Query         gi|254780484|ref|YP_003064897.1| GTPase EngB [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 212
No_of_seqs    114 out of 10511
Neff          9.6 
Searched_HMMs 39220
Date          Sun May 29 17:27:56 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780484.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK00454 engB GTPase EngB; Rev 100.0 1.1E-40 2.8E-45  253.1  19.8  193    9-211     4-196 (196)
  2 TIGR03598 GTPase_YsxC ribosome 100.0 1.1E-37 2.8E-42  235.8  17.5  178   13-200     2-179 (179)
  3 COG0218 Predicted GTPase [Gene 100.0 1.3E-36 3.3E-41  229.7  18.1  192   11-211     6-197 (200)
  4 cd01876 YihA_EngB The YihA (En 100.0 7.3E-34 1.9E-38  213.8  17.4  170   31-210     1-170 (170)
  5 cd01895 EngA2 EngA2 subfamily. 100.0 1.6E-31 4.1E-36  200.3  17.7  171   28-209     1-173 (174)
  6 PRK09518 bifunctional cytidyla 100.0 9.4E-32 2.4E-36  201.7  16.2  172   27-209   450-621 (714)
  7 PRK03003 engA GTP-binding prot 100.0 3.4E-31 8.7E-36  198.5  15.9  168   22-210    31-198 (474)
  8 cd04163 Era Era subfamily.  Er 100.0 7.4E-31 1.9E-35  196.5  17.3  165   30-210     4-168 (168)
  9 PRK00089 era GTP-binding prote 100.0 6.5E-31 1.7E-35  196.9  16.2  163   31-210    10-172 (296)
 10 PRK00093 engA GTP-binding prot 100.0 1.4E-30 3.6E-35  194.9  15.3  173   26-209   169-343 (438)
 11 PRK09518 bifunctional cytidyla 100.0 1.9E-30 4.8E-35  194.2  15.7  166   25-211   275-440 (714)
 12 COG1160 Predicted GTPases [Gen 100.0 1.1E-30 2.9E-35  195.5  14.2  161   30-210     4-164 (444)
 13 PRK03003 engA GTP-binding prot 100.0   4E-30   1E-34  192.3  16.8  172   28-210   210-381 (474)
 14 PRK00093 engA GTP-binding prot 100.0 1.1E-30 2.7E-35  195.6  13.3  163   29-211     1-163 (438)
 15 PRK04213 GTP-binding protein;  100.0 5.4E-30 1.4E-34  191.6  15.9  167   29-210     1-183 (195)
 16 TIGR03594 GTPase_EngA ribosome 100.0 7.3E-30 1.9E-34  190.8  15.3  174   26-210   169-343 (429)
 17 TIGR03594 GTPase_EngA ribosome 100.0 8.9E-30 2.3E-34  190.3  15.2  160   31-211     1-160 (429)
 18 cd01894 EngA1 EngA1 subfamily. 100.0 6.7E-30 1.7E-34  191.0  14.4  157   33-210     1-157 (157)
 19 pfam02421 FeoB_N Ferrous iron  100.0 8.5E-30 2.2E-34  190.4  13.9  160   31-211     1-160 (188)
 20 cd01897 NOG NOG1 is a nucleola 100.0 1.5E-29 3.8E-34  189.0  14.6  162   30-210     1-167 (168)
 21 cd01878 HflX HflX subfamily.   100.0 7.8E-29   2E-33  184.9  15.2  163   26-210    38-204 (204)
 22 cd01879 FeoB Ferrous iron tran 100.0 9.5E-29 2.4E-33  184.4  13.8  157   34-211     1-157 (158)
 23 cd04164 trmE TrmE (MnmE, ThdF, 100.0 2.1E-28 5.4E-33  182.4  15.5  155   30-210     2-156 (157)
 24 cd00880 Era_like Era (E. coli  100.0 2.2E-28 5.5E-33  182.3  15.3  163   34-210     1-163 (163)
 25 cd01898 Obg Obg subfamily.  Th 100.0 2.2E-28 5.5E-33  182.4  14.0  162   31-210     2-170 (170)
 26 COG1159 Era GTPase [General fu 100.0 7.1E-28 1.8E-32  179.4  14.6  164   31-211     8-172 (298)
 27 cd04171 SelB SelB subfamily.   100.0 2.2E-27 5.7E-32  176.5  16.0  160   31-209     2-164 (164)
 28 PRK05291 trmE tRNA modificatio 100.0 1.8E-27 4.5E-32  177.1  15.0  153   28-211   215-367 (445)
 29 COG1160 Predicted GTPases [Gen 100.0 7.4E-28 1.9E-32  179.3  12.4  172   28-210   177-350 (444)
 30 COG0486 ThdF Predicted GTPase  100.0 4.3E-27 1.1E-31  174.9  14.9  161   28-211   216-376 (454)
 31 cd01887 IF2_eIF5B IF2/eIF5B (i  99.9 1.8E-26 4.5E-31  171.4  15.9  162   30-209     1-164 (168)
 32 cd01881 Obg_like The Obg-like   99.9 3.6E-26 9.2E-31  169.6  13.8  158   34-210     1-176 (176)
 33 cd01896 DRG The developmentall  99.9 4.9E-26 1.3E-30  168.8  14.2  156   31-212     2-227 (233)
 34 pfam00009 GTP_EFTU Elongation   99.9   1E-25 2.7E-30  166.9  15.6  169   28-210     2-183 (185)
 35 TIGR03156 GTP_HflX GTP-binding  99.9   3E-26 7.7E-31  170.0  12.8  162   26-210   186-351 (351)
 36 pfam10662 PduV-EutP Ethanolami  99.9 3.5E-25 8.8E-30  163.9  13.4  141   31-208     3-143 (143)
 37 PRK09554 feoB ferrous iron tra  99.9 6.3E-25 1.6E-29  162.4  12.5  163   30-209     4-166 (772)
 38 cd00881 GTP_translation_factor  99.9 5.9E-24 1.5E-28  156.8  16.0  165   32-210     2-186 (189)
 39 PRK11058 putative GTPase HflX;  99.9 2.4E-24   6E-29  159.1  12.0  165   26-211   194-362 (426)
 40 PRK12299 obgE GTPase ObgE; Rev  99.9 2.4E-24 6.1E-29  159.1  11.0  162   31-211   160-327 (334)
 41 TIGR00437 feoB ferrous iron tr  99.9 1.5E-24 3.9E-29  160.3   9.6  153   36-209     1-154 (733)
 42 COG0370 FeoB Fe2+ transport sy  99.9 1.8E-23 4.7E-28  154.0  13.5  159   30-209     4-162 (653)
 43 PRK12298 obgE GTPase ObgE; Rev  99.9 6.7E-24 1.7E-28  156.5  11.1  164   31-211   161-333 (380)
 44 COG1084 Predicted GTPase [Gene  99.9 4.2E-23 1.1E-27  152.0  13.0  173   19-209   156-334 (346)
 45 TIGR00450 thdF tRNA modificati  99.9 7.9E-24   2E-28  156.1   9.1  124   28-163   224-347 (473)
 46 COG2262 HflX GTPases [General   99.9   2E-23 5.1E-28  153.8  10.9  164   26-211   189-356 (411)
 47 KOG1191 consensus               99.9   1E-22 2.6E-27  149.7   9.4  170   28-210   267-449 (531)
 48 PRK12296 obgE GTPase ObgE; Rev  99.9 4.8E-22 1.2E-26  145.9  11.4  160   31-210   161-339 (495)
 49 PRK12312 infB translation init  99.9 3.5E-21   9E-26  140.9  13.5  160   26-207   114-275 (610)
 50 PRK12297 obgE GTPase ObgE; Rev  99.9 7.6E-22 1.9E-26  144.7   8.6  161   31-211   160-329 (429)
 51 KOG1423 consensus               99.9 9.3E-21 2.4E-25  138.5  13.1  173   30-210    73-270 (379)
 52 CHL00189 infB translation init  99.9 6.9E-21 1.8E-25  139.2  12.2  162   28-207   271-434 (770)
 53 PRK05306 infB translation init  99.8 3.7E-20 9.4E-25  135.0  12.8  161   26-207   338-500 (839)
 54 cd01889 SelB_euk SelB subfamil  99.8 1.6E-19 4.2E-24  131.3  14.3  167   31-210     2-185 (192)
 55 cd01890 LepA LepA subfamily.    99.8 1.2E-19 2.9E-24  132.2  13.5  163   31-210     2-176 (179)
 56 PRK04004 translation initiatio  99.8 1.5E-19 3.8E-24  131.5  12.6  165   28-207     4-213 (592)
 57 COG0536 Obg Predicted GTPase [  99.8 3.9E-20   1E-24  134.9   9.4  163   31-211   161-333 (369)
 58 TIGR00475 selB selenocysteine-  99.8 2.7E-19   7E-24  130.0  12.9  167   31-211     2-172 (627)
 59 KOG1489 consensus               99.8   6E-20 1.5E-24  133.8   8.4  162   29-210   196-366 (366)
 60 cd01888 eIF2_gamma eIF2-gamma   99.8 1.3E-18 3.3E-23  126.2  13.6  166   31-210     2-198 (203)
 61 COG1163 DRG Predicted GTPase [  99.8 1.8E-19 4.7E-24  131.0   9.2  169   24-212    58-290 (365)
 62 PRK10512 selenocysteinyl-tRNA-  99.8 1.7E-18 4.2E-23  125.5  13.9  161   31-210     2-165 (615)
 63 cd01891 TypA_BipA TypA (tyrosi  99.8 5.7E-18 1.4E-22  122.5  15.8  169   28-210     1-191 (194)
 64 KOG2486 consensus               99.8 9.7E-20 2.5E-24  132.6   5.9  191   13-212   118-317 (320)
 65 COG0532 InfB Translation initi  99.8 1.7E-18 4.4E-23  125.4  11.8  164   27-208     3-167 (509)
 66 TIGR02729 Obg_CgtA GTP-binding  99.8 3.8E-19 9.7E-24  129.2   7.5  117   32-162   161-295 (296)
 67 KOG1145 consensus               99.8 1.9E-17 4.7E-22  119.5  12.2  161   26-207   150-312 (683)
 68 cd01884 EF_Tu EF-Tu subfamily.  99.7 4.5E-17 1.1E-21  117.3  12.8  167   31-210     4-192 (195)
 69 PRK04000 translation initiatio  99.7 3.9E-17 9.9E-22  117.6  11.4  166   31-210    10-199 (410)
 70 pfam00025 Arf ADP-ribosylation  99.7 2.8E-17 7.1E-22  118.5  10.6  157   28-210    13-174 (174)
 71 TIGR01393 lepA GTP-binding pro  99.7 1.8E-17 4.6E-22  119.5   9.0  164   28-210     2-180 (598)
 72 cd04159 Arl10_like Arl10-like   99.7 4.4E-17 1.1E-21  117.4  11.0  154   31-209     1-159 (159)
 73 cd04155 Arl3 Arl3 subfamily.    99.7 3.5E-17 8.8E-22  117.9  10.4  157   27-209    12-173 (173)
 74 KOG1490 consensus               99.7 1.4E-17 3.5E-22  120.3   8.3  177   20-210   157-340 (620)
 75 cd04154 Arl2 Arl2 subfamily.    99.7 6.2E-17 1.6E-21  116.5  10.3  155   28-208    13-172 (173)
 76 cd04160 Arfrp1 Arfrp1 subfamil  99.7 8.2E-17 2.1E-21  115.8  10.7  160   32-208     2-166 (167)
 77 cd00878 Arf_Arl Arf (ADP-ribos  99.7 8.4E-17 2.1E-21  115.7   9.5  152   31-208     1-157 (158)
 78 PTZ00327 eukaryotic translatio  99.7   7E-16 1.8E-20  110.4  12.7  167   31-210    39-235 (460)
 79 cd04165 GTPBP1_like GTPBP1-lik  99.7 3.4E-15 8.7E-20  106.5  13.2  167   31-208     1-220 (224)
 80 pfam00071 Ras Ras family. Incl  99.7 1.1E-15 2.8E-20  109.3  10.6  156   31-210     1-160 (162)
 81 KOG0462 consensus               99.6 1.1E-15 2.9E-20  109.2   9.8  174   20-210    51-234 (650)
 82 cd04108 Rab36_Rab34 Rab34/Rab3  99.6 6.9E-16 1.8E-20  110.5   7.9  158   31-210     2-164 (170)
 83 PRK12317 elongation factor 1-a  99.6   8E-15   2E-19  104.4  12.7  160   30-202     8-197 (426)
 84 COG3596 Predicted GTPase [Gene  99.6 3.6E-15 9.1E-20  106.4  10.9  166   32-210    42-221 (296)
 85 PRK12736 elongation factor Tu;  99.6 7.1E-15 1.8E-19  104.6  11.9  166   31-209    14-199 (394)
 86 PRK12735 elongation factor Tu;  99.6 1.6E-14   4E-19  102.7  13.6  168   30-210    13-202 (396)
 87 cd04166 CysN_ATPS CysN_ATPS su  99.6 1.1E-14 2.7E-19  103.6  12.7  158   31-201     1-184 (208)
 88 cd01893 Miro1 Miro1 subfamily.  99.6 1.2E-14 2.9E-19  103.4  12.7  159   30-211     1-164 (166)
 89 cd04139 RalA_RalB RalA/RalB su  99.6 3.4E-15 8.6E-20  106.5  10.0  155   31-210     2-161 (164)
 90 KOG0410 consensus               99.6 3.6E-15 9.2E-20  106.3  10.0  158   26-210   175-340 (410)
 91 cd00154 Rab Rab family.  Rab G  99.6 4.6E-15 1.2E-19  105.7  10.3  155   30-208     1-159 (159)
 92 PRK00049 elongation factor Tu;  99.6 1.8E-14 4.5E-19  102.4  13.2  167   30-209    13-202 (397)
 93 cd04128 Spg1 Spg1p.  Spg1p (se  99.6 4.7E-15 1.2E-19  105.7  10.3  157   30-210     1-165 (182)
 94 cd00876 Ras Ras family.  The R  99.6 5.7E-15 1.5E-19  105.2  10.7  155   31-210     1-160 (160)
 95 cd04152 Arl4_Arl7 Arl4/Arl7 su  99.6 1.6E-14   4E-19  102.7  12.7  161   30-210     4-169 (183)
 96 cd04117 Rab15 Rab15 subfamily.  99.6 1.4E-14 3.7E-19  102.9  11.9  156   31-210     2-161 (161)
 97 cd04151 Arl1 Arl1 subfamily.    99.6   1E-14 2.7E-19  103.7  11.1  153   31-209     1-158 (158)
 98 cd04156 ARLTS1 ARLTS1 subfamil  99.6 5.7E-15 1.5E-19  105.2   9.3  153   31-208     1-159 (160)
 99 cd04132 Rho4_like Rho4-like su  99.6 7.9E-15   2E-19  104.4   9.9  159   31-210     2-166 (187)
100 PRK05433 GTP-binding protein L  99.6 3.3E-15 8.3E-20  106.6   7.7  169   25-210     3-183 (601)
101 PTZ00258 GTP-binding protein;   99.6 2.7E-14 6.9E-19  101.3  12.4   72   28-101    21-103 (392)
102 cd04124 RabL2 RabL2 subfamily.  99.6 1.5E-14 3.9E-19  102.7  11.0  154   30-210     1-157 (161)
103 cd04137 RheB Rheb (Ras Homolog  99.6 5.7E-15 1.4E-19  105.2   8.8  155   31-210     3-162 (180)
104 cd01883 EF1_alpha Eukaryotic e  99.6 5.8E-14 1.5E-18   99.4  13.9  157   32-201     2-195 (219)
105 PTZ00132 GTP-binding nuclear p  99.6 1.3E-14 3.3E-19  103.2   9.9  154   31-210     8-164 (209)
106 cd04136 Rap_like Rap-like subf  99.6 7.9E-15   2E-19  104.4   8.5  156   31-211     3-163 (163)
107 cd04116 Rab9 Rab9 subfamily.    99.6 3.7E-15 9.4E-20  106.3   6.7  161   26-210     2-170 (170)
108 cd04176 Rap2 Rap2 subgroup.  T  99.6   2E-14   5E-19  102.1  10.3  156   31-211     3-163 (163)
109 cd01868 Rab11_like Rab11-like.  99.6 1.5E-14 3.8E-19  102.8   9.7  158   29-210     3-164 (165)
110 cd01863 Rab18 Rab18 subfamily.  99.6 1.1E-14 2.7E-19  103.7   8.9  156   30-210     1-161 (161)
111 cd04168 TetM_like Tet(M)-like   99.6 6.5E-14 1.7E-18   99.1  12.9  165   32-210     2-234 (237)
112 cd04142 RRP22 RRP22 subfamily.  99.6 1.3E-14 3.3E-19  103.2   9.2  166   30-210     1-173 (198)
113 cd04113 Rab4 Rab4 subfamily.    99.6 8.8E-15 2.2E-19  104.1   8.3  156   31-210     2-161 (161)
114 cd04120 Rab12 Rab12 subfamily.  99.6 1.7E-14 4.4E-19  102.4   9.6  158   30-210     1-162 (202)
115 cd04101 RabL4 RabL4 (Rab-like4  99.6 3.8E-14 9.7E-19  100.5  11.4  160   30-211     1-164 (164)
116 cd01858 NGP_1 NGP-1.  Autoanti  99.6 5.7E-15 1.5E-19  105.2   7.2   58   27-94    100-157 (157)
117 cd01885 EF2 EF2 (for archaea a  99.6 7.4E-14 1.9E-18   98.8  12.8  166   31-210     2-219 (222)
118 cd04138 H_N_K_Ras_like H-Ras/N  99.6 1.5E-14 3.7E-19  102.9   9.1  154   31-210     3-161 (162)
119 cd04167 Snu114p Snu114p subfam  99.6 2.1E-13 5.3E-18   96.2  15.1  167   31-210     2-210 (213)
120 cd04177 RSR1 RSR1 subgroup.  R  99.6 1.1E-14 2.9E-19  103.5   8.5  156   31-210     3-163 (168)
121 cd00877 Ran Ran (Ras-related n  99.6 2.6E-14 6.6E-19  101.4  10.2  152   31-210     2-158 (166)
122 cd04145 M_R_Ras_like M-Ras/R-R  99.6 1.3E-14 3.2E-19  103.2   8.6  155   31-210     4-163 (164)
123 cd04127 Rab27A Rab27a subfamil  99.6 3.1E-14   8E-19  100.9  10.5  162   29-210     4-176 (180)
124 cd04114 Rab30 Rab30 subfamily.  99.6 1.9E-14 4.9E-19  102.2   9.4  158   29-210     7-168 (169)
125 cd04153 Arl5_Arl8 Arl5/Arl8 su  99.6 1.6E-14 4.1E-19  102.6   9.0  158   24-208    11-173 (174)
126 smart00173 RAS Ras subfamily o  99.6 1.6E-14 4.1E-19  102.6   8.7  155   31-210     2-161 (164)
127 cd04125 RabA_like RabA-like su  99.6 2.6E-14 6.6E-19  101.4   9.5  156   31-210     2-161 (188)
128 cd04123 Rab21 Rab21 subfamily.  99.6 3.1E-14   8E-19  100.9   9.8  157   30-210     1-161 (162)
129 cd01865 Rab3 Rab3 subfamily.    99.6 4.7E-14 1.2E-18   99.9  10.6  157   30-210     2-162 (165)
130 smart00175 RAB Rab subfamily o  99.6 2.2E-14 5.7E-19  101.8   8.8  157   30-210     1-161 (164)
131 cd01867 Rab8_Rab10_Rab13_like   99.6   3E-14 7.5E-19  101.1   9.4  157   30-210     4-164 (167)
132 cd04147 Ras_dva Ras-dva subfam  99.6 1.4E-14 3.7E-19  102.9   7.7  158   31-211     1-163 (198)
133 cd01866 Rab2 Rab2 subfamily.    99.6 6.3E-14 1.6E-18   99.2  11.0  157   30-210     5-165 (168)
134 smart00177 ARF ARF-like small   99.6 2.7E-14   7E-19  101.3   9.1  160   26-211    10-174 (175)
135 cd04122 Rab14 Rab14 subfamily.  99.6 1.7E-14 4.2E-19  102.5   8.0  157   30-210     3-163 (166)
136 cd04104 p47_IIGP_like p47 (47-  99.6 9.1E-14 2.3E-18   98.3  11.8  163   30-210     2-183 (197)
137 cd04175 Rap1 Rap1 subgroup.  T  99.6 2.1E-14 5.3E-19  102.0   8.5  156   31-211     3-163 (164)
138 PTZ00141 elongation factor 1 a  99.5 1.7E-13 4.4E-18   96.7  13.1  159   30-201     8-201 (443)
139 cd04118 Rab24 Rab24 subfamily.  99.5 4.7E-14 1.2E-18   99.9  10.0  158   30-210     1-165 (193)
140 cd04149 Arf6 Arf6 subfamily.    99.5 7.4E-14 1.9E-18   98.8  11.0  154   29-208     9-167 (168)
141 cd04110 Rab35 Rab35 subfamily.  99.5 3.6E-14 9.2E-19  100.6   9.3  157   29-210     6-166 (199)
142 cd04121 Rab40 Rab40 subfamily.  99.5 4.6E-14 1.2E-18  100.0   9.8  158   29-210     6-166 (189)
143 cd04157 Arl6 Arl6 subfamily.    99.5 9.5E-14 2.4E-18   98.2  11.4  153   32-208     2-161 (162)
144 cd01849 YlqF_related_GTPase Yl  99.5 1.4E-14 3.6E-19  102.9   7.2   57   28-94     99-155 (155)
145 cd01859 MJ1464 MJ1464.  This f  99.5 1.3E-14 3.4E-19  103.0   7.0   57   28-94    100-156 (156)
146 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  99.5   4E-14   1E-18  100.3   9.4  157   30-210     3-163 (166)
147 cd04107 Rab32_Rab38 Rab38/Rab3  99.5 8.7E-14 2.2E-18   98.4  11.0  155   31-210     2-167 (201)
148 PTZ00133 ADP-ribosylation fact  99.5 3.7E-14 9.3E-19  100.6   9.0  157   28-210    16-177 (182)
149 cd01860 Rab5_related Rab5-rela  99.5 7.5E-14 1.9E-18   98.7  10.6  157   30-210     2-162 (163)
150 cd04141 Rit_Rin_Ric Rit/Rin/Ri  99.5 2.7E-14 6.8E-19  101.3   8.3  156   30-210     3-163 (172)
151 cd00882 Ras_like_GTPase Ras-li  99.5 1.8E-14 4.6E-19  102.3   7.4  152   34-208     1-157 (157)
152 cd01856 YlqF YlqF.  Proteins o  99.5 1.5E-14 3.7E-19  102.8   6.9   57   28-94    114-170 (171)
153 cd01864 Rab19 Rab19 subfamily.  99.5 7.7E-14   2E-18   98.7  10.5  158   30-210     4-165 (165)
154 CHL00071 tufA elongation facto  99.5 2.1E-13 5.3E-18   96.2  12.6  153   31-196    14-178 (409)
155 cd01870 RhoA_like RhoA-like su  99.5 9.2E-14 2.3E-18   98.2  10.8  160   29-210     1-174 (175)
156 cd04134 Rho3 Rho3 subfamily.    99.5 8.8E-14 2.2E-18   98.4  10.6  160   31-210     2-173 (189)
157 cd04126 Rab20 Rab20 subfamily.  99.5 1.4E-13 3.5E-18   97.3  11.5  157   30-210     1-189 (220)
158 cd04150 Arf1_5_like Arf1-Arf5-  99.5 3.6E-14 9.2E-19  100.6   8.5  153   30-208     1-158 (159)
159 cd01862 Rab7 Rab7 subfamily.    99.5 3.3E-14 8.5E-19  100.8   8.3  158   30-210     1-166 (172)
160 cd04119 RJL RJL (RabJ-Like) su  99.5   1E-13 2.6E-18   98.0  10.5  157   30-210     1-166 (168)
161 cd04169 RF3 RF3 subfamily.  Pe  99.5 4.5E-13 1.2E-17   94.3  13.8  120   30-162     3-136 (267)
162 cd04112 Rab26 Rab26 subfamily.  99.5 4.3E-14 1.1E-18  100.2   8.4  157   31-210     2-162 (191)
163 cd04106 Rab23_lke Rab23-like s  99.5 9.7E-14 2.5E-18   98.1  10.2  155   30-209     1-161 (162)
164 cd04111 Rab39 Rab39 subfamily.  99.5 5.7E-14 1.5E-18   99.4   9.0  157   30-210     3-165 (211)
