HHsearch alignment for GI: 254780484 and conserved domain: cd04176

>cd04176 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Rap subfamily of the Ras family. It consists of Rap2a, Rap2b, and Rap2c. Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton. In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments. In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway. The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis. Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation. A number of additional effector proteins for Rap2 have been identified, incl
Probab=99.58  E-value=2e-14  Score=102.10  Aligned_cols=156  Identities=15%  Similarity=0.203  Sum_probs=88.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
T Consensus         3 KivllGd~~VGKTsli~r~~~~~f~~--~y~pT-i~~--~--~~k~i~~~~~~~~l~iwDtaG~e~~~~~~~--------   67 (163)
T cd04176           3 KVVVLGSGGVGKSALTVQFVSGTFIE--KYDPT-IED--F--YRKEIEVDSSPSVLEILDTAGTEQFASMRD--------   67 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCCC--CCCCC-CCC--E--EEEEEEECCEEEEEEEEECCCCHHHHHHHH--------
T ss_conf             99998999978999999997098997--55885-233--1--679999888999999998988542567889--------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCH-----HHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             98777766420000011223578875-----4545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQ-----IDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
T Consensus        68 --~~~---~~a~~~ilvydit~~~Sf~~l~~~~~~i~~~~~~~~~piilVgNK~DL~~~r~V~~--~e~~~~a~~~---~  137 (163)
T cd04176          68 --LYI---KNGQGFIVVYSLVNQQTFQDIKPMRDQIVRVKGYEKVPIILVGNKVDLESEREVSS--AEGRALAEEW---G  137 (163)
T ss_pred             --HHH---CCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCH--HHHHHHHHHC---C
T ss_conf             --985---57865689712798899999999999999973899963999743134001276999--9999999985---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             86899988888998999999998728
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
T Consensus       138 ~~~~E~SAk~~~nV~~~F~~l~~~i~  163 (163)
T cd04176         138 CPFMETSAKSKTMVNELFAEIVRQMN  163 (163)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHC
T ss_conf             98999856878177999999999539