HHsearch alignment for GI: 254780484 and conserved domain: cd04108

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice. This isoform is associated with membrane ruffles and promotes macropinosome formation. Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further re
Probab=99.64  E-value=6.9e-16  Score=110.48  Aligned_cols=158  Identities=15%  Similarity=0.073  Sum_probs=87.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
T Consensus         2 KivlvGd~~VGKTsli~r~~~~~f~--~~y~~Tig~d----~~~k~~~v~~~~~~l~iwDtaGqe~f~~l~~~y~-----   70 (170)
T cd04108           2 KVIVVGDLSVGKTCLINRFCKDVFD--KNYKATIGVD----FEMERFEILGVPFSLQLWDTAGQERFKCIASTYY-----   70 (170)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCCCEE----EEEEEEEECCEEEEEEEEECCCCCCCCCCHHHHH-----
T ss_conf             8999998998989999999639889--9725634505----8999999999999999998999974664437773-----


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCC--HHHHH---HHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9877776642000001122357887--54545---543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVK--QIDQD---VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~---~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
T Consensus        71 --------r~a~~~ilvyDvt~~~Sf~~~~~w~~~~~~~~~~~~~~i~LvgNK~DL~~~~~~~~~~~~~~~~a~~---~~  139 (170)
T cd04108          71 --------RGAQAIIIVFDLTDVASLEHTRQWLEDALKENDPSSVLLFLVGTKKDLSSPAQYALMEQDAIKLAAE---MQ  139 (170)
T ss_pred             --------CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCEEEEEHHHHHHHHHH---CC
T ss_conf             --------2787589999789878999999999999985089998299999841379875576448999999987---79


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
T Consensus       140 ~~~~E~SAk~g~nV~e~F~~ia~~~  164 (170)
T cd04108         140 AEYWSVSALSGENVREFFFRVAALT  164 (170)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             8799985578818799999999999