165 cd04133 Rop_like Rop subfamily  99.5 1.1E-13 2.9E-18   97.8  10.4  159   30-210     2-172 (176)
166 cd01857 HSR1_MMR1 HSR1/MMR1.    99.5 2.5E-14 6.5E-19  101.5   6.8   57   29-95     83-139 (141)
167 cd00157 Rho Rho (Ras homology)  99.5 9.2E-14 2.4E-18   98.2   9.5  158   30-209     1-171 (171)
168 cd04148 RGK RGK subfamily.  Th  99.5 5.3E-14 1.4E-18   99.6   8.2  156   31-210     2-162 (221)
169 TIGR01394 TypA_BipA GTP-bindin  99.5 2.4E-14 6.2E-19  101.6   6.0  166   31-210     3-201 (609)
170 smart00174 RHO Rho (Ras homolo  99.5 3.2E-13 8.2E-18   95.1  11.7  157   32-210     1-171 (174)
171 cd01871 Rac1_like Rac1-like su  99.5 2.1E-13 5.4E-18   96.2  10.5  160   30-210     2-174 (174)
172 PTZ00336 elongation factor 1-a  99.5 4.6E-13 1.2E-17   94.2  12.1  158   31-201     9-203 (449)
173 PRK09601 translation-associate  99.5 2.9E-13 7.4E-18   95.4  11.0   68   30-99      3-81  (364)
174 cd01892 Miro2 Miro2 subfamily.  99.5   2E-13   5E-18   96.4  10.1  161   28-210     3-165 (169)
175 cd04178 Nucleostemin_like Nucl  99.5 5.5E-14 1.4E-18   99.6   7.2   57   28-94    116-172 (172)
176 TIGR03596 GTPase_YlqF ribosome  99.5 4.1E-14   1E-18  100.3   6.6   61   29-99    118-178 (276)
177 pfam01926 MMR_HSR1 GTPase of u  99.5 9.8E-14 2.5E-18   98.1   8.3  106   41-158     1-106 (106)
178 PRK00741 prfC peptide chain re  99.5 9.4E-13 2.4E-17   92.4  13.3  122   28-162     9-144 (526)
179 PRK09563 rbgA ribosomal biogen  99.5 5.5E-14 1.4E-18   99.5   6.9   61   29-99    121-181 (282)
180 cd01861 Rab6 Rab6 subfamily.    99.5 1.5E-13 3.8E-18   97.0   9.1  156   31-210     2-161 (161)
181 cd01886 EF-G Elongation factor  99.5 1.4E-12 3.7E-17   91.4  14.1  118   32-162     2-129 (270)
182 PRK05506 bifunctional sulfate   99.5 7.4E-13 1.9E-17   93.0  12.2  161   28-201     6-194 (613)
183 PRK12739 elongation factor G;   99.5 1.8E-12 4.5E-17   90.9  14.1  128   22-162     3-140 (693)
184 cd04158 ARD1 ARD1 subfamily.    99.5 1.3E-13 3.3E-18   97.4   8.3  154   31-210     1-160 (169)
185 cd04115 Rab33B_Rab33A Rab33B/R  99.5 2.1E-13 5.3E-18   96.2   9.3  159   29-210     2-168 (170)
186 cd01875 RhoG RhoG subfamily.    99.5 4.9E-13 1.3E-17   94.1  11.2  161   29-210     3-176 (191)
187 cd04170 EF-G_bact Elongation f  99.5   1E-12 2.6E-17   92.3  12.7  118   32-162     2-129 (268)
188 PRK10218 GTP-binding protein;   99.5 2.4E-13 6.2E-18   95.8   9.5  170   27-210     3-194 (607)
189 PRK13351 elongation factor G;   99.5 1.2E-12 3.1E-17   91.8  12.7  128   23-163     2-139 (687)
190 COG0012 Predicted GTPase, prob  99.5 2.1E-13 5.3E-18   96.2   8.7   68   30-99      3-82  (372)
191 PRK05124 cysN sulfate adenylyl  99.5 1.2E-12 2.9E-17   91.9  12.5  162   28-202    26-216 (475)
192 cd04140 ARHI_like ARHI subfami  99.5 3.6E-13 9.1E-18   94.9   9.9  155   31-210     3-164 (165)
193 cd04103 Centaurin_gamma Centau  99.5 1.4E-13 3.5E-18   97.2   7.7  153   30-210     1-158 (158)
194 cd04144 Ras2 Ras2 subfamily.    99.5 2.1E-13 5.3E-18   96.2   8.3  155   31-210     1-162 (190)
195 cd01899 Ygr210 Ygr210 subfamil  99.5 3.4E-14 8.7E-19  100.7   4.1   71   32-104     1-89  (318)
196 cd04135 Tc10 TC10 subfamily.    99.5 2.9E-13 7.4E-18   95.4   8.9  158   30-210     1-173 (174)
197 cd04146 RERG_RasL11_like RERG/  99.5 1.4E-13 3.7E-18   97.1   6.9  157   31-211     1-164 (165)
198 cd04109 Rab28 Rab28 subfamily.  99.5   1E-12 2.6E-17   92.2  11.2  156   31-210     2-165 (215)
199 COG3276 SelB Selenocysteine-sp  99.5 9.6E-13 2.4E-17   92.4  10.6  158   31-210     2-161 (447)
200 COG5257 GCD11 Translation init  99.5 9.7E-13 2.5E-17   92.4  10.5  167   31-210    12-201 (415)
201 cd04143 Rhes_like Rhes_like su  99.4 4.1E-14 1.1E-18  100.3   3.4  156   31-210     2-170 (247)
202 cd04130 Wrch_1 Wrch-1 subfamil  99.4 8.6E-13 2.2E-17   92.7  10.1  156   30-207     1-170 (173)
203 TIGR00491 aIF-2 translation in  99.4 2.4E-13 6.2E-18   95.8   7.1  153   40-207   561-760 (1145)
204 cd00879 Sar1 Sar1 subfamily.    99.4   2E-12 5.2E-17   90.5  11.4  158   29-210    19-190 (190)
205 cd01874 Cdc42 Cdc42 subfamily.  99.4   8E-13   2E-17   92.9   9.2  158   30-209     2-173 (175)
206 PRK00007 elongation factor G;   99.4 2.5E-12 6.4E-17   90.0  11.7  128   22-162     3-141 (693)
207 KOG1424 consensus               99.4 1.3E-13 3.4E-18   97.3   5.0   62   29-100   314-375 (562)
208 smart00176 RAN Ran (Ras-relate  99.4 5.7E-13 1.4E-17   93.7   7.5  150   35-210     1-153 (200)
209 cd04129 Rho2 Rho2 subfamily.    99.4 1.4E-12 3.6E-17   91.4   8.6  160   29-210     1-172 (187)
210 TIGR02528 EutP ethanolamine ut  99.4 9.4E-13 2.4E-17   92.5   7.7  142   31-207     2-143 (144)
211 COG0481 LepA Membrane GTPase L  99.4 7.7E-13   2E-17   93.0   7.1  170   23-210     3-185 (603)
212 COG5256 TEF1 Translation elong  99.4 1.1E-11 2.7E-16   86.4  12.9  158   31-201     9-201 (428)
213 cd04131 Rnd Rnd subfamily.  Th  99.4 2.7E-12 6.8E-17   89.8   9.5  158   30-209     2-174 (178)
214 pfam05049 IIGP Interferon-indu  99.4 1.2E-11   3E-16   86.1  12.5  165   29-210    35-217 (375)
215 PRK09602 translation-associate  99.4 4.9E-13 1.2E-17   94.1   5.3   69   30-100     3-89  (396)
216 smart00178 SAR Sar1p-like memb  99.4 3.1E-12 7.9E-17   89.5   9.0  157   29-210    17-184 (184)
217 KOG0394 consensus               99.4 5.5E-13 1.4E-17   93.8   5.0  165   26-209     6-176 (210)
218 cd04173 Rnd2_Rho7 Rnd2/Rho7 su  99.4 2.6E-11 6.7E-16   84.1  12.9  158   30-209     2-174 (222)
219 KOG0092 consensus               99.4 1.4E-12 3.7E-17   91.4   6.4  157   30-210     6-166 (200)
220 COG1161 Predicted GTPases [Gen  99.4 8.3E-13 2.1E-17   92.8   5.2   61   30-100   133-193 (322)
221 cd04174 Rnd1_Rho6 Rnd1/Rho6 su  99.4 1.4E-11 3.6E-16   85.7  11.2  167   22-209     4-186 (232)
222 COG1217 TypA Predicted membran  99.3 1.3E-11 3.4E-16   85.9  10.5  169   28-210     4-194 (603)
223 KOG1144 consensus               99.3 1.7E-11 4.3E-16   85.3  10.1  166   29-209   475-685 (1064)
224 PRK12740 elongation factor G;   99.3 4.5E-11 1.1E-15   82.8  11.8  115   35-162     1-125 (670)
225 KOG0461 consensus               99.3 5.1E-11 1.3E-15   82.5  11.8  168   30-210     8-192 (522)
226 PRK13768 GTPase; Provisional    99.3 1.1E-11 2.8E-16   86.3   7.6  176   31-212     4-248 (253)
227 cd04172 Rnd3_RhoE_Rho8 Rnd3/Rh  99.3 2.2E-11 5.6E-16   84.6   8.1  158   30-209     6-178 (182)
228 TIGR00092 TIGR00092 GTP-bindin  99.3 3.1E-12   8E-17   89.5   3.3   76   30-106     3-90  (390)
229 cd01900 YchF YchF subfamily.    99.2 7.9E-12   2E-16   87.1   4.6   66   32-99      1-77  (274)
230 pfam03308 ArgK ArgK protein. T  99.2 1.5E-10 3.7E-15   79.8  10.9   67  146-212   164-231 (267)
231 cd04161 Arl2l1_Arl13_like Arl2  99.2 3.3E-11 8.5E-16   83.5   7.4  151   32-208     2-166 (167)
232 KOG0094 consensus               99.2 1.2E-10 2.9E-15   80.4  10.1  159   30-210    23-184 (221)
233 COG1100 GTPase SAR1 and relate  99.2 4.8E-11 1.2E-15   82.6   7.9  157   30-210     6-184 (219)
234 PRK09435 arginine/ornithine tr  99.2 1.5E-10 3.9E-15   79.7  10.2   66  147-212   185-254 (325)
235 KOG0078 consensus               99.2 2.7E-10 6.9E-15   78.3  11.3  162   25-210     8-173 (207)
236 pfam04548 AIG1 AIG1 family. Ar  99.2 1.6E-10 4.1E-15   79.6   9.9  163   30-210     1-173 (200)
237 COG2229 Predicted GTPase [Gene  99.2   8E-10 2.1E-14   75.6  13.4  163   28-209     9-176 (187)
238 TIGR00436 era GTP-binding prot  99.2 2.4E-10   6E-15   78.7   9.6  166   31-211     2-170 (278)
239 cd01873 RhoBTB RhoBTB subfamil  99.2 8.5E-11 2.2E-15   81.2   7.3  161   30-209     3-194 (195)
240 cd01855 YqeH YqeH.  YqeH is an  99.2 4.1E-11 1.1E-15   83.0   5.3   55   31-94    129-190 (190)
241 TIGR00487 IF-2 translation ini  99.2 4.7E-10 1.2E-14   76.9  10.7  164   24-208    85-251 (594)
242 cd01852 AIG1 AIG1 (avrRpt2-ind  99.1 2.9E-10 7.4E-15   78.1   8.6  172   30-210     1-183 (196)
243 cd04162 Arl9_Arfrp2_like Arl9/  99.1 3.9E-10 9.9E-15   77.4   8.7  152   31-209     1-157 (164)
244 cd04105 SR_beta Signal recogni  99.1 1.8E-09 4.5E-14   73.6  11.6  161   30-209     1-203 (203)
245 COG1703 ArgK Putative periplas  99.1 1.9E-09 4.8E-14   73.5  11.5   65  148-212   188-255 (323)
246 TIGR02034 CysN sulfate adenyly  99.1 7.7E-11   2E-15   81.4   4.1  153   35-200     6-187 (411)
247 PRK13796 GTP-binding protein Y  99.1 1.8E-10 4.7E-15   79.3   5.5   58   31-97    164-225 (367)
248 KOG1491 consensus               99.1 1.3E-10 3.4E-15   80.1   4.7   73   28-102    19-102 (391)
249 TIGR03597 GTPase_YqeH ribosome  99.1   2E-10 5.1E-15   79.1   5.4   58   31-97    156-217 (360)
250 COG4917 EutP Ethanolamine util  99.1   2E-09   5E-14   73.4  10.2  141   31-208     3-143 (148)
251 TIGR00750 lao LAO/AO transport  99.1 1.1E-09 2.9E-14   74.7   8.8   66  146-211   179-268 (333)
252 TIGR00231 small_GTP small GTP-  99.0 1.6E-09   4E-14   73.9   9.2  171   29-206     3-184 (186)
253 COG2895 CysN GTPases - Sulfate  99.0 1.9E-09 4.8E-14   73.5   9.0  160   28-200     5-192 (431)
254 KOG0098 consensus               99.0 2.3E-09   6E-14   72.9   9.4  158   28-209     5-166 (216)
255 COG0050 TufB GTPases - transla  99.0 2.2E-09 5.6E-14   73.1   9.3  166   31-210    14-200 (394)
256 pfam00350 Dynamin_N Dynamin fa  99.0 1.1E-09 2.9E-14   74.7   7.8   33   32-65      1-33  (168)
257 KOG1487 consensus               99.0 1.4E-10 3.5E-15   80.0   3.1  157   30-212    60-282 (358)
258 KOG1486 consensus               99.0 5.7E-10 1.4E-14   76.5   6.0  164   28-211    61-288 (364)
259 cd04102 RabL3 RabL3 (Rab-like3  99.0 5.6E-10 1.4E-14   76.5   5.9  166   30-211     1-200 (202)
260 KOG0084 consensus               99.0 3.8E-09 9.7E-14   71.7  10.2  157   30-210    10-171 (205)
261 cd01850 CDC_Septin CDC/Septin.  99.0 7.3E-09 1.9E-13   70.1  11.6  150   31-181     6-175 (276)
262 pfam00735 Septin Septin. Membe  99.0 1.1E-08 2.8E-13   69.1  12.5  149   31-181     6-173 (280)
263 pfam03029 ATP_bind_1 Conserved  99.0 1.4E-09 3.5E-14   74.3   6.6  169   34-212     1-234 (234)
264 COG5258 GTPBP1 GTPase [General  99.0   3E-09 7.8E-14   72.3   8.3  164   31-207   119-335 (527)
265 PRK07560 elongation factor EF-  99.0 5.2E-09 1.3E-13   71.0   8.7  123   27-162    18-152 (730)
266 KOG0395 consensus               98.9 8.2E-10 2.1E-14   75.5   4.6  159   29-210     3-164 (196)
267 KOG0080 consensus               98.9 3.9E-09 9.9E-14   71.7   8.0  157   29-209    11-172 (209)
268 KOG2485 consensus               98.9   8E-09   2E-13   69.9   9.2   68   28-101   142-213 (335)
269 KOG0075 consensus               98.9 1.6E-09   4E-14   73.9   5.0  155   30-209    21-180 (186)
270 KOG0458 consensus               98.9 1.3E-08 3.2E-13   68.7   9.6  160   29-201   177-372 (603)
271 cd01853 Toc34_like Toc34-like   98.9 6.3E-09 1.6E-13   70.5   8.0   63   30-99     32-94  (249)
272 cd01882 BMS1 Bms1.  Bms1 is an  98.9 2.3E-08 5.9E-13   67.2  10.5  146   21-195    30-180 (225)
273 pfam09439 SRPRB Signal recogni  98.9   3E-08 7.6E-13   66.6  11.0  126   28-172     2-138 (181)
274 KOG0448 consensus               98.9 8.6E-09 2.2E-13   69.7   8.1  156   28-194   108-309 (749)
275 COG4108 PrfC Peptide chain rel  98.9 2.9E-08 7.3E-13   66.7  10.7  122   28-162    11-146 (528)
276 KOG0087 consensus               98.9   1E-08 2.6E-13   69.2   8.4  157   30-210    15-175 (222)
277 COG0480 FusA Translation elong  98.9 1.5E-08   4E-13   68.2   9.2  127   24-163     5-142 (697)
278 TIGR00483 EF-1_alpha translati  98.8 1.3E-08 3.2E-13   68.7   7.7  159   30-201     8-202 (445)
279 KOG2484 consensus               98.8 1.5E-09 3.8E-14   74.1   2.6   62   30-101   253-314 (435)
280 PRK01889 ribosome-associated G  98.8 1.1E-08 2.7E-13   69.2   6.2   69   30-103   195-265 (353)
281 KOG0467 consensus               98.8 4.7E-08 1.2E-12   65.4   9.1  168   24-205     4-213 (887)
282 KOG0073 consensus               98.8 8.2E-08 2.1E-12   64.0  10.2  154   30-209    17-176 (185)
283 COG5019 CDC3 Septin family pro  98.8 2.9E-07 7.5E-12   60.9  13.0  155   30-189    24-199 (373)
284 KOG0095 consensus               98.7 9.7E-08 2.5E-12   63.6   9.5  161   30-210     8-168 (213)
285 TIGR00650 MG442 GTP-binding co  98.7 1.2E-08   3E-13   68.9   4.6   31   35-65      1-73  (123)
286 cd01854 YjeQ_engC YjeQ/EngC.    98.7 2.1E-08 5.3E-13   67.5   5.0   67   30-101   162-230 (287)
287 KOG0090 consensus               98.7   1E-07 2.6E-12   63.5   8.1  163   26-210    35-238 (238)
288 KOG1532 consensus               98.7 3.2E-08 8.2E-13   66.4   5.5  177   28-210    18-263 (366)
289 KOG0466 consensus               98.7 9.8E-08 2.5E-12   63.6   7.7  161   30-210    39-240 (466)
290 PRK12289 ribosome-associated G  98.7 4.5E-08 1.1E-12   65.6   5.7  102   31-137   173-279 (351)
291 pfam03193 DUF258 Protein of un  98.7 3.5E-08 8.9E-13   66.2   5.0   66   31-101    37-104 (161)
292 KOG2423 consensus               98.7 1.1E-08 2.8E-13   69.1   2.4   59   30-98    308-366 (572)
293 pfam08477 Miro Miro-like prote  98.6 4.8E-08 1.2E-12   65.4   5.3  112   31-160     1-118 (118)
294 smart00053 DYNc Dynamin, GTPas  98.6 2.7E-07 6.8E-12   61.1   9.1  137   28-166    25-209 (240)
295 PRK00098 ribosome-associated G  98.6 4.8E-08 1.2E-12   65.4   5.1   65   31-101   166-232 (298)
296 KOG1547 consensus               98.6 2.3E-07 5.9E-12   61.5   8.6  146   31-181    48-216 (336)
297 KOG0076 consensus               98.6 1.8E-07 4.6E-12   62.1   7.9  160   31-210    19-186 (197)
298 COG1162 Predicted GTPases [Gen  98.6 7.6E-08 1.9E-12   64.2   5.7   64   31-99    166-231 (301)
299 PTZ00099 rab6; Provisional      98.6 2.7E-07 6.9E-12   61.1   8.5  113   80-210    25-141 (176)
300 KOG0079 consensus               98.6 2.6E-07 6.6E-12   61.2   8.2  156   31-210    10-168 (198)
301 KOG0093 consensus               98.6 4.3E-07 1.1E-11   59.9   9.3  155   31-210    23-182 (193)
302 KOG0091 consensus               98.6 2.7E-07 6.8E-12   61.1   8.2  157   31-210    10-172 (213)
303 KOG2655 consensus               98.6 1.1E-06 2.9E-11   57.5  10.7  150   30-181    22-190 (366)
304 pfam04670 Gtr1_RagA Gtr1/RagA   98.6 2.4E-06 6.2E-11   55.6  12.3  162   31-208     1-173 (230)
305 PRK12288 ribosome-associated G  98.5 1.3E-07 3.3E-12   62.9   4.6   65   31-100   209-275 (344)
306 KOG0460 consensus               98.5 1.6E-06 4.1E-11   56.6   9.6  149   32-194    57-218 (449)
307 TIGR00503 prfC peptide chain r  98.5 1.3E-06 3.4E-11   57.1   9.1  121   28-161    10-144 (530)
308 COG0378 HypB Ni2+-binding GTPa  98.4 2.8E-06 7.1E-11   55.2  10.1   57  151-210   144-200 (202)
309 TIGR03597 GTPase_YqeH ribosome  98.4 2.2E-06 5.6E-11   55.8   8.6   88  120-209    63-151 (360)
310 PRK10463 hydrogenase nickel in  98.4 3.3E-07 8.4E-12   60.6   4.4   61  144-209   225-287 (290)
311 cd01859 MJ1464 MJ1464.  This f  98.4 1.4E-06 3.6E-11   56.9   7.2   87  117-210     9-95  (156)
312 PRK13796 GTP-binding protein Y  98.4 2.7E-06   7E-11   55.3   8.5   87  121-209    72-159 (367)
313 KOG1143 consensus               98.4 1.6E-06   4E-11   56.7   7.0  176   21-207   156-384 (591)
314 KOG1954 consensus               98.3 2.8E-06 7.2E-11   55.2   8.2  142   28-171    57-233 (532)
315 COG5192 BMS1 GTP-binding prote  98.3 4.9E-06 1.3E-10   53.8   9.4  149   20-195    58-210 (1077)
316 KOG0088 consensus               98.3   2E-07   5E-12   61.9   2.2  151   31-209    15-173 (218)
317 cd01856 YlqF YlqF.  Proteins o  98.3 4.5E-06 1.2E-10   54.0   8.6   85  117-210    16-100 (171)
318 KOG0081 consensus               98.3 1.5E-06 3.9E-11   56.7   6.0  161   31-210    11-180 (219)
319 KOG1707 consensus               98.3 1.2E-06 3.1E-11   57.3   5.0  158   30-209    10-173 (625)
320 KOG0070 consensus               98.3 1.1E-06 2.7E-11   57.6   4.5  162   24-211    12-178 (181)
321 KOG0463 consensus               98.2 4.4E-06 1.1E-10   54.1   7.2  167   30-207   134-354 (641)
322 KOG0086 consensus               98.2 9.3E-06 2.4E-10   52.2   8.5  155   29-207     9-167 (214)
323 KOG0097 consensus               98.2   1E-05 2.7E-10   51.9   8.6  150   30-203    12-165 (215)
324 cd01855 YqeH YqeH.  YqeH is an  98.2 5.8E-06 1.5E-10   53.4   7.3   90  119-210    33-124 (190)
325 KOG0468 consensus               98.2 8.7E-06 2.2E-10   52.4   7.7  154   30-197   129-315 (971)
326 TIGR00484 EF-G translation elo  98.2   3E-06 7.6E-11   55.1   5.3  129   23-164     4-150 (705)
327 TIGR00073 hypB hydrogenase acc  98.2 9.8E-07 2.5E-11   57.8   2.6  167   23-210    28-222 (225)
328 KOG4252 consensus               98.1 2.7E-07   7E-12   61.0  -0.8  160   28-210    19-180 (246)
329 KOG0465 consensus               98.1   8E-06 2.1E-10   52.6   6.2  138   12-163    21-170 (721)
330 pfam05783 DLIC Dynein light in  98.1 6.3E-05 1.6E-09   47.5  10.2   67  144-210   210-282 (490)
331 TIGR03596 GTPase_YlqF ribosome  98.0   4E-05   1E-09   48.6   8.4   85  117-210    18-102 (276)
332 TIGR00993 3a0901s04IAP86 chlor  98.0 2.2E-05 5.6E-10   50.1   6.8   69   30-105   125-193 (772)
