HHsearch alignment for GI: 254780484 and conserved domain: cd01881

>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1. Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box). Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown. Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT. Nog1 is a nucleolar protein that might function in ribosome assembly. The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to
Probab=99.94  E-value=3.6e-26  Score=169.57  Aligned_cols=158  Identities=24%  Similarity=0.272  Sum_probs=101.6

Q ss_pred             EECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEE-CCCEEEEEECCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             974899889899999738973798738884145212026655567850-8964999976001011122447898888998
Q gi|254780484|r   34 FSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN-NLPAMALVDMPGYGYARAPKKNVDSWGGLIV  112 (212)
Q Consensus        34 ivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~-~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~  112 (212)
T Consensus         1 ivG~PNvGKSTL~N~Lt~~~~--~v~~~pgTTr~~~~------g~~~~~~~~~i~~~DtpGi~~~~~~~~~~~-~~~---   68 (176)
T cd01881           1 LVGLPNVGKSTLLNALTNAKP--KVANYPFTTLEPNL------GVVEVPDGARIQVADIPGLIEGASEGRGLG-NQF---   68 (176)
T ss_pred             CCCCCCCCHHHHHHHHHCCCC--EEECCCCCEEEEEE------EEEEECCCCEEEEEECCCCCCCCHHHHHHH-HHH---
T ss_conf             969998889999999968996--03078996761246------799947996699995787545733787899-999---


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCHH------HHH-HHH----------HHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             7777664200000112235788754------545-543----------21025753221222211110246899999999
Q gi|254780484|r  113 RYLSERSTLRCVYLLIDCRHGVKQI------DQD-VFS----------FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK  175 (212)
Q Consensus       113 ~~~~~~~~~~~~~~~~~~~~~~~~~------~~~-~~~----------~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~  175 (212)
T Consensus        69 --l~~~~~~d~il~vvD~~~~~~~~~~~~~~~~~~i~~el~~~~~~~~~~~~~~kp~i~v~NK~Dl~~~~~~~~~~~~~~  146 (176)
T cd01881          69 --LAHIRRADAILHVVDASEDDDIGGVDPLEDYEILNAELKLYDLETILGLLTAKPVIYVLNKIDLDDAEELEEELVREL  146 (176)
T ss_pred             --HHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHCCCCEEEEEECEECCCHHHHHHHHHHHH
T ss_conf             --987410889999998987655454458999999999999711566555432697199996860347003159999999


Q ss_pred             HHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             99753136898689998888899899999999872
Q gi|254780484|r  176 YLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       176 ~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
T Consensus       147 ~-----~~~~~~ii~iSA~~~~gi~~L~~~i~~~L  176 (176)
T cd01881         147 A-----LEEGAEVVPISAKTEEGLDELIRAIYELL  176 (176)
T ss_pred             H-----HCCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             7-----46899589997778879999999999659