HHsearch alignment for GI: 254780484 and conserved domain: cd01854

>cd01854 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.
Probab=98.70  E-value=2.1e-08  Score=67.47  Aligned_cols=67  Identities=31%  Similarity=0.353  Sum_probs=39.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEE--EECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH
Q ss_conf             689997489988989999973897379--873888414521202665556785089649999760010111224
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLA--RTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a--~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~  101 (212)
T Consensus       162 k~~v~~G~SGvGKSSLiN~L~~~~~~~t~~vs~~~~rGrH--TTt~---~~L~~l~~gg~iiDTPG~r~~~l~~  230 (287)
T cd01854         162 KTSVLVGQSGVGKSTLINALLPDLDLATGEISEKLGRGRH--TTTH---RELFPLPGGGLLIDTPGFREFGLLH  230 (287)
T ss_pred             CEEEEECCCCCCHHHHHHHHCCHHHHHHHHHHHHHCCCCE--EEEE---EEEEECCCCCEEEECCCCCCCCCCC
T ss_conf             8899988998888999987462121256666776089850--1415---7999928995898689876356777