333 KOG0464 consensus               98.0 8.2E-06 2.1E-10   52.5   3.9  138   28-179    36-183 (753)
334 PRK09563 rbgA ribosomal biogen  97.9 7.9E-05   2E-09   46.9   8.8   85  117-210    21-105 (282)
335 PRK12288 ribosome-associated G  97.9 2.5E-05 6.3E-10   49.8   6.2   69  137-209   140-208 (344)
336 cd01849 YlqF_related_GTPase Yl  97.9 2.7E-05   7E-10   49.5   6.1   83  122-210     1-84  (155)
337 TIGR00485 EF-Tu translation el  97.8 0.00021 5.5E-09   44.4   9.4  165   31-209    14-192 (394)
338 KOG0054 consensus               97.8 1.6E-05   4E-10   50.9   3.4   20   31-50   1168-1187(1381)
339 TIGR00956 3a01205 Pleiotropic   97.7   1E-04 2.5E-09   46.3   6.6   23   32-54    856-878 (1466)
340 KOG0083 consensus               97.7 1.4E-05 3.6E-10   51.2   1.6  157   34-210     2-159 (192)
341 KOG3905 consensus               97.7   0.002   5E-08   38.9  12.2   67  144-210   217-289 (473)
342 KOG0077 consensus               97.6 0.00024 6.1E-09   44.1   7.2  153   31-208    22-190 (193)
343 TIGR02857 CydD ABC transporter  97.6 3.8E-05 9.8E-10   48.7   3.0   22   31-52    380-401 (570)
344 KOG0447 consensus               97.6  0.0012 3.1E-08   40.1  10.6  182   26-208   305-541 (980)
345 PRK00098 ribosome-associated G  97.6 0.00017 4.3E-09   45.0   6.1   67  136-208    98-164 (298)
346 PRK12289 ribosome-associated G  97.6 0.00023 5.8E-09   44.3   6.7   66  137-209   107-172 (351)
347 KOG3859 consensus               97.6 0.00025 6.4E-09   44.0   6.7  144   31-179    44-206 (406)
348 PRK09866 hypothetical protein;  97.6 1.9E-05 4.8E-10   50.5   0.8   25   31-55     71-95  (742)
349 KOG0446 consensus               97.6 5.3E-05 1.3E-09   47.9   2.9  139   26-164    26-214 (657)
350 KOG0071 consensus               97.6 0.00024   6E-09   44.2   6.2  156   30-211    18-178 (180)
351 TIGR01277 thiQ thiamine ABC tr  97.6 5.2E-05 1.3E-09   47.9   2.8   28   26-53     21-48  (213)
352 KOG0393 consensus               97.5 3.9E-05 9.9E-10   48.7   2.0  156   29-208     4-176 (198)
353 TIGR00955 3a01204 Pigment prec  97.5 6.9E-05 1.8E-09   47.2   2.9   22   32-53     61-82  (671)
354 cd01851 GBP Guanylate-binding   97.5 0.00048 1.2E-08   42.4   7.1   65   31-98      9-74  (224)
355 KOG0072 consensus               97.5 0.00031 7.8E-09   43.5   6.1  115   82-211    60-179 (182)
356 COG0523 Putative GTPases (G3E   97.5  0.0021 5.3E-08   38.7   9.9  163   29-203     1-193 (323)
357 KOG3883 consensus               97.5 0.00054 1.4E-08   42.1   7.0  161   30-211    10-175 (198)
358 PTZ00243 ABC transporter; Prov  97.4 9.2E-05 2.4E-09   46.5   2.9   21   32-52    689-709 (1560)
359 TIGR01184 ntrCD nitrate ABC tr  97.4 8.1E-05 2.1E-09   46.8   2.6   22   32-53     14-35  (230)
360 PRK13546 teichoic acids export  97.4  0.0022 5.6E-08   38.6   9.9   23   31-53     52-74  (264)
361 TIGR00618 sbcc exonuclease Sbc  97.4 0.00015 3.7E-09   45.3   3.7   39    6-50     13-51  (1063)
362 cd01854 YjeQ_engC YjeQ/EngC.    97.4 0.00051 1.3E-08   42.2   6.4   66  136-208    96-161 (287)
363 COG1116 TauB ABC-type nitrate/  97.4 0.00013 3.3E-09   45.7   3.0   23   31-53     31-53  (248)
364 PRK01889 ribosome-associated G  97.3 0.00088 2.3E-08   40.9   6.7   66  136-208   128-193 (353)
365 pfam02492 cobW CobW/HypB/UreG,  97.3  0.0015 3.8E-08   39.5   7.8   22   30-51      1-22  (174)
366 TIGR02203 MsbA_lipidA lipid A   97.3 0.00014 3.6E-09   45.5   2.4   21   31-51    390-410 (603)
367 PRK05703 flhF flagellar biosyn  97.3 0.00056 1.4E-08   42.0   5.5  126   30-165   211-361 (412)
368 PRK11537 putative GTP-binding   97.3  0.0033 8.4E-08   37.6   9.4  132   28-165     3-166 (317)
369 cd03290 ABCC_SUR1_N The SUR do  97.3 0.00021 5.3E-09   44.5   3.1   23   31-53     29-51  (218)
370 cd03291 ABCC_CFTR1 The CFTR su  97.3 0.00021 5.4E-09   44.4   3.1   23   31-53     65-87  (282)
371 pfam05879 RHD3 Root hair defec  97.3 0.00043 1.1E-08   42.6   4.5   95   35-132     1-95  (741)
372 TIGR03348 VI_IcmF type VI secr  97.2  0.0065 1.6E-07   35.9  10.2  124   28-163   110-257 (1169)
373 pfam00448 SRP54 SRP54-type pro  97.2  0.0025 6.4E-08   38.2   8.0  154   31-204     3-184 (196)
374 cd03249 ABC_MTABC3_MDL1_MDL2 M  97.2 0.00029 7.5E-09   43.6   3.1   23   31-53     31-53  (238)
375 COG4988 CydD ABC-type transpor  97.2 0.00031 7.9E-09   43.5   3.2   23   31-53    349-371 (559)
376 TIGR02204 MsbA_rel ABC transpo  97.2  0.0003 7.7E-09   43.5   3.1   21   31-51    368-388 (576)
377 PRK10522 multidrug transporter  97.2 0.00032 8.2E-09   43.4   3.2   23   31-53    351-373 (547)
378 cd03114 ArgK-like The function  97.2 0.00095 2.4E-08   40.7   5.4   33   32-64      2-39  (148)
379 PRK11160 cysteine/glutathione   97.1 0.00037 9.4E-09   43.1   3.1   23   31-53    369-391 (575)
380 PRK13657 cyclic beta-1,2-gluca  97.1 0.00037 9.4E-09   43.1   3.1   23   31-53    363-385 (585)
381 PRK10789 putative multidrug tr  97.1 0.00036 9.1E-09   43.1   3.0   23   31-53    343-365 (569)
382 PRK06995 flhF flagellar biosyn  97.1   0.002 5.2E-08   38.8   6.8  127   31-166   178-328 (404)
383 PRK10790 putative multidrug tr  97.1 0.00035   9E-09   43.2   2.9   23   31-53    369-391 (593)
384 cd03253 ABCC_ATM1_transporter   97.1  0.0004   1E-08   42.8   3.1   23   31-53     29-51  (236)
385 cd03289 ABCC_CFTR2 The CFTR su  97.1 0.00041 1.1E-08   42.8   3.2   22   31-52     32-53  (275)
386 TIGR00991 3a0901s02IAP34 GTP-b  97.1  0.0012 3.2E-08   40.0   5.6   66   30-102    40-105 (328)
387 cd03231 ABC_CcmA_heme_exporter  97.1   0.017 4.2E-07   33.5  11.3   23   31-53     28-50  (201)
388 smart00072 GuKc Guanylate kina  97.1  0.0052 1.3E-07   36.4   8.7   59   31-97      4-62  (184)
389 KOG3886 consensus               97.1  0.0006 1.5E-08   41.8   3.9  151   29-194     4-162 (295)
390 cd03234 ABCG_White The White s  97.1  0.0004   1E-08   42.9   2.9   22   31-52     35-56  (226)
391 TIGR00972 3a0107s01c2 phosphat  97.1  0.0004   1E-08   42.8   2.8   25   24-50     24-48  (248)
392 PRK11176 lipid transporter ATP  97.1 0.00033 8.5E-09   43.3   2.4   23   31-53    370-392 (581)
393 TIGR01192 chvA glucan exporter  97.1 0.00034 8.8E-09   43.2   2.4   21   30-50    362-382 (592)
394 PRK11174 cysteine/glutathione   97.1 0.00044 1.1E-08   42.6   2.9   22   31-52    378-399 (588)
395 cd03245 ABCC_bacteriocin_expor  97.1 0.00047 1.2E-08   42.4   3.1   23   31-53     32-54  (220)
396 TIGR02315 ABC_phnC phosphonate  97.0  0.0004   1E-08   42.9   2.6   20   32-51     31-50  (253)
397 cd03246 ABCC_Protease_Secretio  97.0 0.00052 1.3E-08   42.2   3.2   23   31-53     30-52  (173)
398 cd01858 NGP_1 NGP-1.  Autoanti  97.0  0.0022 5.7E-08   38.5   6.4   87  117-209     5-93  (157)
399 COG1162 Predicted GTPases [Gen  97.0  0.0016   4E-08   39.5   5.6   67  138-209    99-165 (301)
400 cd03254 ABCC_Glucan_exporter_l  97.0 0.00053 1.3E-08   42.1   3.2   23   31-53     31-53  (229)
401 TIGR02142 modC_ABC molybdate A  97.0  0.0004   1E-08   42.8   2.5   29   23-53     19-47  (361)
402 cd03252 ABCC_Hemolysin The ABC  97.0 0.00054 1.4E-08   42.1   3.1   23   31-53     30-52  (237)
403 cd03228 ABCC_MRP_Like The MRP   97.0 0.00056 1.4E-08   42.0   3.1   23   31-53     30-52  (171)
404 cd03251 ABCC_MsbA MsbA is an e  97.0 0.00058 1.5E-08   41.9   3.1   23   31-53     30-52  (234)
405 cd03288 ABCC_SUR2 The SUR doma  97.0 0.00059 1.5E-08   41.9   3.1   23   31-53     49-71  (257)
406 COG3840 ThiQ ABC-type thiamine  97.0 0.00052 1.3E-08   42.2   2.8   28   24-53     22-49  (231)
407 KOG0054 consensus               97.0 0.00061 1.6E-08   41.8   3.1   22   31-52    549-570 (1381)
408 KOG2743 consensus               97.0  0.0014 3.7E-08   39.6   5.0  150   23-177    51-239 (391)
409 TIGR02324 CP_lyasePhnL phospho  97.0 0.00053 1.3E-08   42.1   2.7   23   32-54     37-59  (224)
410 cd03248 ABCC_TAP TAP, the Tran  97.0 0.00063 1.6E-08   41.7   3.1   23   31-53     42-64  (226)
411 TIGR02868 CydC ABC transporter  97.0 0.00054 1.4E-08   42.1   2.7   22   31-52    389-410 (566)
412 CHL00131 ycf16 sulfate ABC tra  97.0 0.00061 1.6E-08   41.8   3.0   22   31-52     34-55  (252)
413 cd03223 ABCD_peroxisomal_ALDP   97.0 0.00067 1.7E-08   41.5   3.2   23   31-53     29-51  (166)
414 cd03250 ABCC_MRP_domain1 Domai  97.0 0.00068 1.7E-08   41.5   3.2   23   31-53     33-55  (204)
415 cd03298 ABC_ThiQ_thiamine_tran  97.0 0.00059 1.5E-08   41.9   2.8   28   24-53     21-48  (211)
416 KOG0074 consensus               96.9  0.0031 7.9E-08   37.7   6.5  157   29-210    17-178 (185)
417 COG1136 SalX ABC-type antimicr  96.9 0.00066 1.7E-08   41.6   3.0   23   31-53     33-55  (226)
418 cd03369 ABCC_NFT1 Domain 2 of   96.9 0.00065 1.7E-08   41.6   2.9   23   31-53     36-58  (207)
419 KOG0469 consensus               96.9  0.0012   3E-08   40.2   4.1  123   26-162    16-163 (842)
420 PRK11248 tauB taurine transpor  96.9 0.00063 1.6E-08   41.7   2.7   23   31-53     29-51  (255)
421 PRK13547 hmuV hemin importer A  96.9 0.00066 1.7E-08   41.6   2.8   27   24-52     24-50  (273)
422 cd03233 ABC_PDR_domain1 The pl  96.9 0.00072 1.8E-08   41.4   3.0   22   31-52     35-56  (202)
423 KOG0459 consensus               96.9  0.0025 6.3E-08   38.3   5.7  173   24-204    74-279 (501)
424 COG0419 SbcC ATPase involved i  96.9  0.0009 2.3E-08   40.8   3.4   35   16-50     12-46  (908)
425 PTZ00265 multidrug resistance   96.9 0.00077   2E-08   41.2   3.1   21   31-51   1197-1217(1467)
426 COG4987 CydC ABC-type transpor  96.9 0.00078   2E-08   41.2   3.0   23   30-52    365-387 (573)
427 PTZ00243 ABC transporter; Prov  96.9 0.00079   2E-08   41.2   3.1   21   31-51   1338-1358(1560)
428 KOG0057 consensus               96.9 0.00071 1.8E-08   41.4   2.8   21   31-51    380-400 (591)
429 PRK10771 thiQ thiamine transpo  96.9 0.00075 1.9E-08   41.3   2.9   22   31-52     27-48  (233)
430 PRK13631 cbiO cobalt transport  96.9 0.00078   2E-08   41.2   3.0   22   31-52     54-75  (320)
431 PRK11701 phnK phosphonates tra  96.9 0.00081 2.1E-08   41.1   3.0   23   31-53     34-56  (258)
432 cd00071 GMPK Guanosine monopho  96.9  0.0011 2.7E-08   40.4   3.5   56   32-95      2-57  (137)
433 TIGR03608 L_ocin_972_ABC putat  96.9 0.00081 2.1E-08   41.1   2.9   23   31-53     26-48  (206)
434 PRK09580 sufC cysteine desulfu  96.9 0.00088 2.2E-08   40.9   3.0   27   24-52     24-50  (248)
435 COG3523 IcmF Type VI protein s  96.9  0.0026 6.6E-08   38.2   5.4  125   28-163   124-270 (1188)
436 cd03232 ABC_PDR_domain2 The pl  96.8 0.00099 2.5E-08   40.6   3.2   23   31-53     35-57  (192)
437 cd03271 ABC_UvrA_II The excisi  96.8 0.00083 2.1E-08   41.0   2.7   26   24-51     18-43  (261)
438 cd03244 ABCC_MRP_domain2 Domai  96.8  0.0011 2.8E-08   40.3   3.3   23   31-53     32-54  (221)
439 cd03213 ABCG_EPDR ABCG transpo  96.8 0.00092 2.3E-08   40.8   2.9   23   31-53     37-59  (194)
440 cd03297 ABC_ModC_molybdenum_tr  96.8 0.00087 2.2E-08   40.9   2.8   23   31-53     25-47  (214)
441 COG1132 MdlB ABC-type multidru  96.8 0.00091 2.3E-08   40.8   2.8   23   31-53    357-379 (567)
442 cd03240 ABC_Rad50 The catalyti  96.8  0.0013 3.4E-08   39.8   3.6   21   31-51     24-44  (204)
443 cd03247 ABCC_cytochrome_bd The  96.8 0.00093 2.4E-08   40.7   2.8   23   31-53     30-52  (178)
444 cd03292 ABC_FtsE_transporter F  96.8 0.00096 2.4E-08   40.7   2.8   23   31-53     29-51  (214)
445 cd03257 ABC_NikE_OppD_transpor  96.8 0.00094 2.4E-08   40.7   2.8   23   31-53     33-55  (228)
446 cd03256 ABC_PhnC_transporter A  96.8 0.00098 2.5E-08   40.6   2.8   23   31-53     29-51  (241)
447 PRK13540 cytochrome c biogenes  96.8 0.00098 2.5E-08   40.6   2.8   28   24-53     24-51  (200)
448 PRK09984 phosphonate/organopho  96.8   0.001 2.6E-08   40.5   2.9   22   31-52     32-53  (262)
449 cd03217 ABC_FeS_Assembly ABC-t  96.8  0.0011 2.7E-08   40.4   3.0   27   24-52     23-49  (200)
450 PRK10247 putative ABC transpor  96.8  0.0011 2.8E-08   40.3   3.0   23   31-53     35-57  (225)
451 PRK13634 cbiO cobalt transport  96.8 0.00089 2.3E-08   40.8   2.5   22   31-52     22-43  (276)
452 PRK13648 cbiO cobalt transport  96.8  0.0011 2.9E-08   40.3   3.0   22   31-52     37-58  (269)
453 PRK11147 ABC transporter ATPas  96.8  0.0011 2.8E-08   40.3   3.0   23   31-53     31-53  (632)
454 cd03226 ABC_cobalt_CbiO_domain  96.8  0.0011 2.9E-08   40.2   3.0   28   24-53     23-50  (205)
455 cd03236 ABC_RNaseL_inhibitor_d  96.8  0.0011 2.9E-08   40.3   2.9   22   31-52     28-49  (255)
456 PRK10584 putative ABC transpor  96.7   0.001 2.6E-08   40.5   2.7   23   31-53     38-60  (228)
457 cd03262 ABC_HisP_GlnQ_permease  96.7  0.0011 2.8E-08   40.3   2.8   23   31-53     28-50  (213)
458 PRK13632 cbiO cobalt transport  96.7  0.0011 2.8E-08   40.3   2.8   22   31-52     38-59  (273)
459 pfam03205 MobB Molybdopterin g  96.7  0.0012   3E-08   40.1   2.9   22   30-51      1-22  (122)
460 PRK13635 cbiO cobalt transport  96.7  0.0011 2.9E-08   40.2   2.8   23   31-53     35-57  (279)
461 PRK11819 putative ABC transpor  96.7  0.0013 3.4E-08   39.8   3.1   23   31-53     35-57  (556)
462 PRK12724 flagellar biosynthesi  96.7  0.0063 1.6E-07   35.9   6.6  130   31-166   225-376 (432)
463 KOG0061 consensus               96.7  0.0012 3.2E-08   40.0   2.9   24   31-54     58-81  (613)
464 PRK00300 gmk guanylate kinase;  96.7  0.0014 3.7E-08   39.7   3.2   58   30-95      8-65  (208)
465 COG4148 ModC ABC-type molybdat  96.7   0.014 3.5E-07   34.0   8.2   23   31-53     26-48  (352)
466 PRK13646 cbiO cobalt transport  96.7  0.0012 3.2E-08   40.0   2.9   22   31-52     35-56  (286)
467 PRK13644 cbiO cobalt transport  96.7  0.0013 3.3E-08   39.9   2.9   23   31-53     30-52  (274)
468 PRK10636 putative ABC transpor  96.7  0.0014 3.5E-08   39.8   3.0   23   31-53     29-51  (638)
469 pfam02263 GBP Guanylate-bindin  96.7  0.0067 1.7E-07   35.8   6.4   66   29-96     21-86  (264)
470 cd03293 ABC_NrtD_SsuB_transpor  96.7  0.0013 3.3E-08   39.9   2.7   23   31-53     32-54  (220)
471 PRK03695 vitamin B12-transport  96.7  0.0013 3.4E-08   39.8   2.8   22   31-52     25-46  (245)
472 PRK13643 cbiO cobalt transport  96.7  0.0013 3.2E-08   40.0   2.7   22   31-52     34-55  (288)
473 PRK10751 molybdopterin-guanine  96.7  0.0016 4.2E-08   39.3   3.3   23   29-51      2-24  (170)
474 pfam00625 Guanylate_kin Guanyl  96.7  0.0027 6.9E-08   38.1   4.3   58   32-97      4-61  (182)
475 PRK13636 cbiO cobalt transport  96.7  0.0014 3.7E-08   39.6   2.9   22   31-52     34-55  (285)
476 PRK13637 cbiO cobalt transport  96.6  0.0012 3.1E-08   40.1   2.5   22   31-52     35-56  (287)
477 PRK13652 cbiO cobalt transport  96.6  0.0014 3.5E-08   39.8   2.7   27   24-52     27-53  (277)
478 PRK10744 phosphate transporter  96.6  0.0014 3.5E-08   39.8   2.7   22   31-52     38-59  (257)
479 cd03300 ABC_PotA_N PotA is an   96.6  0.0015 3.8E-08   39.5   2.9   23   31-53     28-50  (232)
480 PRK13638 cbiO cobalt transport  96.6  0.0015 3.9E-08   39.5   2.9   23   31-53     29-51  (271)
481 PRK11300 livG leucine/isoleuci  96.6  0.0016   4E-08   39.4   3.0   23   31-53     33-55  (255)
482 PRK11231 fecE iron-dicitrate t  96.6  0.0015 3.9E-08   39.5   2.9   28   24-53     25-52  (255)
483 TIGR00960 3a0501s02 Type II (G  96.6  0.0014 3.5E-08   39.8   2.6   23   31-53     31-53  (216)
484 PRK10895 putative ABC transpor  96.6  0.0016 4.1E-08   39.4   3.0   28   24-53     26-53  (241)
485 cd03296 ABC_CysA_sulfate_impor  96.6  0.0014 3.7E-08   39.7   2.8   23   31-53     30-52  (239)
486 cd03260 ABC_PstB_phosphate_tra  96.6  0.0015 3.8E-08   39.5   2.8   28   24-53     23-50  (227)
487 PRK10253 iron-enterobactin tra  96.6  0.0013 3.3E-08   39.9   2.5   27   24-52     30-56  (265)
488 cd03229 ABC_Class3 This class   96.6  0.0016   4E-08   39.4   2.9   28   24-53     23-50  (178)
489 COG2274 SunT ABC-type bacterio  96.6  0.0018 4.6E-08   39.1   3.2   23   31-53    501-523 (709)
490 cd03237 ABC_RNaseL_inhibitor_d  96.6  0.0015 3.9E-08   39.5   2.8   23   31-53     27-49  (246)
491 PRK11247 ssuB aliphatic sulfon  96.6  0.0015 3.7E-08   39.6   2.7   23   31-53     40-62  (257)
492 PRK13538 cytochrome c biogenes  96.6  0.0017 4.3E-08   39.2   3.0   23   31-53     29-51  (204)
493 PRK13548 hmuV hemin importer A  96.6  0.0017 4.3E-08   39.2   3.0   23   31-53     30-52  (257)
494 TIGR01271 CFTR_protein cystic   96.6  0.0015 3.9E-08   39.5   2.7   23   28-50   1285-1307(1534)
495 PRK11831 putative ABC transpor  96.6  0.0016   4E-08   39.4   2.8   28   24-53     31-58  (269)
496 TIGR03375 type_I_sec_LssB type  96.6  0.0017 4.3E-08   39.2   3.0   23   31-53    493-515 (694)
497 PRK10575 iron-hydroxamate tran  96.6  0.0017 4.3E-08   39.3   2.9   28   24-53     34-61  (265)
498 PRK10938 putative molybdenum t  96.6  0.0017 4.4E-08   39.2   3.0   22   31-52    288-309 (490)
499 PRK13645 cbiO cobalt transport  96.6  0.0016   4E-08   39.4   2.7   22   31-52     39-60  (289)
500 TIGR00957 MRP_assoc_pro multi   96.6  0.0016 4.1E-08   39.3   2.8   21   32-52    670-690 (1542)

