HHsearch alignment for GI: 254780484 and conserved domain: KOG1487

>KOG1487 consensus.
Probab=99.03  E-value=1.4e-10  Score=80.03  Aligned_cols=157  Identities=18%  Similarity=0.172  Sum_probs=89.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
T Consensus        60 a~vg~vgFPSvGksTl~~~l~g~~s~--vasyefttl~------~vpG~~~y~gaKiqlldlpgiiegakdgkgrg~qvi  131 (358)
T KOG1487          60 ARVGFVGFPSVGKSTLLSKLTGTFSE--VAAYEFTTLT------TVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGKQVI  131 (358)
T ss_pred             EEEEEEECCCCCHHHHHHHHCCCCCC--CCCCCCEEEE------EECCEEECCCCCEEEECCCCHHCCCCCCCCCCCEEE
T ss_conf             15537853766624332230188876--5543322689------706667404562343048540014646788760788


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC-------------------------------------------------------
Q ss_conf             9987777664200000112235788-------------------------------------------------------
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV-------------------------------------------------------  134 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~-------------------------------------------------------  134 (212)
T Consensus       132 ava------rtcnli~~vld~~kp~~hk~~ie~eleg~girlnk~pp~i~~kkKdkgGInlt~~~LdlD~~rsil~eyR~  205 (358)
T KOG1487         132 AVA------RTCNLIFIVLDVLKPLSHKKIIEKELEGFGIRLNKQPPNIGTKKKDKGGINLTGTHLDLDLQRSILSEYRI  205 (358)
T ss_pred             EEE------ECCCEEEEEEECCCCCCHHHHHHHHHHCCEEECCCCCCCCCCCCCCCCCEEEECCHHHHHHHHHHHHHHHH
T ss_conf             883------01658998711067521788998763103666148899763012444743001320027889999887643


Q ss_pred             -----------CHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHH
Q ss_conf             -----------754545543210257532212222111102468999999999975313689868999888889989999
Q gi|254780484|r  135 -----------KQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR  203 (212)
Q Consensus       135 -----------~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~  203 (212)
T Consensus       206 hsAdi~Lr~DaT~DdLIdvVegnr~yVp~iyvLNkIdsISiEELd------------ii~~iphavpISA~~~wn~d~lL  273 (358)
T KOG1487         206 HSADIALRFDATADDLIDVVEGNRIYVPCIYVLNKIDSISIEELD------------IIYTIPHAVPISAHTGWNFDKLL  273 (358)
T ss_pred             CCHHEEEECCCCHHHHHHHHCCCCEEEEEEEEECCCCEEEEECCC------------EEEECCCEEECCCCCCCCHHHHH
T ss_conf             102305635764222432200573156655562223501210132------------01105632452456665567889


Q ss_pred             HHHHHHHCC
Q ss_conf             999987287
Q gi|254780484|r  204 KAILETINY  212 (212)
Q Consensus       204 ~~I~~~l~~  212 (212)
T Consensus       274 ~~mweyL~L  282 (358)
T KOG1487         274 EKMWEYLKL  282 (358)
T ss_pred             HHHHHCCHH
T ss_conf             887306002