HHsearch alignment for GI: 254780484 and conserved domain: PRK05506

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional.
Probab=99.49  E-value=7.4e-13  Score=93.04  Aligned_cols=161  Identities=16%  Similarity=0.171  Sum_probs=112.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCC-CC------------------------EEEECCCCCEEEECCEEEEEEEEEEEEC
Q ss_conf             6868999748998898999997389-73------------------------7987388841452120266555678508
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNR-KN------------------------LARTSNAPGRTQHLNFFVPKDFSNLKNN   82 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~-~~------------------------~a~~~~~p~tt~~~~~~~~~~~~~~~~~   82 (212)
T Consensus         6 ~~l~~~~~G~VD~GKSTliGrlL~dt~~i~~d~~~~~~~~s~~~g~~~~~~~~a~l~D~l~~EreqGiTIDva~~~F~t~   85 (613)
T PRK05506          6 TLLRFITCGSVDDGKSTLIGRLLYDSKMIFEDQLAALERDSKKVGTQGDEIDLALLVDGLAAEREQGITIDVAYRYFSTP   85 (613)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHCCCEEEEEEEEEECC
T ss_conf             62589999366797888988999981996789999999999981898886035442148888985597168567788438


Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-CCCCCCCCCC
Q ss_conf             964999976001011122447898888998777766420000011223578875454554321025753-2212222111
Q gi|254780484|r   83 LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS-YQIVLTKIDK  161 (212)
Q Consensus        83 ~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~  161 (212)
T Consensus        86 ~r~~~i~DaPGH~~y~r-------------NMitgAs~ad~AilliDa~~G~~~QTrrH~~i~~llGI~~iivaVNKMDl  152 (613)
T PRK05506         86 KRKFIVADTPGHEQYTR-------------NMATGASTADLAIILVDARKGVLTQTRRHSFIASLLGIRHIVLAVNKMDL  152 (613)
T ss_pred             CEEEEEECCCCHHHHHH-------------HHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCC
T ss_conf             70599942896798998-------------99987865387999998887951551899999987298759999852012


Q ss_pred             CCH--HHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHH
Q ss_conf             102--4689999999999753136898689998888899899
Q gi|254780484|r  162 LSP--TTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEV  201 (212)
Q Consensus       162 ~~~--~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~e  201 (212)
T Consensus       153 V~y~~~~f~~I~~~~~~~~~~l~~~~~~~IPISAl~GDNVv~  194 (613)
T PRK05506        153 VDYDQEVFDRIVADYLAFAAKLGLTDVTFIPISALKGDNVVT  194 (613)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCEEEE
T ss_conf             478199999999999999965799887599673574874767