HHsearch alignment for GI: 254780484 and conserved domain: cd01899

>cd01899 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg-like family and present in archaea and fungi. They are characterized by a distinct glycine-rich motif immediately following the Walker B motif. The Ygr210 and YyaF/YchF subfamilies appear to form one major branch of the Obg-like family. Among eukaryotes, the Ygr210 subfamily is represented only in fungi. These fungal proteins form a tight cluster with their archaeal orthologs, which suggests the possibility of horizontal transfer from archaea to fungi.
Probab=99.47  E-value=3.4e-14  Score=100.74  Aligned_cols=71  Identities=23%  Similarity=0.273  Sum_probs=48.0

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEE----EEE------------EEEE--EECCCEEEEEECCH
Q ss_conf             99974899889899999738973798738884145212026----655------------5678--50896499997600
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV----PKD------------FSNL--KNNLPAMALVDMPG   93 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~----~~~------------~~~~--~~~~~~~~~~DtpG   93 (212)
T Consensus         1 iGiVGlPNvGKSTlFnAlT~~~--~~~anyPF~TIePN~Gv~~v~v~~p~~~l~~~~~~~~~~~~~~~r~vPve~vDIAG   78 (318)
T cd01899           1 IGLVGKPNAGKSTFFNAATLAD--VEIANYPFTTIDPNVGVGYVRVECPCKELGVSCNPRYGKCIDGKRYVPVELIDVAG   78 (318)
T ss_pred             CCEECCCCCCHHHHHHHHHCCC--CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCEECCEEEEECHH
T ss_conf             9344889898899999997799--85127996676774162005568841666433043312014774003326752100


Q ss_pred             HHHHHHHHHHH
Q ss_conf             10111224478
Q gi|254780484|r   94 YGYARAPKKNV  104 (212)
Q Consensus        94 ~~~~~~~~~~~  104 (212)
T Consensus        79 LV~GAskG~GL   89 (318)
T cd01899          79 LVPGAHEGKGL   89 (318)
T ss_pred             HHCCCCCCCCC
T ss_conf             10566457766