HHsearch alignment for GI: 254780484 and conserved domain: TIGR00487

>TIGR00487 IF-2 translation initiation factor IF-2; InterPro: IPR000178 Initiation factor 2 (IF-2) (gene infB) is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-2 promotes the GTP-dependent binding of the initiator tRNA to the small subunit of the ribosome. IF-2 is a protein of about 70 to 95 Kd which contains a central GTP-binding domain flanked by a highly variable N-terminal domain and a more conserved C-terminal domain. Bacterial IF-2 is structurally and functionally related to eukaryotic mitochondrial IF-2 (IF-2(mt)) as well as to algal and plants chloroplast IF-2 (IF-2(chl)). Both IF-2(mt) and IF-2(chl) are encoded by nuclear genes and are produced as precursor proteins with a transit peptide. An exception are red algae where IF-2(chl) is encoded by the plastid genome .; GO: 0003743 translation initiation factor activity, 0005525 GTP binding, 0006413 translational initiation, 0005622 intracellular.
Probab=99.16  E-value=4.7e-10  Score=76.92  Aligned_cols=164  Identities=24%  Similarity=0.330  Sum_probs=119.5

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCE-EEEEECCHHHHHHHHHH
Q ss_conf             88766868999748998898999997389737987388841452120266555678508964-99997600101112244
Q gi|254780484|r   24 LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPA-MALVDMPGYGYARAPKK  102 (212)
Q Consensus        24 ~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~-~~~~DtpG~~~~~~~~~  102 (212)
T Consensus        85 ~~~~~pp~~~~~gh~dhg~~~ll~~~~~~~~--~~~~~gg~~~~~g~y~-----~~~~~~~~~~~f~d~pgh~~f~~---  154 (594)
T TIGR00487        85 LLVPRPPVVTIMGHVDHGKTSLLDSIRKTKV--AAGEAGGITQHIGAYH-----VEKEDGKKWITFLDTPGHEAFTL---  154 (594)
T ss_pred             HHHCCCCEEEEEECCCCCCHHHHHHHHHCCC--CCCCCCCCHHHCCEEE-----EEECCCCEEEEEECCCCHHHHHH---
T ss_conf             1102476368851235540345655541000--0111365201013045-----66428843799840775367787---


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC--HHHHHHHHHHHHHHHHH
Q ss_conf             7898888998777766420000011223578875454554321025753221222211110--24689999999999753
Q gi|254780484|r  103 NVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS--PTTAQETLEKTKYLIRN  180 (212)
Q Consensus       103 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~--~~~~~~~~~~~~~~~~~  180 (212)
T Consensus       155 ----------~~~~g~~~~d~~~~~~~~~dg~~~~~~~~~~h~~~~~~p~~~~~n~~d~p~~~pd~~~~~~~~~g-~~~~  223 (594)
T TIGR00487       155 ----------MRARGAKVTDIVVLVVAADDGVKPQTIEAISHAKAANVPLIVAVNKIDKPEANPDRVKQELSEYG-LVPE  223 (594)
T ss_pred             ----------HHHCCCCEEEEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHCC-CCCH
T ss_conf             ----------76337610015799984155642356887653333077369986124676678778999987517-7501


Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             1368986899988888998999999998
Q gi|254780484|r  181 YPTAHPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       181 ~~~~~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
T Consensus       224 ~wgg~~~~~~~~~~~g~g~~~l~~~~l~  251 (594)
T TIGR00487       224 DWGGDTIFVPVSALTGDGIDELLDAILL  251 (594)
T ss_pred             HCCCCEEEEEEECCCCCCHHHHHHHHHH
T ss_conf             1278346886200136765788888887