No 1  
>PRK00454 engB GTPase EngB; Reviewed
Probab=100.00  E-value=1.1e-40  Score=253.09  Aligned_cols=193  Identities=47%  Similarity=0.732  Sum_probs=152.8

Q ss_pred             CCCEEEEEECCCHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEE
Q ss_conf             57404786236567588766868999748998898999997389737987388841452120266555678508964999
Q gi|254780484|r    9 KSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMAL   88 (212)
Q Consensus         9 ~~~~~~~~~~~~~~~~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~   88 (212)
                      ...|.|++|+.+++++|.+++|+|||+||||||||||+|+|+|++++|.+++.||||+..+++.         .+..+.+
T Consensus         4 ~~~~~f~~~~~~~~~~p~~~~p~VaivGrpNvGKSTL~N~L~g~k~~a~vs~~pgtTr~i~~~~---------~~~~~~l   74 (196)
T PRK00454          4 IHQAEFIISAPKIKQLPPDDGPEIAFAGRSNVGKSSLINALTNRKNLARTSKTPGRTQLINFFE---------VNDGLRL   74 (196)
T ss_pred             CEEEEEEEECCCHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCEEEEEEEE---------CCCCEEE
T ss_conf             1424899925897789998896899984898889999999868973699747888607988876---------1883389


