HHsearch alignment for GI: 254780484 and conserved domain: cd04156

>cd04156 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling. ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers. ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL). ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter. In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity. In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation. The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=99.60  E-value=5.7e-15  Score=105.20  Aligned_cols=153  Identities=18%  Similarity=0.199  Sum_probs=88.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
T Consensus         1 KivilG~~~~GKTsil~r~~~~~~-~~--~~pTig--~~-----~~~~~~~~~~~l~iwD~~G~e~~~~~~~~y------   64 (160)
T cd04156           1 QVLLLGLDSAGKSTLLYKLKHAEL-VT--TIPTVG--FN-----VEMLQLEKHLSLTVWDVGGQEKMRTVWKCY------   64 (160)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCC-CC--CCCCCC--EE-----EEEEEECCEEEEEEEECCCCCCCCHHHHHH------
T ss_conf             999999999999999999956987-77--577615--03-----899998998999999789862474158877------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCC--HHHHH---HHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC-CCC
Q ss_conf             9877776642000001122357887--54545---54321025753221222211110246899999999997531-368
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVK--QIDQD---VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY-PTA  184 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~---~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~-~~~  184 (212)
T Consensus        65 -------~~~a~~iI~V~D~td~~~~~~~~~~~~~~l~~~~~~~~pili~~NK~Dl~~~~~~~ei~~~l~--~~~~~~~~  135 (160)
T cd04156          65 -------LENTDGLVYVVDSSDEARLDESQKELKHILKNEHIKGVPVVLLANKQDLPGALTAEEITRRFK--LKKYCSDR  135 (160)
T ss_pred             -------HCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHHH--HHHHHHCC
T ss_conf             -------456778999985686788787999999998663537874999998633656679999999986--99998539


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             986899988888998999999998
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
T Consensus       136 ~~~i~~~SAktGegi~e~f~~la~  159 (160)
T cd04156         136 DWYVQPCSAVTGEGLAEAFRKLAS  159 (160)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHC
T ss_conf             999998668849599999999857