HHsearch alignment for GI: 254780484 and conserved domain: cd04157

>cd04157 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases. Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development. Arl6 is also believed to have a role in cilia or flagella function. Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p. Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism. Older literature suggests that A
Probab=99.55  E-value=9.5e-14  Score=98.18  Aligned_cols=153  Identities=17%  Similarity=0.249  Sum_probs=88.2

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99974899889899999738973798738884145212026655567850896499997600101112244789888899
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLI  111 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~  111 (212)
T Consensus         2 Il~lGl~~sGKTtil~~l~~~~~~~-~~~~pT~G--~~------~~~~~~~~~~~~iwD~~G~~~~r~lw~~--------   64 (162)
T cd04157           2 ILVVGLDNSGKTTIINQLKPENAQS-QIIVPTVG--FN------VESFEKGNLSFTAFDMSGQGKYRGLWEH--------   64 (162)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCCCC-CCCCCCCC--EE------EEEEEECCEEEEEEECCCCCCCCHHHHH--------
T ss_conf             9999999998899999997289875-64168507--57------8999839988999985887442055898--------


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCHH--HHHHHHHH-----CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             87777664200000112235788754--54554321-----025753221222211110246899999999997531368
Q gi|254780484|r  112 VRYLSERSTLRCVYLLIDCRHGVKQI--DQDVFSFL-----DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       112 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~-----~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
T Consensus        65 --y---~~~~~~iI~VvDssd~~~~~~~~~~l~~ll~~~~~~~~~~PiLI~~NK~D~~~~~~~~ei~~~l~l--~~~~~~  137 (162)
T cd04157          65 --Y---YKNIQGIIFVIDSSDRLRLVVVKDELELLLNHPDIKHRRVPILFFANKMDLPDALTAVKITQLLGL--ENIKDK  137 (162)
T ss_pred             --H---HCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHHCH--HHHCCC
T ss_conf             --7---056744899970763888999999999997176551798459999814778899999999988586--652489


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             986899988888998999999998
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
T Consensus       138 ~~~i~~~SA~tG~Gi~e~f~WL~~  161 (162)
T cd04157         138 PWHIFASNALTGEGLDEGVQWLQA  161 (162)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHC
T ss_conf             649999789789798999999865