HHsearch alignment for GI: 254780484 and conserved domain: cd01900

>cd01900 YchF YchF subfamily. YchF is a member of the Obg family, which includes four other subfamilies of GTPases: Obg, DRG, Ygr210, and NOG1. Obg is an essential gene that is involved in DNA replication in C. crescentus and Streptomyces griseus and is associated with the ribosome. Several members of the family, including YchF, possess the TGS domain related to the RNA-binding proteins. Experimental data and genomic analysis suggest that YchF may be part of a nucleoprotein complex and may function as a GTP-dependent translational factor.
Probab=99.24  E-value=7.9e-12  Score=87.13  Aligned_cols=66  Identities=27%  Similarity=0.240  Sum_probs=47.8

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEE-----------ECCCEEEEEECCHHHHHHH
Q ss_conf             9997489988989999973897379873888414521202665556785-----------0896499997600101112
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK-----------NNLPAMALVDMPGYGYARA   99 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~-----------~~~~~~~~~DtpG~~~~~~   99 (212)
T Consensus         1 ~GivGlpnvGKstlFnalT~~~--~~~~nypf~ti~pn~g~v~VpD~Rl~~L~~~~~p~k~i~a~vefvDIaGLvkgAs   77 (274)
T cd01900           1 IGIVGLPNVGKSTLFNALTKAG--AEAANYPFCTIEPNVGIVPVPDERLDKLAEIVKPKKIVPATIEFVDIAGLVKGAS   77 (274)
T ss_pred             CCEECCCCCCHHHHHHHHHCCC--CCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCC
T ss_conf             9564789998899999997799--8745899777268058996775658899873177651235789985465567752