HHsearch alignment for GI: 254780484 and conserved domain: TIGR01393

>TIGR01393 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function of the proteins in this family are unknown. ; GO: 0005525 GTP binding.
Probab=99.73  E-value=1.8e-17  Score=119.55  Aligned_cols=164  Identities=18%  Similarity=0.173  Sum_probs=114.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCE---------------EEECCEEEEEEEEEEEECCCEEEEEECC
Q ss_conf             6868999748998898999997389737987388841---------------4521202665556785089649999760
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGR---------------TQHLNFFVPKDFSNLKNNLPAMALVDMP   92 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~t---------------t~~~~~~~~~~~~~~~~~~~~~~~~Dtp   92 (212)
T Consensus         2 ~IRNFsIIAHIDHGKSTLADRlle~T~--~~s~R~m~~Q~LD~MDlERERGITIK~qaV~l~Yk~~~DGe~Y~LNLIDTP   79 (598)
T TIGR01393         2 NIRNFSIIAHIDHGKSTLADRLLEKTG--AVSEREMREQVLDSMDLERERGITIKAQAVRLKYKVAKDGETYVLNLIDTP   79 (598)
T ss_pred             CCCCEEEEEEECCCCCHHHHHHHHHCC--CCCCHHHHHCCCCCCCEEECCCCEEECCCEEEEEEEECCCCEEEEEEECCC
T ss_conf             875267884624893248899998617--456202543057751000005820115634753375338878899645288


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             01011122447898888998777766420000011223578875454554321025753221222211110246899999
Q gi|254780484|r   93 GYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLE  172 (212)
Q Consensus        93 G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~  172 (212)
T Consensus        80 GHVDFsY-------------EVSRSLAACEGALL~VDA~QGvEAQT~aN~YlAlE~dLeIIPViNKIDL-P~Adpe~v~~  145 (598)
T TIGR01393        80 GHVDFSY-------------EVSRSLAACEGALLLVDAAQGVEAQTLANVYLALENDLEIIPVINKIDL-PSADPERVKK  145 (598)
T ss_pred             CCCCCCH-------------HHHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEECCCCC-CCCCHHHHHH
T ss_conf             9721273-------------7888888716403561410323588899998875618758477825368-8888589999


Q ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             99999753136898689998888899899999999872
Q gi|254780484|r  173 KTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       173 ~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
T Consensus       146 eIe~~---iGld~~~ai~~SAKtG~Gi~e~LEaIv~~v  180 (598)
T TIGR01393       146 EIEEV---IGLDASEAILASAKTGIGIEEILEAIVKRV  180 (598)
T ss_pred             HHHHH---CCCCCCCCEEEEECCCCCHHHHHHHHHHCC
T ss_conf             87654---188964303875036788899988971018