HHsearch alignment for GI: 254780484 and conserved domain: cd01885

>cd01885 EF2 EF2 (for archaea and eukarya). Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes. The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome. The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins. Two major mechanisms are known to regulate protein elongation and both involve eEF2. First, eEF2 can be modulated by reversible phosphorylation. Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes. Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2. In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation. Seco
Probab=99.57  E-value=7.4e-14  Score=98.80  Aligned_cols=166  Identities=19%  Similarity=0.277  Sum_probs=102.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEE---------ECCEEEE----------EEEEEEEECCCEEEEEEC
Q ss_conf             899974899889899999738973798738884145---------2120266----------555678508964999976
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ---------HLNFFVP----------KDFSNLKNNLPAMALVDM   91 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~---------~~~~~~~----------~~~~~~~~~~~~~~~~Dt   91 (212)
T Consensus         2 Ni~iigHvdhGKTTL~D~Ll~~~g~i-~~~~~g~~~~~D~~~~E~eRgiTIks~~isl~~~~~~~~~~~~~~~~inlIDT   80 (222)
T cd01885           2 NICIIAHVDHGKTTLSDSLLASAGII-SEKLAGKARYMDSREDEQERGITMKSSAISLYFEYEEEDKADGNEYLINLIDS   80 (222)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCC-CHHCCCCEEECCCHHHHHHCCCEEEEEEEEEEEEECCCCCCCCCCEEEEEEEC
T ss_conf             69998668877999999999985984-12106634651424334205415862268999860344345688638999728


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC------CHH
Q ss_conf             00101112244789888899877776642000001122357887545455432102575322122221111------024
Q gi|254780484|r   92 PGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL------SPT  165 (212)
Q Consensus        92 pG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~------~~~  165 (212)
T Consensus        81 PGH~dF~~-------------ev~~al~~~DgailVVDa~eGv~~qT~~vl~~a~~~~l~~il~iNKiDRli~el~l~p~  147 (222)
T cd01885          81 PGHVDFSS-------------EVTAALRLCDGALVVVDAVEGVCVQTETVLRQALKERVKPVLVINKIDRLILELKLSPE  147 (222)
T ss_pred             CCHHHHHH-------------HHHHHHHHCCEEEEEECCCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHCCCCHH
T ss_conf             85698999-------------99999985681799610457857789999999998599979999890365001179989


Q ss_pred             HH----HHHHHHHHHHHHHC---------------CCCCCCEEEEECCCCCCHH--------HHHHHHHHHH
Q ss_conf             68----99999999997531---------------3689868999888889989--------9999999872
Q gi|254780484|r  166 TA----QETLEKTKYLIRNY---------------PTAHPEVIPTSSVKRKGIE--------VLRKAILETI  210 (212)
Q Consensus       166 ~~----~~~~~~~~~~~~~~---------------~~~~~~i~~vSA~~g~Gi~--------eL~~~I~~~l  210 (212)
T Consensus       148 day~~l~~iie~vN~~i~~~~~~~~~~~~~~~~~~~p~~gnV~f~Sa~~Gw~f~l~~fa~ly~ll~~iv~~i  219 (222)
T cd01885         148 EAYQRLARIIEQVNAIIGTYADEEFKEKDDEKWYFSPQKGNVAFGSALHGWGFTIIKFARIYAVLEMVVKHL  219 (222)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCHHHHCCCCCCCEEECCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             999999999999999998723043303553210207777838999832377126754121899999999628