Q ss_pred             EECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             97600101112244789888899877776642000001122357887545455432102575322122221111024689
Q gi|254780484|r   89 VDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQ  168 (212)
Q Consensus        89 ~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~  168 (212)
                      +||||+...................+.........++++.|+..+..+++..+.+.+...+.|+++++||+|++++.+..
T Consensus        75 vDtpGyG~a~~~~~~~~~~~~~i~~yl~~~~~l~~villIDa~~g~~~~D~~i~~~l~~~~~p~iivlNKiD~l~~~~~~  154 (196)
T PRK00454         75 VDLPGYGYAKVSKEEKEKWQKLIEEYLQKRENLKGVVLLIDSRHPLKELDLEMIEWLKEAGIPVLIVLTKADKLKKGERK  154 (196)
T ss_pred             EECCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEECCHHCCHHHHH
T ss_conf             93799741327787888999999999996233363899997165898889999999986277859999872516978999


Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             9999999997531368986899988888998999999998728
Q gi|254780484|r  169 ETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       169 ~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      +.+..+.+.+... ....+++++||++|.|+++|++.|.+.|.
T Consensus       155 ~~~~~i~~~l~~~-~~~~~ii~ISA~~g~GI~eL~~~I~k~Lk  196 (196)
T PRK00454        155 KLLKKVKKALARF-AADPEVLLFSSLKKTGIDELRAAIAKWLK  196 (196)
T ss_pred             HHHHHHHHHHHHC-CCCCCEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             9999999997612-58982899969999798999999999859


No 2  
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=100.00  E-value=1.1e-37  Score=235.75  Aligned_cols=178  Identities=47%  Similarity=0.751  Sum_probs=143.1

Q ss_pred             EEEEECCCHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECC
Q ss_conf             47862365675887668689997489988989999973897379873888414521202665556785089649999760
Q gi|254780484|r   13 IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMP   92 (212)
Q Consensus        13 ~~~~~~~~~~~~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~Dtp   92 (212)
                      -|++|+..++++|.+++|+|||+||||||||||+|+|+|++.++.+++.||||+..+++..         +..+.++|||
T Consensus         2 ~~~~~~~~~~~~p~~~~p~IaivGrpNvGKSTL~N~L~g~k~~a~vs~~pGtTr~i~~~~~---------~~~~~lvDtp   72 (179)
T TIGR03598         2 EFLKSAVKLKQLPPDDGPEIAFAGRSNVGKSSLINALTNRKKLARTSKTPGRTQLINFFEV---------NDGFRLVDLP   72 (179)
T ss_pred             EEEEECCCHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEE---------CCCEEEEECC
T ss_conf             7888168976799988978999869998889999998689855897089973660232010---------4736999777


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             01011122447898888998777766420000011223578875454554321025753221222211110246899999
Q gi|254780484|r   93 GYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLE  172 (212)
Q Consensus        93 G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~  172 (212)
                      |+...+...............+......+..++++.|+..+..++|..+.+.+...+.|+++++||+|++++++..+..+
T Consensus        73 GyG~~~~~~~~~~~~~~~~~~~~~~~~~l~~villiDa~~gl~~~D~~i~~~l~~~~kp~iivlNK~Dll~~~~~~~~~~  152 (179)
T TIGR03598        73 GYGYAKVSKEEKEKWQKLIEEYLRGRENLKGVVLLMDIRHPLKELDLEMLEWLDERGIPVLIVLTKADKLKKSERNKQLK  152 (179)
T ss_pred             CHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHH
T ss_conf             60211278888999999999999998864302898743779989999999999975998899997813069899999999


Q ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCCHH
Q ss_conf             9999975313689868999888889989
Q gi|254780484|r  173 KTKYLIRNYPTAHPEVIPTSSVKRKGIE  200 (212)
Q Consensus       173 ~~~~~~~~~~~~~~~i~~vSA~~g~Gi~  200 (212)
                      ++.+.+... ....+++++||++|.|||
T Consensus       153 ~i~~~l~~~-~~~~~v~~ISA~~g~GID  179 (179)
T TIGR03598       153 KIKKALKKD-ADDPSVQLFSSLKKTGIE  179 (179)
T ss_pred             HHHHHHHCC-CCCCCEEEEECCCCCCCC
T ss_conf             999997336-688948999799983879


No 3  
>COG0218 Predicted GTPase [General function prediction only]
Probab=100.00  E-value=1.3e-36  Score=229.65  Aligned_cols=192  Identities=46%  Similarity=0.724  Sum_probs=177.7

Q ss_pred             CEEEEEECCCHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEE
Q ss_conf             40478623656758876686899974899889899999738973798738884145212026655567850896499997
Q gi|254780484|r   11 AWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVD   90 (212)
Q Consensus        11 ~~~~~~~~~~~~~~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~D   90 (212)
                      -+.|++|++.+++.|.++.|+||++||+|||||||+|+|+|++.+|.++.+||+|+..|++.....         +.++|
T Consensus         6 ~~~f~~sa~~~~~~P~~~~~EIaF~GRSNVGKSSlIN~l~~~k~LArtSktPGrTq~iNff~~~~~---------~~lVD   76 (200)
T COG0218           6 KAKFITSAPDIKQYPEDDLPEIAFAGRSNVGKSSLINALTNQKNLARTSKTPGRTQLINFFEVDDE---------LRLVD   76 (200)
T ss_pred             CCEEEEECCCHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEECCCCCCCCCEEEEEEECCC---------EEEEE
T ss_conf             327898027775689988967999816866689999999678635565799985423679983585---------79981


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             60010111224478988889987777664200000112235788754545543210257532212222111102468999
Q gi|254780484|r   91 MPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQET  170 (212)
Q Consensus        91 tpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~  170 (212)
                      .||....+........+......+.........+.++.|......+.|.++++++...++|+++++||+|++++.+..+.
T Consensus        77 lPGYGyAkv~k~~~e~w~~~i~~YL~~R~~L~~vvlliD~r~~~~~~D~em~~~l~~~~i~~~vv~tK~DKi~~~~~~k~  156 (200)
T COG0218          77 LPGYGYAKVPKEVKEKWKKLIEEYLEKRANLKGVVLLIDARHPPKDLDREMIEFLLELGIPVIVVLTKADKLKKSERNKQ  156 (200)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHCHHHEEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHH
T ss_conf             79954032899999999999999996352224899999789998687999999999759986999971103774678889


Q ss_pred             HHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             99999997531368986899988888998999999998728
Q gi|254780484|r  171 LEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       171 ~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      +..+.+.+...+.+...++.+|+.++.|+++|+..|.+.++
T Consensus       157 l~~v~~~l~~~~~~~~~~~~~ss~~k~Gi~~l~~~i~~~~~  197 (200)
T COG0218         157 LNKVAEELKKPPPDDQWVVLFSSLKKKGIDELKAKILEWLK  197 (200)
T ss_pred             HHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             99999984689886643999865454489999999999864


No 4  
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=100.00  E-value=7.3e-34  Score=213.82  Aligned_cols=170  Identities=47%  Similarity=0.743  Sum_probs=132.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|||+|+||||||||+|+|+|+++.+.+++.||||+..+.+..         +..+.++||||+................
T Consensus         1 eIaivG~pN~GKSTL~N~L~~~~~~~~vs~~~gtTr~i~~~~~---------~~~~~~vDtPG~g~~~~~~~~~~~~~~~   71 (170)
T cd01876           1 EIAFAGRSNVGKSSLINALTNRKKLARTSKTPGKTQLINFFNV---------NDKFRLVDLPGYGYAKVSKEVKEKWGKL   71 (170)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCEEEEEEEEEE---------CCEEEEEECCCCHHCCCCHHHHHHHHHH
T ss_conf             9899989999999999999689962786078977852058853---------8779999657840101687799999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             98777766420000011223578875454554321025753221222211110246899999999997531368986899
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP  190 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  190 (212)
                      ...+.......+.++++.|+..+...++..+.+.+...++|+++|+||+|++++++.......+...+.. .....++++
T Consensus        72 ~~~~l~~~~~~~~vi~viD~~~~~~~~d~~i~~~l~~~~kp~iiVlNKiDlv~~~~~~~~~~~~~~~l~~-~~~~~~ii~  150 (170)
T cd01876          72 IEEYLENRENLKGVVLLIDSRHGPTEIDLEMLDWLEELGIPFLVVLTKADKLKKSELAKALKEIKKELKL-FEIDPPIIL  150 (170)
T ss_pred             HHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEEEECCCHHHHHHHHHHHHHHHHC-CCCCCEEEE
T ss_conf             9999984063349999996322374868999999987699879999867537877899999999998742-179983999


Q ss_pred             EECCCCCCHHHHHHHHHHHH
Q ss_conf             98888899899999999872
Q gi|254780484|r  191 TSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       191 vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +||++|+||++|++.|.++|
T Consensus       151 iSA~~g~gi~~L~~~I~~~L  170 (170)
T cd01876         151 FSSLKGQGIDELRALIEKWL  170 (170)
T ss_pred             EECCCCCCHHHHHHHHHHHC
T ss_conf             98899977999999999859


No 5  
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=100.00  E-value=1.6e-31  Score=200.32  Aligned_cols=171  Identities=23%  Similarity=0.317  Sum_probs=125.1

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      ++++|||+|+||||||||+|+|+|++. +.++++|+||+..      ........+.++.++||||+.............
T Consensus         1 ~~~~V~ivG~pN~GKSTL~N~l~g~~~-~~vs~~pgtTr~~------~~~~~~~~~~~~~~vDtpGi~~~~~~~~~~e~~   73 (174)
T cd01895           1 DPIRIAIIGRPNVGKSSLVNALLGEER-VIVSDIAGTTRDS------IDVPFEYDGKKYTLIDTAGIRRKGKVEEGIEKY   73 (174)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCC-EEECCCCCCEEEC------CEEEEEECCEEEEEEECCCCCCCCCCCCHHHHH
T ss_conf             998999998999989999999838984-4434999915733------289999999889998578842134421068899


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHH--HHHHHHHHHHHHHCCCCC
Q ss_conf             889987777664200000112235788754545543210257532212222111102468--999999999975313689
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTA--QETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~--~~~~~~~~~~~~~~~~~~  185 (212)
                        ............+.++++.|+..+..+++..+.+.+...+.|+++++||+|++++...  ....+.+.+.+.  ...+
T Consensus        74 --~~~~~~~~i~~~dvil~viDa~~~~~~~d~~i~~~l~~~~~p~iiv~NK~Dli~~~~~~~~~~~~~~~~~~~--~~~~  149 (174)
T cd01895          74 --SVLRTLKAIERADVVLLVIDATEGITEQDLRIAGLILEEGKALVIVVNKWDLVEKDSKTMKEFKKEIRRKLP--FLDY  149 (174)
T ss_pred             --HHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECEECCCCCHHHHHHHHHHHHHHHC--CCCC
T ss_conf             --999999999842865899758989988999999999985998699985675267647789999999998734--1689


