HHsearch alignment for GI: 254780484 and conserved domain: TIGR00073

>TIGR00073 hypB hydrogenase accessory protein HypB; InterPro: IPR004392 The hydrogenase accessory protein HypB is a GTP hydrolase for assembly of nickel metallocentre of hydrogenase. A similar protein, ureG, is an accessory protein for urease, which also uses nickel.; GO: 0016151 nickel ion binding, 0006461 protein complex assembly.
Probab=98.17  E-value=9.8e-07  Score=57.84  Aligned_cols=167  Identities=16%  Similarity=0.160  Sum_probs=79.5

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHCCC-----CEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHH
Q ss_conf             5887668689997489988989999973897-----37987388841452120266555678508964999976001011
Q gi|254780484|r   23 LLPKAGPPEIAFSGRSNVGKSSLINILVNRK-----NLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYA   97 (212)
Q Consensus        23 ~~P~~~~p~VaivG~~NvGKSSLiNaL~g~~-----~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~   97 (212)
T Consensus        28 ~~~~~g~~~lNfmsspGSGKT~LiEk~~~~~~~~~K~Avi~GD~~t~~-DA--------~RlR~~G~~a~~~nTGk~---   95 (225)
T TIGR00073        28 RFDKEGLLVLNFMSSPGSGKTTLIEKLIERLDDEVKIAVIEGDVQTKN-DA--------DRLRKYGVPAIQINTGKE---   95 (225)
T ss_pred             HHHHCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCCEEEEECCHHHHH-HH--------HHHHHCCCEEEEECCCCC---
T ss_conf             998659789980258861158999999998457897899975532255-69--------999864986886368864---


Q ss_pred             HHHHHHHHHHHHH-HHHHHHHHHHHCC-CCCCC-CCCCCCCHHH------------------HHHHHHHCCCCCCCCCCC
Q ss_conf             1224478988889-9877776642000-00112-2357887545------------------455432102575322122
Q gi|254780484|r   98 RAPKKNVDSWGGL-IVRYLSERSTLRC-VYLLI-DCRHGVKQID------------------QDVFSFLDKKAVSYQIVL  156 (212)
Q Consensus        98 ~~~~~~~~~~~~~-~~~~~~~~~~~~~-~~~~~-~~~~~~~~~~------------------~~~~~~~~~~~~~~~~v~  156 (212)
T Consensus        96 ----CHLdA~mv~G~~~~L~~~~ld~~~DlL~IENVGNLvCP~~FdLGe~~rVvllSVTEGdDk~lKyP~~F~~Ad~~~i  171 (225)
T TIGR00073        96 ----CHLDAHMVAGAIHALKDLPLDDISDLLLIENVGNLVCPADFDLGEHMRVVLLSVTEGDDKVLKYPAMFKEADLILI  171 (225)
T ss_pred             ----CCCHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCEECCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHH
T ss_conf             ----4401667865875542168887146268864476100673112356307999865899965466158874445621


Q ss_pred             CCCCCCCH--HHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             22111102--4689999999999753136898689998888899899999999872
Q gi|254780484|r  157 TKIDKLSP--TTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       157 nK~D~~~~--~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
T Consensus       172 nK~DL~~~v~~D~ek~~~d~~~~-----nP~a~Ii~~S~ktg~Gl~~w~~~l~~~~  222 (225)
T TIGR00073       172 NKVDLAEAVGFDVEKMKADARKI-----NPEAEIILVSAKTGKGLDEWLEFLEGKK  222 (225)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHH-----CCCEEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             47889977073678999999862-----8950799863689734789999999864