>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains; InterPro: IPR005690 Two integral outer envelope GTPases, Toc34 and Toc86, are proposed to regulate the recognition and translocation of nuclear-encoded preproteins during the early stages of protein import into chloroplasts. The long precursor of the 86K protein is proposed to have three domains. The N-terminal A-domain is acidic, repetitive, weakly conserved, readily removed by proteolysis during chloroplast isolation, and not required for protein translocation . The other domains are designated G (GTPase) and M (membrane anchor); this family includes most of the G domain and all of M.; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0006886 intracellular protein transport, 0009707 chloroplast outer membrane.

Probab=98.01 E-value=2.2e-05 Score=50.10 Aligned_cols=69 Identities=20% Similarity=0.219 Sum_probs=49.3 Q ss_pred CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH Q ss_conf 6899974899889899999738973798738884145212026655567850896499997600101112244789 Q gi|254780484|r 30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD 105 (212) Q Consensus 30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~ 105 (212) T Consensus 125 l~IlVLGK~GVGKSATINSI~~e~~~s~dAf~~~T~~V-------~~i~G~V~Gv~i~viDTPGL~~s~~dQs~N~ 193 (772) T TIGR00993 125 LNILVLGKSGVGKSATINSIFGEVKASIDAFGLGTTSV-------QEIEGLVDGVKIRVIDTPGLKSSASDQSKNE 193 (772) T ss_pred EEEEEECCCCCCCCHHHHHHHCCEEEEEECCCCCCCEE-------EEEEEEEEEEEEEEEECCCCCHHHHHHHHCH T ss_conf 14345515687720101111235001201014666447-------7666677107999975788755554333020

HHsearch alignment for GI: 254780484 and conserved domain: TIGR00993