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             868999888889989999999987
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      .+++++||++|+|+++|++.|.|.
T Consensus       150 ~~ii~iSA~~g~Gi~~L~~~I~ei  173 (174)
T cd01895         150 APIVFISALTGQGVDKLFDAIDEV  173 (174)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             928999744798999999999986


No 6  
>PRK09518 bifunctional cytidylate kinase/GTP-binding protein; Reviewed
Probab=100.00  E-value=9.4e-32  Score=201.70  Aligned_cols=172  Identities=19%  Similarity=0.189  Sum_probs=125.4

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             66868999748998898999997389737987388841452120266555678508964999976001011122447898
Q gi|254780484|r   27 AGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDS  106 (212)
Q Consensus        27 ~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~  106 (212)
                      +++++||||||||||||||+|+|+|+++ +.|++.||||++.      ........+..+.++||+|+............
T Consensus       450 ~~~~rIAIIGRPNVGKSTLiN~LlgeeR-~IVs~iaGTTRDs------Id~~~~~~g~~~~lIDTAGiRkk~k~~~~iE~  522 (714)
T PRK09518        450 SGLRRVALVGRPNVGKSSLLNQLTREER-AVVNDLAGTTRDP------VDEIVNIDGKDWLFVDTAGIRRKQKKLTGAEY  522 (714)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCE-EEECCCCCCEECE------EEEEEEECCEEEEEEECHHCCCCCCCCCCCCH
T ss_conf             6773588866998878999999968975-8856889850230------55679999978999986001524432543227


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             88899877776642000001122357887545455432102575322122221111024689999999999753136898
Q gi|254780484|r  107 WGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP  186 (212)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (212)
                        .........+..+++++++.|+..+...|+..+.......++++++++||+|++++.........++..+.  ...+.
T Consensus       523 --~S~~rt~~aI~~adVvllviDA~~git~QD~~Ia~~i~~~gk~~IivvNKWDLv~~~~~~~~~~~i~~~l~--~~~~a  598 (714)
T PRK09518        523 --YASLRTQAAIERCELALILFDASQPISEQDLRVMSMAVDAGRALVLAFNKWDLMDEFRRQRLEREIDTEFD--RVMWA  598 (714)
T ss_pred             --HHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECHHCCCHHHHHHHHHHHHHHCC--CCCCC
T ss_conf             --99999999886588999998677675289999999999859937999961430686689999999997563--68999


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             68999888889989999999987
Q gi|254780484|r  187 EVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       187 ~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      |++++||++|+|++.|.+.+.+.
T Consensus       599 piv~iSA~~g~~v~kl~~~i~~~  621 (714)
T PRK09518        599 ERVNISAKTGRHTNRLARAMDKA  621 (714)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHH
T ss_conf             88999667897889999999999


No 7  
>PRK03003 engA GTP-binding protein EngA; Reviewed
Probab=99.98  E-value=3.4e-31  Score=198.46  Aligned_cols=168  Identities=21%  Similarity=0.244  Sum_probs=121.0

Q ss_pred             HHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH
Q ss_conf             75887668689997489988989999973897379873888414521202665556785089649999760010111224
Q gi|254780484|r   22 GLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        22 ~~~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~  101 (212)
                      +.-|...+|.||||||||||||||||+|+|++ .|+|++.||+|++.      .++...+.+..+.++||+|+...... 
T Consensus        31 ~~~~~~~lPiVaIvGRPNVGKStLFNrL~~~~-~AIV~d~pGvTRDr------~~~~~~~~~~~f~lvDTgG~~~~~~~-  102 (474)
T PRK03003         31 DEEASGPLPVVAVVGRPNVGKSTLVNRILGRR-EAVVEDIPGVTRDR------VSYDAEWNGRRFVVQDTGGWEPDAKG-  102 (474)
T ss_pred             CCCCCCCCCEEEEECCCCCCHHHHHHHHHCCC-EEEECCCCCCCCCC------EEEEEEECCCEEEEEECCCCCCCHHH-
T ss_conf             56667999989998999988899999986886-38805989988086------36899999928999979999997478-


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             47898888998777766420000011223578875454554321025753221222211110246899999999997531
Q gi|254780484|r  102 KNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY  181 (212)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~  181 (212)
                          ...............+++++++.|...+....+.++.+++...+.|+++|+||+|....+..         ..+.|
T Consensus       103 ----~~~~i~~q~~~ai~eaD~IlfVvD~~~glt~~D~eia~~LRk~~kpviLVvNK~D~~~~~~~---------~~efy  169 (474)
T PRK03003        103 ----LQALVAEQAEVAMRTADAVLFVVDATVGATATDEAVARLLRRSGKPVFLAANKVDSERGEAD---------AAALW  169 (474)
T ss_pred             ----HHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHH---------HHHHH
T ss_conf             ----99999999999998699999999689898878999999987539977998675566210234---------89999


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             36898689998888899899999999872
Q gi|254780484|r  182 PTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       182 ~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .++..++++|||.+|.|+++|.+.|.+.+
T Consensus       170 ~LGf~~~i~ISA~Hg~Gi~dLld~i~~~l  198 (474)
T PRK03003        170 SLGLGEPHPVSALHGRGVADLLDAVLAAL  198 (474)
T ss_pred             HHCCCCEEEEEHHCCCCHHHHHHHHHHHC
T ss_conf             75799869960203789799999999748


No 8  
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=99.98  E-value=7.4e-31  Score=196.55  Aligned_cols=165  Identities=22%  Similarity=0.316  Sum_probs=122.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      +.|||+|+||||||||+|+|+|++ .+.+++.|+||+.+      ..+....++.++.++||||+.........     .
T Consensus         4 ~~V~ivG~pN~GKSsL~N~L~~~~-~a~vs~~~gtTr~~------~~~~~~~~~~~~~l~DtpG~~~~~~~~~~-----~   71 (168)
T cd04163           4 GFVAIVGRPNVGKSTLLNALVGQK-ISIVSPKPQTTRNR------IRGIYTDDDAQIIFVDTPGIHKPKKKLGE-----R   71 (168)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCC-EEEECCCCCEEECC------CEEEEEECCEEEEEEECCCCCCCHHHHHH-----H
T ss_conf             689999999999999999995897-03323889826344------23689849978999958986651456778-----9


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             99877776642000001122357887545455432102575322122221111024689999999999753136898689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVI  189 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~  189 (212)
                      ............+.++++.|...+....+..+.+.+...+.|.++++||+|++++.+...   ...+.... .....+++
T Consensus        72 ~~~~~~~~l~~~D~il~vvD~~~~~~~~d~~i~~~l~~~~~~~iivlNK~Dl~~~~~~~~---~~~~~~~~-~~~~~~vi  147 (168)
T cd04163          72 MVKAAWSALKDVDLVLFVVDASEPIGEGDEFILELLKKSKTPVILVLNKIDLVKDKEDLL---PLLEKLKE-LGPFAEIF  147 (168)
T ss_pred             HHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECEEECCCHHHHH---HHHHHHHH-HCCCCCEE
T ss_conf             999999865136558999978989866779999999980998599997887047877899---99999996-18999689


Q ss_pred             EEECCCCCCHHHHHHHHHHHH
Q ss_conf             998888899899999999872
Q gi|254780484|r  190 PTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       190 ~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ++||++|+|+++|++.|.+.|
T Consensus       148 ~iSA~~g~Gid~L~~~i~~~L  168 (168)
T cd04163         148 PISALKGENVDELLEEIVKYL  168 (168)
T ss_pred             EEECCCCCCHHHHHHHHHHHC
T ss_conf             997778969999999999539


No 9  
>PRK00089 era GTP-binding protein Era; Reviewed
Probab=99.97  E-value=6.5e-31  Score=196.87  Aligned_cols=163  Identities=25%  Similarity=0.337  Sum_probs=131.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      -|||+|+||||||||+|+|+|++ .+.|++.|+||+..      ..+....++.++.++||||+........     ...
T Consensus        10 ~VaivG~PNvGKSTL~N~l~~~k-~siVS~k~~TTR~~------i~gi~~~~~~q~i~iDTpGi~~~~~~l~-----~~~   77 (296)
T PRK00089         10 FVAIVGRPNVGKSTLLNALVGQK-ISIVSPKPQTTRHR------IRGIVTEDDAQIIFVDTPGIHKPKRALN-----RAM   77 (296)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCC-EEEECCCCCCCCCC------EEEEEEECCEEEEEEECCCCCCCHHHHH-----HHH
T ss_conf             99999899988899999996896-17614959987283------8999997997999998998667467787-----899


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             98777766420000011223578875454554321025753221222211110246899999999997531368986899
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP  190 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  190 (212)
                      ...........++++++.|+..+..+++....+.+.....|.++++||+|++++++....++.+.+..     .+..+++
T Consensus        78 ~~~~~~ai~~aDlil~viD~~~~~~~~d~~i~~~l~~~~kp~ilviNKiDlv~k~~l~~~~~~l~~~~-----~f~~if~  152 (296)
T PRK00089         78 NKAAWSSLKDVDLVLFVVDADEKIGPGDEFILEKLKKVKTPVILVLNKIDLVDKEELLPLLEELSELM-----DFAEIVP  152 (296)
T ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEHHHHCCHHHHHHHHHHHHHHC-----CCCEEEE
T ss_conf             99999999759999999857889898899999988874998899954788428988999999998537-----9765999


Q ss_pred             EECCCCCCHHHHHHHHHHHH
Q ss_conf             98888899899999999872
Q gi|254780484|r  191 TSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       191 vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +||++|.|+++|++.|.+.+
T Consensus       153 iSA~~~~gi~~L~~~l~~~l  172 (296)
T PRK00089        153 ISALKGDNVDELLDLIAKYL  172 (296)
T ss_pred             EECCCCCCHHHHHHHHHHHC
T ss_conf             96778889899999999867


No 10 
>PRK00093 engA GTP-binding protein EngA; Reviewed
Probab=99.97  E-value=1.4e-30  Score=194.89  Aligned_cols=173  Identities=23%  Similarity=0.307  Sum_probs=131.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      .++.++|||+|+||||||||+|+|+|+++ +.|++.||||++.      ........+..+.++||||+.......+.. 
T Consensus       169 ~~~~iriaiiGrpNvGKStl~N~ll~~~r-~ivs~~~GtTrD~------i~~~~~~~~~~~~~iDTaGirkk~k~~~~i-  240 (438)
T PRK00093        169 EEDPIKIAIIGRPNVGKSTLINALLGEER-VIVSDIAGTTRDS------IDTPFERDGQKYTLIDTAGIRRRGKVTEGI-  240 (438)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHH-HHCCCCCCCCCCC------EEEEEEECCCEEEEEECCCCCCCCCCCHHH-
T ss_conf             45560599955888655678887654333-2047999851123------267999899679999898987656421378-


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHH--HHHHHHHHHHHHHCCC
Q ss_conf             88889987777664200000112235788754545543210257532212222111102468--9999999999753136
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTA--QETLEKTKYLIRNYPT  183 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~--~~~~~~~~~~~~~~~~  183 (212)
                       ..............+++++++.|+..+...+|..++......++|.++++||+|++.+...  +...+.+...+  ...
T Consensus       241 -E~~s~~~t~~~i~~~dvvilviDa~~~~~~qD~~i~~~i~~~gk~~ii~vNKwDLv~~~~~~~~~~~~~i~~~l--~~~  317 (438)
T PRK00093        241 -EKYSVIRTLKAIERADVVLLVIDATEGITEQDLRIAGLALEAGRALVIVVNKWDLVEKDSKTMEEVKEELRRRL--PFL  317 (438)
T ss_pred             -HHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECHHCCCCCHHHHHHHHHHHHHHC--CCC
T ss_conf             -89999999999864466999997665884888999999998199669999702225663899999999999756--125


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             89868999888889989999999987
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      .+.|++++||++|.|++.|.+.+.+.
T Consensus       318 ~~~pIvfiSA~~g~gi~kl~~~i~~v  343 (438)
T PRK00093        318 DFAPIVFISALTGQGVDKLFESILEA  343 (438)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             89877998514777999999999999


No 11 
>PRK09518 bifunctional cytidylate kinase/GTP-binding protein; Reviewed
Probab=99.97  E-value=1.9e-30  Score=194.21  Aligned_cols=166  Identities=19%  Similarity=0.266  Sum_probs=135.9

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHH
Q ss_conf             87668689997489988989999973897379873888414521202665556785089649999760010111224478
Q gi|254780484|r   25 PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNV  104 (212)
Q Consensus        25 P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~  104 (212)
                      +...+|.||||||||||||||||+|+|++ .|+|.+.||+|++.      .+....+.+..+.++||+|+.....     
T Consensus       275 ~~~~~p~VAIVGRPNVGKSTLFNRL~g~r-~AIV~d~pGvTRDR------~~~~~~~~~~~F~lvDTGG~~~~~~-----  342 (714)
T PRK09518        275 GPEPVGTVAIVGRPNVGKSTLVNRILGRR-EAVVEDTPGVTRDR------VSYDAEWAGRDFKLVDTGGWEADAE-----  342 (714)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHCCC-EEEECCCCCCCCCC------CEEEEEECCEEEEEEECCCCCCCCH-----
T ss_conf             77888879998999876899998862884-16846989988375------5579999991699997999998832-----


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             98888998777766420000011223578875454554321025753221222211110246899999999997531368
Q gi|254780484|r  105 DSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       105 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                      ................+++++++.|...+....+..+..++...++|+++++||+|-...+..         ....|.++
T Consensus       343 ~~~~~I~~Q~~~Ai~eADlIlFVVD~~~Glt~~D~~ia~~LRk~~KpvilvvNK~D~~~~e~~---------~~ef~~LG  413 (714)
T PRK09518        343 GIEAAIASQAEIAMTLADAIVFVVDGQVGMTSTDEVIARMLQRAGKPVVLVANKIDDQASEYD---------VAEFWKLG  413 (714)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHH---------HHHHHHCC
T ss_conf             699999999999999689999999689798978999999998569988999989788764012---------99999659


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             986899988888998999999998728
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      ..++++|||.+|.|+++|.+.|.+.+.
T Consensus       414 ~~e~~~ISA~Hg~G~~dLld~i~~~l~  440 (714)
T PRK09518        414 LGEPYSISAMHGRGVADLLDVVLDSLK  440 (714)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             999689847357898999999996588


No 12 
>COG1160 Predicted GTPases [General function prediction only]
Probab=99.97  E-value=1.1e-30  Score=195.47  Aligned_cols=161  Identities=26%  Similarity=0.378  Sum_probs=129.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      |.||||||||||||||||+|+|++ .|.|++.||+|++.      .++...+.+..+.++||+|+.....    ......
T Consensus         4 ~~VAIVGRPNVGKSTLFNRL~g~r-~AIV~D~pGvTRDr------~y~~~~~~~~~f~lIDTgGl~~~~~----~~l~~~   72 (444)
T COG1160           4 PVVAIVGRPNVGKSTLFNRLTGRR-IAIVSDTPGVTRDR------IYGDAEWLGREFILIDTGGLDDGDE----DELQEL   72 (444)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCE-EEEEECCCCCCCCC------CCCEEEECCCEEEEEECCCCCCCCC----HHHHHH
T ss_conf             789998999875899998875770-26760699975577------5450698386079997899776881----289999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             99877776642000001122357887545455432102575322122221111024689999999999753136898689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVI  189 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~  189 (212)
                      .......+...+++.+++.|...+....|..+.+++....+|+++|+||+|....++         ...+.|.++..+++
T Consensus        73 i~~Qa~~Ai~eADvilfvVD~~~Git~~D~~ia~~Lr~~~kpviLvvNK~D~~~~e~---------~~~efyslG~g~~~  143 (444)
T COG1160          73 IREQALIAIEEADVILFVVDGREGITPADEEIAKILRRSKKPVILVVNKIDNLKAEE---------LAYEFYSLGFGEPV  143 (444)
T ss_pred             HHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHH---------HHHHHHHCCCCCCE
T ss_conf             999999999767999999848878997899999999853998899997666730456---------48999864789826


Q ss_pred             EEECCCCCCHHHHHHHHHHHH
Q ss_conf             998888899899999999872
Q gi|254780484|r  190 PTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       190 ~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +|||.+|.|+++|.+.+.+.+
T Consensus       144 ~ISA~Hg~Gi~dLld~v~~~l  164 (444)
T COG1160         144 PISAEHGRGIGDLLDAVLELL  164 (444)
T ss_pred             EEEHHHCCCHHHHHHHHHHHC
T ss_conf             842553569899999999756


