HHsearch alignment for GI: 254780484 and conserved domain: cd04105

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta). SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane. Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP. SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane. The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane. SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon. High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ
Probab=99.11  E-value=1.8e-09  Score=73.62  Aligned_cols=161  Identities=21%  Similarity=0.229  Sum_probs=84.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
T Consensus         1 ptvLl~Gl~~aGKT~Lf~~L~~~~~~-----~T~tS~~~n~~~~~~--~~~~~~~~~~lvD~PGH~klR~~-----~~~~   68 (203)
T cd04105           1 PTVLLLGPSDSGKTALFTKLTTGKYR-----STVTSIEPNVATFIL--NSEGKGKKFRLVDVPGHPKLRDK-----LLET   68 (203)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCC-----CCCCCCCCCCEEEEC--CCCCCCCEEEEEECCCCHHHHHH-----HHHH
T ss_conf             95999907999899999999749988-----877888786206640--24668727999987996889999-----9999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCC---HHHHHHHHHH-----CCCCCCCCCCCCCCCCCC---HHHHHHHHHHHHHHH
Q ss_conf             99877776642000001122357887---5454554321-----025753221222211110---246899999999997
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVK---QIDQDVFSFL-----DKKAVSYQIVLTKIDKLS---PTTAQETLEKTKYLI  178 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~-----~~~~~~~~~v~nK~D~~~---~~~~~~~~~~~~~~~  178 (212)
T Consensus        69 ----~---~~~~~gIVfvVDs~~~~~~l~~~Ae~Ly~iL~~~~~~~~~iPvLIacNKqDl~tA~~~~~Ik~~LE~Ei~~l  141 (203)
T cd04105          69 ----L---KNSAKGIVFVVDSATFQKNLKDVAEFLYDILTDLEKVKNKIPVLIACNKQDLFTAKPAKKIKEQLEKELNTL  141 (203)
T ss_pred             ----H---HHCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             ----8---754989999996887511199999999999862664368998899986614345789999999999999999


Q ss_pred             HHC------------------------------CCCCCCEEEEECC-CCCCHHHHHHHHHHH
Q ss_conf             531------------------------------3689868999888-889989999999987
Q gi|254780484|r  179 RNY------------------------------PTAHPEVIPTSSV-KRKGIEVLRKAILET  209 (212)
Q Consensus       179 ~~~------------------------------~~~~~~i~~vSA~-~g~Gi~eL~~~I~~~  209 (212)
T Consensus       142 r~srs~~l~~~~~~~~~~~~~~~~~~~~F~F~~l~~~V~f~~gsv~~~~~~i~~~~~wi~e~  203 (203)
T cd04105         142 RESRSKSLSSLDGDEGSKESLGDKGGKSFEFDQLEGKVEFLEGSVKVDGGGIDGWEEWIDEL  203 (203)
T ss_pred             HHHHHCCCCCCCCCCCCCHHHCCCCCCCEEEECCCCCEEEEEEEEECCCCCCHHHHHHHHHC
T ss_conf             99774244334455553112147788852540279825899736725888705999999759