HHsearch alignment for GI: 254780484 and conserved domain: cd01849

>cd01849 YlqF_related_GTPase YlqF-related GTPases. These proteins are found in bacteria, eukaryotes, and archaea. They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.
Probab=99.54  E-value=1.4e-14  Score=102.91  Aligned_cols=57  Identities=33%  Similarity=0.456  Sum_probs=45.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHH
Q ss_conf             6868999748998898999997389737987388841452120266555678508964999976001
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGY   94 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~   94 (212)
T Consensus        99 ~~~~i~ivG~PNVGKSsliN~L~~~~~-~~v~~~pGtTrd~~~i~--------~-~~~~~liDTpGi  155 (155)
T cd01849          99 KSITVGVIGYPNVGKSSVINALLNKLK-LKVGNVPGTTTSQQEVK--------L-DNKIKLLDTPGI  155 (155)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHCCCE-EEECCCCCCEECEEEEE--------E-CCCEEEEECCCC
T ss_conf             660899987777447789999847850-62669998383559999--------6-899899979299