HHsearch alignment for GI: 254780484 and conserved domain: PTZ00133

>PTZ00133 ADP-ribosylation factor; Provisional.
Probab=99.54  E-value=3.7e-14  Score=100.55  Aligned_cols=157  Identities=13%  Similarity=0.137  Sum_probs=93.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
T Consensus        16 k~~kililGl~~sGKTsil~~l~~~~~-~--~~~pTvg--~~------~~~~~~~~~~l~iwD~~Gqe~~r~lw~~----   80 (182)
T PTZ00133         16 KEVRILMVGLDAAGKTTILYKLKLGEV-V--TTIPTIG--FN------VETVEYKNLKFTMWDVGGQDKLRPLWRH----   80 (182)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHCCCC-C--CCCCCCC--CC------EEEEEECCEEEEEEECCCCCCCCHHHHH----
T ss_conf             747999996799889999999962997-7--7378688--45------6999978889999989998454747876----


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHH--HH---HHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             8899877776642000001122357887545--45---543210257532212222111102468999999999975313
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVKQID--QD---VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP  182 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~---~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~  182 (212)
T Consensus        81 ------y---y~~~~giI~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~piLi~~NK~Dl~~a~~~~ei~~~l~l--~~~~  149 (182)
T PTZ00133         81 ------Y---YQNTNGIIFVVDSNDRERIGDARQELEKMLAEDELRNAVLLVFANKQDLPNAMSTTEVTEKLGL--HSVR  149 (182)
T ss_pred             ------C---CCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEECCCCCCCCCCHHHHHHHHCH--HHHH
T ss_conf             ------0---5676449999966787899999999999971442248859999706687788899999999695--5561


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             6898689998888899899999999872
Q gi|254780484|r  183 TAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       183 ~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
T Consensus       150 ~~~~~i~~~SA~tG~Gi~e~f~wL~~~i  177 (182)
T PTZ00133        150 QRNWYIQGCCATTAQGLYEGLDWLSANI  177 (182)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             5995899825758949899999999999