HHsearch alignment for GI: 254780484 and conserved domain: KOG1143

>KOG1143 consensus.
Probab=98.36  E-value=1.6e-06  Score=56.70  Aligned_cols=176  Identities=17%  Similarity=0.269  Sum_probs=100.1

Q ss_pred             HHHCCCCCC---CEEEEECCCCCCHHHHHHHHHCCCC-----EEEEC-------CCCCEEEECCE---EEEEEEEEE---
Q ss_conf             675887668---6899974899889899999738973-----79873-------88841452120---266555678---
Q gi|254780484|r   21 IGLLPKAGP---PEIAFSGRSNVGKSSLINILVNRKN-----LARTS-------NAPGRTQHLNF---FVPKDFSNL---   79 (212)
Q Consensus        21 ~~~~P~~~~---p~VaivG~~NvGKSSLiNaL~g~~~-----~a~~~-------~~p~tt~~~~~---~~~~~~~~~---   79 (212)
T Consensus       156 VRKvPd~QqfievRvAVlGg~D~GKSTLlGVLTQgeLDnG~GrARln~FRh~HEiqsGrTSsis~evlGFd~~g~vVNY~  235 (591)
T KOG1143         156 VRKVPDSQQFIEVRVAVLGGCDVGKSTLLGVLTQGELDNGNGRARLNIFRHPHEIQSGRTSSISNEVLGFDNRGKVVNYA  235 (591)
T ss_pred             HHHCCCCCCCEEEEEEEECCCCCCCCEEEEEEECCCCCCCCCEEEEEHHCCHHHHCCCCCCCCCHHCCCCCCCCCCCCHH
T ss_conf             31288742304899998527656722366554105314788706630110636540576320010100536534300223


Q ss_pred             ---------EECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             ---------50896499997600101112244789888899877776642000001122357887545455432102575
Q gi|254780484|r   80 ---------KNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAV  150 (212)
Q Consensus        80 ---------~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  150 (212)
T Consensus       236 ~~~taEEi~e~SSKlvTfiDLAGh~kY~~TTi~-----------gLtgY~Ph~A~LvVsA~~Gi~~tTrEHLgl~~AL~i  304 (591)
T KOG1143         236 QNMTAEEIVEKSSKLVTFIDLAGHAKYQKTTIH-----------GLTGYTPHFACLVVSADRGITWTTREHLGLIAALNI  304 (591)
T ss_pred             HCCCHHHHHHHHCCEEEEEECCCCHHHHEEEEE-----------ECCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHCC
T ss_conf             204599987410233887650442231304522-----------003679862799998688876540888889997178


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC-----------------------CCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             3221222211110246899999999997531-----------------------36898689998888899899999999
Q gi|254780484|r  151 SYQIVLTKIDKLSPTTAQETLEKTKYLIRNY-----------------------PTAHPEVIPTSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       151 ~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~-----------------------~~~~~~i~~vSA~~g~Gi~eL~~~I~  207 (212)
T Consensus       305 PfFvlvtK~Dl~~~~~~~~tv~~l~nll~~~Gc~kvp~~Vt~~ddAv~Aaq~~~s~nivPif~vSsVsGegl~ll~~fLn  384 (591)
T KOG1143         305 PFFVLVTKMDLVDRQGLKKTVKDLSNLLAKAGCTKVPKRVTTKDDAVKAAQELCSGNIVPIFAVSSVSGEGLRLLRTFLN  384 (591)
T ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEECHHHHHHHHHHHCCCCCEEEEEEEECCCCCHHHHHHHHH
T ss_conf             76999984012363217899999998874237632634850507887888875368811489985047632669999986