HHsearch alignment for GI: 254780484 and conserved domain: TIGR03598

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=100.00  E-value=1.1e-37  Score=235.75  Aligned_cols=178  Identities=47%  Similarity=0.751  Sum_probs=143.1

Q ss_pred             EEEEECCCHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECC
Q ss_conf             47862365675887668689997489988989999973897379873888414521202665556785089649999760
Q gi|254780484|r   13 IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMP   92 (212)
Q Consensus        13 ~~~~~~~~~~~~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~Dtp   92 (212)
T Consensus         2 ~~~~~~~~~~~~p~~~~p~IaivGrpNvGKSTL~N~L~g~k~~a~vs~~pGtTr~i~~~~~---------~~~~~lvDtp   72 (179)
T TIGR03598         2 EFLKSAVKLKQLPPDDGPEIAFAGRSNVGKSSLINALTNRKKLARTSKTPGRTQLINFFEV---------NDGFRLVDLP   72 (179)
T ss_pred             EEEEECCCHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEE---------CCCEEEEECC
T ss_conf             7888168976799988978999869998889999998689855897089973660232010---------4736999777


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             01011122447898888998777766420000011223578875454554321025753221222211110246899999
Q gi|254780484|r   93 GYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLE  172 (212)
Q Consensus        93 G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~  172 (212)
T Consensus        73 GyG~~~~~~~~~~~~~~~~~~~~~~~~~l~~villiDa~~gl~~~D~~i~~~l~~~~kp~iivlNK~Dll~~~~~~~~~~  152 (179)
T TIGR03598        73 GYGYAKVSKEEKEKWQKLIEEYLRGRENLKGVVLLMDIRHPLKELDLEMLEWLDERGIPVLIVLTKADKLKKSERNKQLK  152 (179)
T ss_pred             CHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHH
T ss_conf             60211278888999999999999998864302898743779989999999999975998899997813069899999999


Q ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCCHH
Q ss_conf             9999975313689868999888889989
Q gi|254780484|r  173 KTKYLIRNYPTAHPEVIPTSSVKRKGIE  200 (212)
Q Consensus       173 ~~~~~~~~~~~~~~~i~~vSA~~g~Gi~  200 (212)
T Consensus       153 ~i~~~l~~~-~~~~~v~~ISA~~g~GID  179 (179)
T TIGR03598       153 KIKKALKKD-ADDPSVQLFSSLKKTGIE  179 (179)
T ss_pred             HHHHHHHCC-CCCCCEEEEECCCCCCCC
T ss_conf             999997336-688948999799983879