No 13 
>PRK03003 engA GTP-binding protein EngA; Reviewed
Probab=99.97  E-value=4e-30  Score=192.33  Aligned_cols=172  Identities=19%  Similarity=0.223  Sum_probs=138.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      .+++|||+|+||||||||+|+|+|+++ +.|++.||||++.      ........+..+.++||+|+.............
T Consensus       210 ~~~rIAIvGrPNvGKStL~N~llg~~r-~ivs~~~GTTRDs------I~~~~~~~~~~~~liDTAGiRrk~kv~~~iE~~  282 (474)
T PRK03003        210 GPRRVALVGKPNVGKSSLLNKLAGEER-SVVHDVAGTTVDP------VDSLIELGGKVWRFVDTAGLRRKVGQASGHEFY  282 (474)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCC-EEECCCCCCCCCC------EEEEEEECCEEEEEEECCCCCCCCCCCCCHHHH
T ss_conf             762799980899878899999858975-6745899851544------058999999899999898766355334314589


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             88998777766420000011223578875454554321025753221222211110246899999999997531368986
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE  187 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~  187 (212)
                      .  .......+..+++++++.|+..+...|+..+.......+.+.++++||+|++++.......+.+...+.  ...+.|
T Consensus       283 s--~~rtl~aI~~advvilviDa~egit~QD~~Ia~~v~~~gk~~IivvNKwDLv~~~~~~~~~~~i~~~l~--~~~~~p  358 (474)
T PRK03003        283 A--SLRTHAAIDAAEVAVVLIDASEPLTEQDQRVLSMVIEAGRALVLAFNKWDLVDEDRRYYLEREIDRELA--QVRWAP  358 (474)
T ss_pred             H--HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECHHCCCHHHHHHHHHHHHHHHH--HCCCCC
T ss_conf             9--999999987335579998546587499999999999809957999971441686789999999986455--448985


Q ss_pred             EEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             89998888899899999999872
Q gi|254780484|r  188 VIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       188 i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ++++||++|.|++.|.+.+.+..
T Consensus       359 iv~ISA~~g~~i~kL~~~i~~v~  381 (474)
T PRK03003        359 RVNISAKTGRAVQKLVPALETAL  381 (474)
T ss_pred             EEEEEEECCCCHHHHHHHHHHHH
T ss_conf             69998104879899999999999


No 14 
>PRK00093 engA GTP-binding protein EngA; Reviewed
Probab=99.97  E-value=1.1e-30  Score=195.59  Aligned_cols=163  Identities=24%  Similarity=0.305  Sum_probs=131.6

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      .|.|||+||||||||||||+|+|++ .|.|++.||+|++.      .++...+.+..+.++||||+......    ....
T Consensus         1 ~p~VaIvGrpNvGKStLfN~l~~~~-~aIv~~~~G~TRD~------~~~~~~~~~~~~~lvDT~G~~~~~~~----~~~~   69 (438)
T PRK00093          1 KPVVAIVGRPNVGKSTLFNRLTGKR-DAIVADTPGVTRDR------IYGEAEWLGREFIVIDTGGIDPGDED----GFEK   69 (438)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCC-EEEECCCCCCCCCC------EEEEEEECCEEEEEEECCCCCCCCCH----HHHH
T ss_conf             9989998999987899999986886-18715989998471------58999999928999989798988820----7999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             89987777664200000112235788754545543210257532212222111102468999999999975313689868
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEV  188 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i  188 (212)
                      ............+++++++.|...+....|.++.+++...+.|+++++||+|....+..         ..+.|.+|..++
T Consensus        70 ~i~~q~~~ai~~aDlIlfVvD~~~git~~D~~i~~~Lrk~~k~vilviNK~D~~~~~~~---------~~ef~~LGf~~~  140 (438)
T PRK00093         70 QMREQALLAIEEADVILFVVDGRAGLTPADEEIAKILRKSNKPVILVVNKVDGKKMEAD---------AYEFYSLGLGEP  140 (438)
T ss_pred             HHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHH---------HHHHHHHCCCCE
T ss_conf             99999999998589999998377689878999999999739978999975566320345---------999998368981


Q ss_pred             EEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             99988888998999999998728
Q gi|254780484|r  189 IPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       189 ~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      ++|||.+|.|+++|.+.|.+.+.
T Consensus       141 i~iSA~h~~Gi~~L~~~i~~~l~  163 (438)
T PRK00093        141 YPISAEHGRGIGDLLDAILELLP  163 (438)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCC
T ss_conf             88853056698999999985488


No 15 
>PRK04213 GTP-binding protein; Provisional
Probab=99.97  E-value=5.4e-30  Score=191.56  Aligned_cols=167  Identities=32%  Similarity=0.527  Sum_probs=111.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH-HHHHHH
Q ss_conf             8689997489988989999973897379873888414521202665556785089649999760010111224-478988
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK-KNVDSW  107 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~-~~~~~~  107 (212)
                      .|+||||||||||||||+|+|+|++  +.+++.||+|+.++.+.          ...+.++||||+....... ......
T Consensus         1 ~P~VaivGRpNVGKSTL~N~L~g~k--~~vs~~pg~Tr~~~~~~----------~~~~~~vDtPG~g~~~~~~~~~~~~~   68 (195)
T PRK04213          1 MPEIIFVGRSNVGKSTLIRALTGKK--VRVGKRPGVTLKPNEYD----------WGDFILVDLPGFGFMSGVPKKVQERI   68 (195)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCC--CCCCCCCCEEEEEEEEE----------CCCEEEEECCCCCCCCCCCHHHHHHH
T ss_conf             9879997699988999999996898--51348996487345885----------08899999999622245888899999


Q ss_pred             HHHHHHHH-HHHHHHCCCCCCCCCC-----------CCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             88998777-7664200000112235-----------78875454554321025753221222211110246899999999
Q gi|254780484|r  108 GGLIVRYL-SERSTLRCVYLLIDCR-----------HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK  175 (212)
Q Consensus       108 ~~~~~~~~-~~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~  175 (212)
                      ........ ......+.++++.|..           .+....+.++.+++...+.|+++++||+|++.+.+  +.++.+.
T Consensus        69 ~~~~~~~~~~~~~~~~~~~~vvD~~~~~~~~dr~~~~~~~~~D~~i~~~l~~~~~p~ilv~NKiD~i~~~~--~~l~~i~  146 (195)
T PRK04213         69 KDEIVHYIEDNADRIAAAVLVVDGKSFPEIIERWESRGEIPIDVEMFDFLRELGINPIVAVNKMDKIKNSE--EVLDEIA  146 (195)
T ss_pred             HHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECHHHCCCHH--HHHHHHH
T ss_conf             99999999998851789999995786544211234456777789999999874998799998733058778--8899999


Q ss_pred             HHHHHCC---CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9975313---6898689998888899899999999872
Q gi|254780484|r  176 YLIRNYP---TAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       176 ~~~~~~~---~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +.+..+.   .....++++||+++ |||+|++.|.+.|
T Consensus       147 e~~~~~~~~~~~~~~iv~iSakk~-Gid~L~~~I~~~L  183 (195)
T PRK04213        147 ERLGLYPPWRQWLDIIAPISAKKG-GIEALKGLINKRL  183 (195)
T ss_pred             HHHHCCCCHHHCCCEEEEEECCCC-CHHHHHHHHHHHC
T ss_conf             998257615656987999845779-9999999999967


No 16 
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=99.97  E-value=7.3e-30  Score=190.82  Aligned_cols=174  Identities=22%  Similarity=0.294  Sum_probs=135.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      .++.++|||+|+||||||||+|+|+|+++ +.|++.||||++.      ........+..+.++||||+.......+...
T Consensus       169 ~~~~iriaivGrPNvGKSTl~N~ll~~~r-~ivs~~~GtTrD~------i~~~~~~~~~~~~~iDTaGirkk~k~~~~~e  241 (429)
T TIGR03594       169 EDGPIKIAIIGRPNVGKSTLVNALLGEER-VIVSDIAGTTRDS------IDIPFERNGKKYLLIDTAGIRRKGKVTEGIE  241 (429)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHH-HHCCCCCCCCCCC------EEEEEEECCEEEEEEECCCCCCCCCCCHHHH
T ss_conf             55652699974887654677777654333-2147999863102------6879999990899998988763664230477


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHH-HHHHHHHHHHHHHHCCCC
Q ss_conf             8888998777766420000011223578875454554321025753221222211110246-899999999997531368
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTT-AQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~-~~~~~~~~~~~~~~~~~~  184 (212)
                        .............+++++++.|+..+...+|..+.......+.|.++++||+|++.+.. .+...+.+.+.+.  ...
T Consensus       242 --~~s~~~t~~~i~~~dvvil~iD~~~~~~~qD~~i~~~i~~~~k~~ii~~NK~Dli~~~~~~~~~~~~i~~~l~--~~~  317 (429)
T TIGR03594       242 --KYSVLRTLKAIERADVVLLVLDATEGITEQDLRIAGLALEAGKALIIVVNKWDLVKDEKTREEFKKELRRKLP--FLD  317 (429)
T ss_pred             --HHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEHHHCCCCHHHHHHHHHHHHHHCC--CCC
T ss_conf             --9999999999874477999997665884888999998987399769999722303799999999999998562--368


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             98689998888899899999999872
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +.|++++||++|.|++.|.+.+.+..
T Consensus       318 ~~pI~fiSA~~g~gi~kl~~~i~~~~  343 (429)
T TIGR03594       318 FAPIVFISALTGQGVDKLLDAIDEVY  343 (429)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             98689973457789999999999999


No 17 
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=99.97  E-value=8.9e-30  Score=190.33  Aligned_cols=160  Identities=25%  Similarity=0.320  Sum_probs=130.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      .|||+||||||||||||+|+|++ .|.|++.||+|++.      .++.....+..+.++||||+.....     ......
T Consensus         1 ~VaIvGrpNVGKStLfN~L~~~~-~aIv~~~~G~TRD~------~~~~~~~~~~~~~liDT~G~~~~~~-----~~~~~~   68 (429)
T TIGR03594         1 VVAIVGRPNVGKSTLFNRLTGKR-DAIVADTPGVTRDR------KYGDAEWGGREFILIDTGGIEEDDD-----GLDKQI   68 (429)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCC-EEECCCCCCCCCCC------EEEEEEECCEEEEEEECCCCCCCCH-----HHHHHH
T ss_conf             98999999987899999987886-17615989988773------3799999990799998989898743-----789999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             98777766420000011223578875454554321025753221222211110246899999999997531368986899
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP  190 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  190 (212)
                      ..........++.++++.|...+....|.++.+++.....|+++++||+|....++         ...+.+.+|..++++
T Consensus        69 ~~q~~~ai~~aDlIlfVvD~~~git~~D~~i~~~Lrk~~k~vilviNK~D~~~~~~---------~~~ef~~LG~~~~i~  139 (429)
T TIGR03594        69 REQAEIAIEEADVILFVVDGREGLTPEDEEIAKWLRKSGKPVILVANKIDGKKEDA---------VAAEFYSLGFGEPIP  139 (429)
T ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHH---------HHHHHHHHCCCCEEE
T ss_conf             99999999867999999857768986799999999871997899998346753145---------699999836898688


Q ss_pred             EECCCCCCHHHHHHHHHHHHC
Q ss_conf             988888998999999998728
Q gi|254780484|r  191 TSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       191 vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      |||.+|.|+++|.+.|.+.+.
T Consensus       140 iSA~h~~Gi~~L~~~i~~~l~  160 (429)
T TIGR03594       140 ISAEHGRGIGDLLDAILELLP  160 (429)
T ss_pred             EEECCCCCHHHHHHHHHHHCC
T ss_conf             742046799999999996588


No 18 
>cd01894 EngA1 EngA1 subfamily.  This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability.  A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=99.97  E-value=6.7e-30  Score=191.03  Aligned_cols=157  Identities=25%  Similarity=0.321  Sum_probs=118.9

Q ss_pred             EEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99748998898999997389737987388841452120266555678508964999976001011122447898888998
Q gi|254780484|r   33 AFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIV  112 (212)
Q Consensus        33 aivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~  112 (212)
                      ||+|+||||||||+|+|+|++ .+.|++.|+||+..      ..+.....+.++.++||||+...........     ..
T Consensus         1 aivG~pN~GKSsL~N~l~~~~-~~ivs~~~gtTr~~------~~~~~~~~~~~~~lvDTpG~~~~~~~~~~~~-----~~   68 (157)
T cd01894           1 AIVGRPNVGKSTLFNRLTGRR-DAIVEDTPGVTRDR------IYGEAEWGGREFILIDTGGIEPDDEGISKEI-----RE   68 (157)
T ss_pred             CCCCCCCCCHHHHHHHHHCCC-CEEEECCCCCEEEE------EEEEEEECCEEEEEEECCCCCCCCCHHHHHH-----HH
T ss_conf             904899988999999995887-53540799935667------8999999998899985787555660678999-----99


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEE
Q ss_conf             77776642000001122357887545455432102575322122221111024689999999999753136898689998
Q gi|254780484|r  113 RYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS  192 (212)
Q Consensus       113 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vS  192 (212)
                      .........+.++++.|+..+....+..+.+.+...+.|+++++||+|++++.+....   .    ..  .+..+++++|
T Consensus        69 ~~~~~i~~ad~il~viDa~~~~~~~d~~i~~~l~~~~kp~i~v~NK~D~~~~~~~~~~---~----~~--l~~~~~i~iS  139 (157)
T cd01894          69 QAELAIEEADVILFVVDGREGLTPADEEIAKYLRKSKKPVILVVNKVDNIKEEDEAAE---F----YS--LGFGEPIPIS  139 (157)
T ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHH---H----HH--CCCCCEEEEE
T ss_conf             9999998659079999899999989999999999847980999978716586456999---9----96--5999759999


Q ss_pred             CCCCCCHHHHHHHHHHHH
Q ss_conf             888899899999999872
Q gi|254780484|r  193 SVKRKGIEVLRKAILETI  210 (212)
Q Consensus       193 A~~g~Gi~eL~~~I~~~l  210 (212)
                      |++|+|+++|++.|.+.|
T Consensus       140 A~~g~Gid~L~~~I~~~L  157 (157)
T cd01894         140 AEHGRGIGDLLDAILELL  157 (157)
T ss_pred             EECCCCHHHHHHHHHHHC
T ss_conf             658949999999999659


No 19 
>pfam02421 FeoB_N Ferrous iron transport protein B. Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=99.97  E-value=8.5e-30  Score=190.44  Aligned_cols=160  Identities=24%  Similarity=0.305  Sum_probs=110.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|||+|+||||||||+|+|+|++  +.+++.||||++.      ..+.....+.++.++||||+........ ...... 
T Consensus         1 tVaIvG~PNvGKSTLlN~L~g~~--~~Vs~~pGtTrd~------~~~~~~~~~~~~~lvDTpGi~~~~~~~~-~e~v~~-   70 (188)
T pfam02421         1 TIALVGNPNVGKTTLFNALTGAR--QHVGNWPGVTVEK------KEGTFKYKGYEIEIVDLPGTYSLSPYSE-EEKVAR-   70 (188)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCC--CEEECCCCCCCCE------EEEEEEECCEEEEEEECCCCCCCCCCCH-HHHHHH-
T ss_conf             98998899989999999995999--6563899972333------5768752516799996888501465327-899999-


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             98777766420000011223578875454554321025753221222211110246899999999997531368986899
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP  190 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  190 (212)
                       . .. .....++++++.|+...  +....+.......+.|.++++||+|++++.......+.+.+.+      +.++++
T Consensus        71 -~-~~-~~~~aDlvl~vvDa~~~--er~l~l~~~l~~~~~p~IvVlNK~Dl~~~~~~~~~~~~l~~~l------g~~vi~  139 (188)
T pfam02421        71 -D-YL-LEEKPDVIINVVDATNL--ERNLYLTLQLLELGIPVVVALNMMDEAEKKGIKIDIKKLSELL------GVPVVP  139 (188)
T ss_pred             -H-HH-HHCCCCCEEEEEECCCH--HHHHHHHHHHHHCCCCEEEEECCCHHCCCCCCHHHHHHHHHHC------CCCEEE
T ss_conf             -9-98-62368736999767624--5448999999976998899961702010036520399999873------996899


Q ss_pred             EECCCCCCHHHHHHHHHHHHC
Q ss_conf             988888998999999998728
Q gi|254780484|r  191 TSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       191 vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      +||++|+|+++|++.|.+.+.
T Consensus       140 ISA~~g~Gi~eL~~~I~~~~~  160 (188)
T pfam02421       140 TSARKGEGIDELKDAIIEVAE  160 (188)
T ss_pred             EEEECCCCHHHHHHHHHHHHH
T ss_conf             993169999999999999972


