HHsearch alignment for GI: 254780484 and conserved domain: PRK12298

>PRK12298 obgE GTPase ObgE; Reviewed.
Probab=99.91  E-value=6.7e-24  Score=156.54  Aligned_cols=164  Identities=20%  Similarity=0.196  Sum_probs=112.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
T Consensus       161 DVGLvG~PNAGKSTll~~iS~Ak--PKIAdYpFTTL~PnLGvV~~-----~~~~~fviADIPGLIeGAs~G~GLG~~-FL  232 (380)
T PRK12298        161 DVGLLGLPNAGKSTFIRAVSAAK--PKVADYPFTTLVPNLGVVRV-----DDERSFVIADIPGLIEGAAEGAGLGIR-FL  232 (380)
T ss_pred             CCCEEECCCCCCHHHHHHHHCCC--CCCCCCCCCCCCCEEEEEEE-----CCCCEEEEEECCCCCCCCCCCCCHHHH-HH
T ss_conf             65146369886108998855589--75478875336874679994-----698669998777555775558772899-99


Q ss_pred             HHHHHHHHHHHCCCCCCCCCC----CCCCHHHHHHH----HHH-CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             987777664200000112235----78875454554----321-025753221222211110246899999999997531
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCR----HGVKQIDQDVF----SFL-DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY  181 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~----~~~-~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~  181 (212)
T Consensus       233 rHi-----eRt~~LlhviD~s~~~~~dp~~~~~~i~~EL~~Y~~~L~~kp~iiv~NK~Dl~~~~e~~~~~~~~~~~~---  304 (380)
T PRK12298        233 KHL-----ERCRVLLHLIDIAPIDGSDPVENARIIVNELEKYSPKLAEKPRWLVFNKIDLLDEEEAEERAKEIVEAL---  304 (380)
T ss_pred             HHH-----HHHCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHC---
T ss_conf             998-----753589999968877751999999999999998597660598799998854899799999999999970---


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             368986899988888998999999998728
Q gi|254780484|r  182 PTAHPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       182 ~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
T Consensus       305 -~~~~~v~~ISA~tgeG~~~L~~~i~~~l~  333 (380)
T PRK12298        305 -GWEGPVYLISAASGEGTKELCWDLMTFIE  333 (380)
T ss_pred             -CCCCCEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             -88888799978768799999999999998