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYA   97 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~---g~~-~~a~~~~~p~tt------~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~   97 (212)
T Consensus        36 kirnigiiahidagktttterily~ag~~~s~g~vddgdtvtdfla~erergitiqsaav~fdwkg~rinlidtpghvdf  115 (753)
T KOG0464          36 KIRNIGIIAHIDAGKTTTTERILYLAGAIHSAGDVDDGDTVTDFLAIERERGITIQSAAVNFDWKGHRINLIDTPGHVDF  115 (753)
T ss_pred             HHHCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCEEEEEEEECCCCCCEEEEECCCCCCEE
T ss_conf             64113069985178740678899774022104656788537788888886483665404421235616765248884037


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             12244789888899877776642000001122357887545455432102575322122221111024689999999999
Q gi|254780484|r   98 RAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYL  177 (212)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~  177 (212)
T Consensus       116 ~leverc-------------lrvldgavav~dasagve~qtltvwrqadk~~ip~~~finkmdk~~anf-e~avdsi~ek  181 (753)
T KOG0464         116 RLEVERC-------------LRVLDGAVAVFDASAGVEAQTLTVWRQADKFKIPAHCFINKMDKLAANF-ENAVDSIEEK  181 (753)
T ss_pred             EEEHHHH-------------HHHHCCEEEEEECCCCCCCCEEEEEHHCCCCCCCHHHHHHHHHHHHHHH-HHHHHHHHHH
T ss_conf             9878988-------------8775073899845677664122100030135784533023466655546-6688999987


Q ss_pred             HH
Q ss_conf             75
Q gi|254780484|r  178 IR  179 (212)
Q Consensus       178 ~~  179 (212)
T Consensus       182 l~  183 (753)
T KOG0464         182 LG  183 (753)
T ss_pred             HC
T ss_conf             38