>TIGR02528 EutP ethanolamine utilization protein, EutP; InterPro: IPR012381 Members of this family function in ethanolamine and propanediol degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose , . More than 10f the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect , . The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella , , . Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 biogenic amine metabolic process.

Probab=99.40 E-value=9.4e-13 Score=92.46 Aligned_cols=142 Identities=20% Similarity=0.248 Sum_probs=86.2 Q ss_pred EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH Q ss_conf 89997489988989999973897379873888414521202665556785089649999760010111224478988889 Q gi|254780484|r 31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL 110 (212) Q Consensus 31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~ 110 (212) T Consensus 2 r~~f~G~~gCGKTTL~q~L~g~~~~YK------KTQAv-----------E~~--~k~~IDTPGEY~enr---------~~ 53 (144) T TIGR02528 2 RIMFIGSVGCGKTTLTQALQGEEIKYK------KTQAV-----------EYK--DKEAIDTPGEYVENR---------RY 53 (144) T ss_pred EEEEEECCCCCHHHHHHHCCCCCCCEE------EEEEE-----------EEC--CCCCCCCCCCCCCCC---------CH T ss_conf 178871588874435431168732102------33445-----------425--888655985001575---------23 Q ss_pred HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEE Q ss_conf 98777766420000011223578875454554321025753221222211110246899999999997531368986899 Q gi|254780484|r 111 IVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP 190 (212) Q Consensus 111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~ 190 (212) T Consensus 54 Y~AL~vtaaDAd~i~lV~~a~~~~~~f~PgF~~~f--~kK~~IG~vTK~DLA~~d~~i~---r~~~~L~~--AG~~~iF~ 126 (144) T TIGR02528 54 YSALIVTAADADVIALVQSATDEESRFSPGFASIF--VKKEVIGIVTKIDLAEADKDIE---RAKRLLET--AGAEKIFE 126 (144) T ss_pred HHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCC--CCCCEEEEEEECCCCCCHHHHH---HHHHHHHH--CCCCCCEE T ss_conf 78888887210236677357764223785000236--7886347884037887734799---99999872--36543316 Q ss_pred EECCCCCCHHHHHHHHH Q ss_conf 98888899899999999 Q gi|254780484|r 191 TSSVKRKGIEVLRKAIL 207 (212) Q Consensus 191 vSA~~g~Gi~eL~~~I~ 207 (212) T Consensus 127 ~~~~d~~G~~~l~~yL~ 143 (144) T TIGR02528 127 ISSVDEKGIEELVDYLN 143 (144) T ss_pred ECCCCCHHHHHHHHHHC T ss_conf 50778045899999844

HHsearch alignment for GI: 254780484 and conserved domain: TIGR02528