HHsearch alignment for GI: 254780484 and conserved domain: PRK07560

>PRK07560 elongation factor EF-2; Reviewed.
Probab=98.95  E-value=5.2e-09  Score=70.95  Aligned_cols=123  Identities=14%  Similarity=0.153  Sum_probs=77.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCC-CEE-EECCCCCE-EE-----ECCEEEEEEE----EEEEECCCEEEEEECCHH
Q ss_conf             668689997489988989999973897-379-87388841-45-----2120266555----678508964999976001
Q gi|254780484|r   27 AGPPEIAFSGRSNVGKSSLINILVNRK-NLA-RTSNAPGR-TQ-----HLNFFVPKDF----SNLKNNLPAMALVDMPGY   94 (212)
Q Consensus        27 ~~~p~VaivG~~NvGKSSLiNaL~g~~-~~a-~~~~~p~t-t~-----~~~~~~~~~~----~~~~~~~~~~~~~DtpG~   94 (212)
T Consensus        18 e~IRNI~IiaHvdaGKTTLtE~lL~~sg~i~~~~~~~~t~~D~~~~E~eRgITI~sa~~sl~~~~~~~~~~INlIDTPGh   97 (730)
T PRK07560         18 EQIRNIGIVAHIDHGKTTLSDNLLAGAGMISEELAGKQLALDYDEEEQARGITIKAANVSMVHEYEGKEYLINLIDTPGH   97 (730)
T ss_pred             HHCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCEECCCHHHHHHCCCCEEECCEEEEEEECCCCEEEEEECCCCC
T ss_conf             63528999937998989999999996499865347986417885999972985752110289875698378999819697


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             01112244789888899877776642000001122357887545455432102575322122221111
Q gi|254780484|r   95 GYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL  162 (212)
Q Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~  162 (212)
T Consensus        98 ~DF~~E-------------v~~aLrv~DgAvvVvdav~GV~~qTe~v~rqa~~~~~p~ilfINKmDR~  152 (730)
T PRK07560         98 VDFGGD-------------VTRAMRAVDGAIVVVDAVEGVMPQTETVLRQALEERVRPVLFINKVDRL  152 (730)
T ss_pred             CHHHHH-------------HHHHHHHHCEEEEEEECCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             305999-------------9999988587899997898877318999999987799979998686623