HHsearch alignment for GI: 254780484 and conserved domain: cd04173

>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd3/RhoE/Rho8. Rnd2/Rho7 is transiently expressed in radially migrating cells in the brain while they are within the subventricular zone of the hippocampus and cerebral cortex. These migrating cells typically develop into pyramidal neurons. Cells that exogenously expressed Rnd2/Rho7 failed to migrate to upper layers of the brain, suggesting that Rnd2/Rho7 plays a role in the radial migration and morphological changes of developing pyramidal neurons, and that Rnd2/Rho7 degradation is necessary for proper cellular migration. The Rnd2/Rho7 GEF Rapostlin is found primarily in the brain and together with Rnd2/Rho7 induces dendrite branching. Unlike Rnd1/Rho6 and Rnd3/RhoE/Rho8, which are RhoA antagonists, Rnd2/Rho7 binds the GEF Pragmin and significantly stimulates RhoA activity and Rho-A mediated cell contraction. Rnd2/Rho7 is also found to be expressed in sperma
Probab=99.36  E-value=2.6e-11  Score=84.12  Aligned_cols=158  Identities=13%  Similarity=0.119  Sum_probs=83.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
T Consensus         2 ~KiVlvGD~~VGKTsLl~~f~~~~F--~~~y~pTi--~~~---~~~~~~vd~~~v~L~iWDTAGqE~y~~lr~-------   67 (222)
T cd04173           2 CKIVVVGDAECGKTALLQVFAKDAY--PGSYVPTV--FEN---YTASFEIDKRRIELNMWDTSGSSYYDNVRP-------   67 (222)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC--CCCCCCCE--EEE---EEEEEEECCEEEEEEEECCCCCCHHHHHHH-------
T ss_conf             0999989899898999999963999--99847845--877---899999999999999976888503455678-------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHH--HHCCCCCCCCCCCCCCCCCCHHHHHHHHHH----------HH
Q ss_conf             998777766420000011223578--8754545543--210257532212222111102468999999----------99
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHG--VKQIDQDVFS--FLDKKAVSYQIVLTKIDKLSPTTAQETLEK----------TK  175 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~--~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~----------~~  175 (212)
T Consensus        68 ---~yyr~a~---~~llvfdit~~~SF~~v~~~W~~ei~~~~p~~piiLVGnK~DLR~d~~~~~el~~~~~~pVt~eeg~  141 (222)
T cd04173          68 ---LAYPDSD---AVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGT  141 (222)
T ss_pred             ---HHCCCCC---EEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHH
T ss_conf             ---7503698---9999983897788999999999999985899978999587424568788999985578887899999


Q ss_pred             HHHHHCCCCCCCEEEEECCCCC-CHHHHHHHHHHH
Q ss_conf             9975313689868999888889-989999999987
Q gi|254780484|r  176 YLIRNYPTAHPEVIPTSSVKRK-GIEVLRKAILET  209 (212)
Q Consensus       176 ~~~~~~~~~~~~i~~vSA~~g~-Gi~eL~~~I~~~  209 (212)
T Consensus       142 ~lA~--~~ga~~y~EcSAk~~~n~V~evF~~a~~~  174 (222)
T cd04173         142 VLAK--QVGAVSYVECSSRSSERSVRDVFHVATVA  174 (222)
T ss_pred             HHHH--HCCCCEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             9999--76998899888486874989999999999