HHsearch alignment for GI: 254780484 and conserved domain: KOG1954

>KOG1954 consensus.
Probab=98.35  E-value=2.8e-06  Score=55.20  Aligned_cols=142  Identities=17%  Similarity=0.239  Sum_probs=86.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCE-EEECCCCCEEEECCEEEEEEEEEEEECC-----------------------
Q ss_conf             6868999748998898999997389737-9873888414521202665556785089-----------------------
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNL-ARTSNAPGRTQHLNFFVPKDFSNLKNNL-----------------------   83 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~-a~~~~~p~tt~~~~~~~~~~~~~~~~~~-----------------------   83 (212)
T Consensus        57 ~KPmill~GqyStGKTtfi~yLle~dypg~riGpEPTtd~Fi~vM~G~~e~~ipGnal~vd~~~pF~gL~~FG~aflnRf  136 (532)
T KOG1954          57 AKPMILLVGQYSTGKTTFIRYLLEQDYPGLRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKKPFRGLNKFGNAFLNRF  136 (532)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             68448997246666039999987177875546899975306899855865666786256468775165666679999988


Q ss_pred             ----------CEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC-CCCCHHHHHHHHHHCCCCCCC
Q ss_conf             ----------649999760010111224478988889987777664200000112235-788754545543210257532
Q gi|254780484|r   84 ----------PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR-HGVKQIDQDVFSFLDKKAVSY  152 (212)
Q Consensus        84 ----------~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~  152 (212)
T Consensus       137 ~csqmp~~vLe~vtiVdtPGILsge--KQrisR~ydF~~v~~WFaeR~D~IiLlfD~hKLDIsdEf~~vi~aLkG~Edki  214 (532)
T KOG1954         137 MCSQLPNQVLESVTIVDTPGILSGE--KQRISRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFKRVIDALKGHEDKI  214 (532)
T ss_pred             HHHCCCHHHHHHEEEECCCCCCCCC--HHCCCCCCCHHHHHHHHHHHCCEEEEEECHHHCCCCHHHHHHHHHHHCCCCEE
T ss_conf             7733875655004442367532012--22012367808899999974568999724664566678999999861886406


Q ss_pred             CCCCCCCCCCCHHHHHHHH
Q ss_conf             2122221111024689999
Q gi|254780484|r  153 QIVLTKIDKLSPTTAQETL  171 (212)
Q Consensus       153 ~~v~nK~D~~~~~~~~~~~  171 (212)
T Consensus       215 RVVLNKADqVdtqqLmRVy  233 (532)
T KOG1954         215 RVVLNKADQVDTQQLMRVY  233 (532)
T ss_pred             EEEECCCCCCCHHHHHHHH
T ss_conf             8883032443799999999