HHsearch alignment for GI: 254780484 and conserved domain: TIGR00483

>TIGR00483 EF-1_alpha translation elongation factor EF-1, subunit alpha; InterPro: IPR004539 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. EF1A (also known as EF-1alpha or EF-Tu) is a G-protein. It forms a ternary complex of EF1A-GTP-aminoacyltRNA. The binding of aminoacyl-tRNA stimulates GTP hydrolysis by EF1A, causing a conformational change in EF1A that causes EF1A-GDP to detach from the ribosome, leaving the aminoacyl-tRNA attached at the A-site. Only the cognate aminoacyl-tRNA can induce the required conformational change in EF1A through its tight anticodon-codon binding , . EF1A-GDP is returned to its active state, EF1A-GTP, through the action of another elongation factor, EF1B (also known as EF-Ts or EF-1beta/gamma/delta). This entry represents EF1A proteins found primarily in eukaryotic (eEF1A) and archaeal (aEF1A) organisms, these proteins being more closely related to one another than to EF1A (or EF-Tu) found in bacteria (IPR004541 from INTERPRO). More information about these proteins can be found at Protein of the Month: Elongation Factors . ; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005737 cytoplasm.
Probab=98.85  E-value=1.3e-08  Score=68.71  Aligned_cols=159  Identities=14%  Similarity=0.215  Sum_probs=91.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCC------------CEE-----------EECCCCCEEEECCEEEEEEEEEEEECCCEE
Q ss_conf             689997489988989999973897------------379-----------873888414521202665556785089649
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRK------------NLA-----------RTSNAPGRTQHLNFFVPKDFSNLKNNLPAM   86 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~------------~~a-----------~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~   86 (212)
T Consensus         8 ~Nv~~IGHVD~GKST~~G~Lly~~G~I~~~~~eK~~kEa~e~GK~~F~fa~V~D~Lk~ERERGvTID~A~~KFeT~KY~~   87 (445)
T TIGR00483         8 INVAFIGHVDHGKSTLVGRLLYKAGAIDEQLLEKLKKEAQEKGKASFEFAWVMDRLKEERERGVTIDVAHKKFETDKYEV   87 (445)
T ss_pred             EEEEEEEEEECCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCHHHHHHHHCCCCCEEE
T ss_conf             44899825408850266777754289658999999875755187303676543110000015622433445417885169


Q ss_pred             EEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC---C----CCCCCHHHHHHHHHHCCCCCC-CCCCCCC
Q ss_conf             9997600101112244789888899877776642000001122---3----578875454554321025753-2212222
Q gi|254780484|r   87 ALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLID---C----RHGVKQIDQDVFSFLDKKAVS-YQIVLTK  158 (212)
Q Consensus        87 ~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~----~~~~~~~~~~~~~~~~~~~~~-~~~v~nK  158 (212)
T Consensus        88 TivDcPGHRDFiKNM-------------ITGaSQADaAvLv~~v~~~~~~ag~~~~pQTrEH~~La~TLGi~QliVAiNK  154 (445)
T TIGR00483        88 TIVDCPGHRDFIKNM-------------ITGASQADAAVLVVAVDDGEFEAGISVQPQTREHVFLARTLGINQLIVAINK  154 (445)
T ss_pred             EEEECCCCCHHHHHC-------------CCCCCCCCEEEEEEECCCCCCCCCEEECCCCHHHHHHHHHHCCEEEEEEECC
T ss_conf             998469870134311-------------2667512427999952544102401217860577888775032045333102


Q ss_pred             CCCCCHH--HHHHHHHHHHH-HHHH--CCCCCCCEEEEECCCCCCHHH
Q ss_conf             1111024--68999999999-9753--136898689998888899899
Q gi|254780484|r  159 IDKLSPT--TAQETLEKTKY-LIRN--YPTAHPEVIPTSSVKRKGIEV  201 (212)
Q Consensus       159 ~D~~~~~--~~~~~~~~~~~-~~~~--~~~~~~~i~~vSA~~g~Gi~e  201 (212)
T Consensus       155 MD~V~yd~~~f~~~~~~~s~~l~K~vGY~p~~v~FiP~s~~~GDN~~~  202 (445)
T TIGR00483       155 MDSVNYDEEEFEALKKEVSEQLLKKVGYKPDEVPFIPISAFEGDNVIK  202 (445)
T ss_pred             CCCEECCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCHHH
T ss_conf             461002778999999999998998748875612325403546761343