HHsearch alignment for GI: 254780484 and conserved domain: cd01863

>cd01863 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex. In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=99.58  E-value=1.1e-14  Score=103.66  Aligned_cols=156  Identities=20%  Similarity=0.176  Sum_probs=85.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
T Consensus         1 ~KivvvG~~~vGKTsli~r~~~~~f~~~--~~~ti~~~~----~~~~~~~~~~~~~l~iwDt~g~~~~~~~~~~~~----   70 (161)
T cd01863           1 LKILLIGDSGVGKSSLLLRFTDDTFDPD--LAATIGVDF----KVKTLTVDGKKVKLAIWDTAGQERFRTLTSSYY----   70 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCCCC--CCCCCCCCC----EEEEEEECCEEEEEEEEECCCCCCCCCCHHHHH----
T ss_conf             9899999799579999999963999998--487313342----389999999999999999999842353422441----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--C---HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             9987777664200000112235788--7---5454554321025753221222211110246899999999997531368
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--K---QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~---~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
T Consensus        71 ---------~~a~~~ilvfd~~~~~Sf~~i~~~~~~i~~~~~~~~~~~ilVgnK~D~~~~~v~~---~~~~~~a~~~---  135 (161)
T cd01863          71 ---------RGAQGVILVYDVTRRDTFTNLETWLNELETYSTNNDIVKMLVGNKIDKENREVTR---EEGLKFARKH---  135 (161)
T ss_pred             ---------HHCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCH---HHHHHHHHHC---
T ss_conf             ---------3215348997678265699999999999985688887378873104400068999---9999999986---


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             98689998888899899999999872
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
T Consensus       136 ~~~y~e~Sak~g~nV~~~F~~l~~~i  161 (161)
T cd01863         136 NMLFIETSAKTRDGVQQAFEELVEKI  161 (161)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHC
T ss_conf             99999971586815999999999709