HHsearch alignment for GI: 254780484 and conserved domain: TIGR00618

>TIGR00618 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. SbcC may have nuclease activity that is functionally related to one of the nuclease activities of the RecBCD enzyme (IPR004586 from INTERPRO).; GO: 0004527 exonuclease activity, 0006259 DNA metabolic process.
Probab=97.43  E-value=0.00015  Score=45.34  Aligned_cols=39  Identities=21%  Similarity=0.303  Sum_probs=31.3

Q ss_pred             CCCCCCEEEEEECCCHHHCCCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             014574047862365675887668689997489988989999973
Q gi|254780484|r    6 IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILV   50 (212)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~P~~~~p~VaivG~~NvGKSSLiNaL~   50 (212)
T Consensus        13 ~y~~~~~~dfT------~~~fasl~~f~i~G~tGAGKtsLldAI~   51 (1063)
T TIGR00618        13 SYKGESVIDFT------ALGFASLKLFVICGKTGAGKTSLLDAIT   51 (1063)
T ss_pred             CCCCCCEEECC------CCCCCCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             34576101027------8872125736777889983545999999