No 20 
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=99.97  E-value=1.5e-29  Score=189.03  Aligned_cols=162  Identities=23%  Similarity=0.267  Sum_probs=107.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      |.|||+|+||||||||+|+|+|++.  .++++|+||+..      ..+....++.++.++||||+..........  ...
T Consensus         1 P~VaivG~pNvGKStL~N~L~g~~~--~v~~~p~TTr~~------~~~~~~~~~~~~~liDTpGi~~~~~~~~~~--ie~   70 (168)
T cd01897           1 PTLVIAGYPNVGKSSLVNKLTRAKP--EVAPYPFTTKSL------FVGHFDYKYLRWQVIDTPGLLDRPLEERNT--IEM   70 (168)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC--EECCCCCCCCCC------EEEEEEECCCEEEEECCCCCCCCCHHHHHH--HHH
T ss_conf             9799988999889999999958986--023758723574------368999837276872488655674788889--999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC---CHHHHHHHHHHCC--CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             9987777664200000112235788---7545455432102--5753221222211110246899999999997531368
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV---KQIDQDVFSFLDK--KAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~--~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                      ...  .......+.++++.|.....   .+...........  ...|.++++||+|+++++......+    .   +...
T Consensus        71 ~~~--~~l~~~~d~il~viD~~~~~~~~~~~~~~l~~~i~~~~~~~p~i~v~NK~Dl~~~~~~~~~~~----~---~~~~  141 (168)
T cd01897          71 QAI--TALAHLRAAVLFLFDPSETCGYSLEEQLSLFEEIKPLFKNKPVIVVLNKIDLLTFEDLSEIEE----E---EELE  141 (168)
T ss_pred             HHH--HHHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHH----H---HHCC
T ss_conf             999--999835776899996887678489999999998776525888799994753458100799999----9---9708


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             98689998888899899999999872
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +.++++|||++|.|+++|+++|++.|
T Consensus       142 ~~~vi~ISA~~g~Gi~~L~~~i~ell  167 (168)
T cd01897         142 GEEVLKISTLTEEGVDEVKNKACELL  167 (168)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             99889998158969999999999963


No 21 
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=99.96  E-value=7.8e-29  Score=184.90  Aligned_cols=163  Identities=22%  Similarity=0.271  Sum_probs=110.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      +++.|.|||||+||||||||||+|+|++.  .+.++|++|+.+...     .....++.++.++||||+..... .....
T Consensus        38 ~~g~p~VaivG~PNvGKSTLlN~L~g~~~--~v~~~~~tT~d~~~~-----~i~~~~~~~i~l~DT~G~i~~~p-~~lie  109 (204)
T cd01878          38 RSGIPTVALVGYTNAGKSTLFNALTGADV--YAEDQLFATLDPTTR-----RLRLPDGREVLLTDTVGFIRDLP-HQLVE  109 (204)
T ss_pred             HCCCCEEEEECCCCCCHHHHHHHHHCCCC--EEECCCCCCCCCEEE-----EEEECCCCEEEEEECCCCCCCCC-HHHHH
T ss_conf             45998799988999989999999948996--341567764576366-----89956997799983686446783-78999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHH----HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             888899877776642000001122357887545----4554321025753221222211110246899999999997531
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVKQID----QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY  181 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~  181 (212)
                      ....    .......++.++++.|.........    ......+.....|+++|+||+|++++.+.....          
T Consensus       110 ~~~~----tle~i~~AD~il~vvD~s~~~~~~~~~~~~~~l~~l~~~~k~~i~V~NKiDl~~~~~~~~~~----------  175 (204)
T cd01878         110 AFRS----TLEEVAEADLLLHVVDASDPDYEEQIETVEKVLKELGAEDIPMILVLNKIDLLDDEELEERL----------  175 (204)
T ss_pred             HHHH----HHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHHH----------
T ss_conf             9999----99999739899999979985366779999999998065557607888670479957589999----------


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             36898689998888899899999999872
Q gi|254780484|r  182 PTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       182 ~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .....++++|||++|.|+++|++.|.+.|
T Consensus       176 ~~~~~~~i~ISA~~g~Gid~L~~~I~e~L  204 (204)
T cd01878         176 EAGRPDAVFISAKTGEGLDELLEAIEELL  204 (204)
T ss_pred             HHCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             70899879998868949999999999559


No 22 
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily.  E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions.  FeoB has been identified as part of this transport system.  FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=99.96  E-value=9.5e-29  Score=184.42  Aligned_cols=157  Identities=24%  Similarity=0.299  Sum_probs=109.2

Q ss_pred             EECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97489988989999973897379873888414521202665556785089649999760010111224478988889987
Q gi|254780484|r   34 FSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVR  113 (212)
Q Consensus        34 ivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~  113 (212)
                      |+|+||||||||+|+|+|++  +.++++||||++.      ..+.+..++.++.++||||+............ ..   .
T Consensus         1 ivG~pNvGKSTL~N~L~g~~--~~vs~~pgtTrd~------~~~~~~~~~~~~~lvDtpGi~~~~~~~~~e~i-~~---~   68 (158)
T cd01879           1 LVGNPNVGKTTLFNALTGAR--QKVGNWPGVTVEK------KEGRFKLGGKEIEIVDLPGTYSLSPYSEDEKV-AR---D   68 (158)
T ss_pred             CCCCCCCCHHHHHHHHHCCC--CEECCCCCCEEEE------EEEEEEECCEEEEEEECCCCCCCCCCCHHHHH-HH---H
T ss_conf             97989888999999995998--6461789827634------78899629937999979874125641356789-99---9


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEC
Q ss_conf             77766420000011223578875454554321025753221222211110246899999999997531368986899988
Q gi|254780484|r  114 YLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS  193 (212)
Q Consensus       114 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA  193 (212)
                      ... ....+.++++.|...  .+.+..........+.|+++|+||+|++++.......+.+.+.+      +.+++++||
T Consensus        69 ~~~-~~~~d~vl~vvD~~~--~~~~l~~~~~l~~~~~p~ivV~NK~D~~~~~~~~~~~~~l~~~~------~~~ii~iSA  139 (158)
T cd01879          69 FLL-GEKPDLIVNVVDATN--LERNLYLTLQLLELGLPVVVALNMIDEAEKRGIKIDLDKLSELL------GVPVVPTSA  139 (158)
T ss_pred             HHH-HCCCCCEEEEEECCH--HHHHHHHHHHHHHCCCCEEEEEEHHHHHHHCCCHHHHHHHHHHC------CCCEEEEEC
T ss_conf             998-517871799977740--67768999999865998899940277655225466799999871------994899987


Q ss_pred             CCCCCHHHHHHHHHHHHC
Q ss_conf             888998999999998728
Q gi|254780484|r  194 VKRKGIEVLRKAILETIN  211 (212)
Q Consensus       194 ~~g~Gi~eL~~~I~~~l~  211 (212)
                      ++|+|+++|++.|.+.++
T Consensus       140 ~~g~Gi~~L~~~i~el~~  157 (158)
T cd01879         140 RKGEGIDELKDAIAELAE  157 (158)
T ss_pred             CCCCCHHHHHHHHHHHHC
T ss_conf             789799999999999867


No 23 
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=99.96  E-value=2.1e-28  Score=182.42  Aligned_cols=155  Identities=24%  Similarity=0.318  Sum_probs=114.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+|+|+||||||||+|+|+|++ .+.+++.|+||+..      ..+....++.++.++||||+.......+....   
T Consensus         2 ~~ValvG~pN~GKStL~N~l~g~~-~~ivs~~pgtTrd~------~~~~~~~~~~~i~l~DTpG~~~~~~~~e~~~~---   71 (157)
T cd04164           2 IKVVIVGKPNVGKSSLLNALAGRD-RAIVSDIAGTTRDV------IEESIDIGGIPVRLIDTAGIRETEDEIEKIGI---   71 (157)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCC-CEEECCCCCEEEEC------CEEEEEECCEEEEEEECCCCCCCCCHHHHHHH---
T ss_conf             799998899998999999996897-33432889847863------26789539988999726775444578999999---


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             99877776642000001122357887545455432102575322122221111024689999999999753136898689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVI  189 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~  189 (212)
                        ..........+.++++.|........+.......  ...|+++++||+|++++.+....            ....+++
T Consensus        72 --~~~~~~i~~aDlil~vvD~~~~~~~~~~~~~~~~--~~~p~i~v~NKiDl~~~~~~~~~------------~~~~~vi  135 (157)
T cd04164          72 --ERAREAIEEADLVLFVIDASRGLDEEDLEILELP--ADKPIIVVLNKSDLLPDSELLSL------------LAGKPII  135 (157)
T ss_pred             --HHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHH--CCCCEEEEEECCCCCCCHHHHHH------------CCCCCEE
T ss_conf             --9998630157679999889877888899999851--47998999967601486667985------------2899779


Q ss_pred             EEECCCCCCHHHHHHHHHHHH
Q ss_conf             998888899899999999872
Q gi|254780484|r  190 PTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       190 ~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +|||++|+|+++|++.|.+..
T Consensus       136 ~ISA~~g~Gi~~L~~~I~e~a  156 (157)
T cd04164         136 AISAKTGEGLDELKEALLELA  156 (157)
T ss_pred             EEECCCCCCHHHHHHHHHHHC
T ss_conf             998527959999999999972


No 24 
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=99.96  E-value=2.2e-28  Score=182.35  Aligned_cols=163  Identities=26%  Similarity=0.354  Sum_probs=123.3

Q ss_pred             EECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97489988989999973897379873888414521202665556785089649999760010111224478988889987
Q gi|254780484|r   34 FSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVR  113 (212)
Q Consensus        34 ivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~  113 (212)
                      |+|+||||||||+|+|+|++ .+.+++.|+||+.+......     ..+..++.++||||+..........      ...
T Consensus         1 ivG~~N~GKStL~N~L~~~~-~~~vs~~~gtT~~~~~~~~~-----~~~~~~i~lvDtpG~~~~~~~~~~~------~~~   68 (163)
T cd00880           1 LFGRTNAGKSSLLNALLGQE-VAIVSPVPGTTTDPVEYVWE-----LGPLGPVVLIDTPGIDEAGGLGRER------EEL   68 (163)
T ss_pred             CCCCCCCCHHHHHHHHHCCC-CCEECCCCCEECCCEEEEEE-----ECCCCEEEEEECCCCCCCCCHHHHH------HHH
T ss_conf             91979989999999995899-61016989986564589999-----5478659997279852223101689------999


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEC
Q ss_conf             77766420000011223578875454554321025753221222211110246899999999997531368986899988
Q gi|254780484|r  114 YLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS  193 (212)
Q Consensus       114 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA  193 (212)
                      ........+.++++.+........+......+...+.|.++++||+|++++.+.............  .....+++++||
T Consensus        69 ~~~~~~~~D~il~viD~~~~~~~~~~~~l~~l~~~~~p~i~v~NK~D~~~~~~~~~~~~~~~~~~~--~~~~~~i~~iSA  146 (163)
T cd00880          69 ARRVLERADLILFVVDADLRADEEEEKLLELLRERGKPVLLVLNKIDLLPEEEEEELLELRLLILL--LLLGLPVIAVSA  146 (163)
T ss_pred             HHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECEECCCHHHHHHHHHHHHHHHH--HCCCCEEEEEEC
T ss_conf             999998689899998789997556699999999719742788534206787899999999999987--679985999978


Q ss_pred             CCCCCHHHHHHHHHHHH
Q ss_conf             88899899999999872
Q gi|254780484|r  194 VKRKGIEVLRKAILETI  210 (212)
Q Consensus       194 ~~g~Gi~eL~~~I~~~l  210 (212)
                      ++|.|+++|++.|.+.|
T Consensus       147 ~~g~gi~~L~~~i~e~L  163 (163)
T cd00880         147 LTGEGIDELREALIEAL  163 (163)
T ss_pred             CCCCCHHHHHHHHHHHC
T ss_conf             98979999999999519


No 25 
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=99.96  E-value=2.2e-28  Score=182.37  Aligned_cols=162  Identities=22%  Similarity=0.230  Sum_probs=106.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|||+|+||||||||+|+|+|.+.  .+++.||||+.+....     ....+..++.++||||+........... ...+
T Consensus         2 ~VAiiG~pNvGKSTLlN~l~~~~~--~V~~~pgTT~~~~~g~-----i~~~~~~~i~~~DtpGi~~~~~~~~~l~-~~~l   73 (170)
T cd01898           2 DVGLVGLPNAGKSTLLSAISNAKP--KIADYPFTTLVPNLGV-----VRVDDGRSFVVADIPGLIEGASEGKGLG-HRFL   73 (170)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCC--EEECCCCCCCCCEEEE-----EEECCCCEEEEECCCCCCCCCCCCCCHH-HHHH
T ss_conf             589989999989999999967876--0325666523744779-----9936985699964886444554662248-9998


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCC--HHHHHHHHHHC-----CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9877776642000001122357887--54545543210-----2575322122221111024689999999999753136
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVK--QIDQDVFSFLD-----KKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT  183 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~-----~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~  183 (212)
                           ......+.++++.|......  .+.....+.+.     ...+|.++++||+|++.+++..+....+...     .
T Consensus        74 -----~~i~~advil~vvD~~~~~~~~~~~~~i~~~l~~~~~~~~~kp~ilv~NK~Dl~~~~~~~~~~~~~~~~-----~  143 (170)
T cd01898          74 -----RHIERTRLLLHVIDLSGDDDPVEDYKTIRNELELYNPELLEKPRIVVLNKIDLLDEEELFELLKELLKE-----L  143 (170)
T ss_pred             -----HCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCHHHHCCCCEEEEEHHHCCCHHHHHHHHHHHHHH-----C
T ss_conf             -----613345617999989987898999999999999827444038650677620242835638999999985-----6


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             898689998888899899999999872
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+.+++++||++|+|+++|++.|.+.|
T Consensus       144 ~~~~vi~iSA~~g~gi~~L~~~I~~~L  170 (170)
T cd01898         144 WGKPVFPISALTGEGLDELLRKLAELL  170 (170)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             999589997547979999999999669


No 26 
>COG1159 Era GTPase [General function prediction only]
Probab=99.96  E-value=7.1e-28  Score=179.40  Aligned_cols=164  Identities=26%  Similarity=0.349  Sum_probs=127.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      -|||+||||||||||+|+|.|+| ++.+++.|.||+.      ...+....+..+..|+||||+...+..  ........
T Consensus         8 fVaIiGrPNvGKSTLlN~l~G~K-isIvS~k~QTTR~------~I~GI~t~~~~QiIfvDTPGih~pk~~--l~~~m~~~   78 (298)
T COG1159           8 FVAIIGRPNVGKSTLLNALVGQK-ISIVSPKPQTTRN------RIRGIVTTDNAQIIFVDTPGIHKPKHA--LGELMNKA   78 (298)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCC-EEEECCCCCHHHH------HEEEEEECCCCEEEEEECCCCCCCCHH--HHHHHHHH
T ss_conf             99998699876899998985682-5751598531144------214799869844999848988876517--88999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHH-HHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             98777766420000011223578875454554321025753221222211110246-89999999999753136898689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTT-AQETLEKTKYLIRNYPTAHPEVI  189 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~-~~~~~~~~~~~~~~~~~~~~~i~  189 (212)
                         ........++++++.++...+..-+....+.+.....|.++++||+|++.+.. .....+.....     ..+..++
T Consensus        79 ---a~~sl~dvDlilfvvd~~~~~~~~d~~il~~lk~~~~pvil~iNKID~~~~~~~l~~~~~~~~~~-----~~f~~iv  150 (298)
T COG1159          79 ---ARSALKDVDLILFVVDADEGWGPGDEFILEQLKKTKTPVILVVNKIDKVKPKTVLLKLIAFLKKL-----LPFKEIV  150 (298)
T ss_pred             ---HHHHHCCCCEEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHH-----CCCCEEE
T ss_conf             ---99872457599999866656891079999977643898699998402578477899999999850-----8830179


Q ss_pred             EEECCCCCCHHHHHHHHHHHHC
Q ss_conf             9988888998999999998728
Q gi|254780484|r  190 PTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       190 ~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      |+||++|.|++.|.+.|.+.|.
T Consensus       151 piSA~~g~n~~~L~~~i~~~Lp  172 (298)
T COG1159         151 PISALKGDNVDTLLEIIKEYLP  172 (298)
T ss_pred             EEECCCCCCHHHHHHHHHHHCC
T ss_conf             9510156788999999998588


No 27 
>cd04171 SelB SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo
Probab=99.96  E-value=2.2e-27  Score=176.52  Aligned_cols=160  Identities=23%  Similarity=0.313  Sum_probs=121.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCC-EEEECCCCCEEEECCEEEEEEEEEEE-ECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             899974899889899999738973-79873888414521202665556785-0896499997600101112244789888
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKN-LARTSNAPGRTQHLNFFVPKDFSNLK-NNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~-~a~~~~~p~tt~~~~~~~~~~~~~~~-~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      -||++||||||||||+|+|+|.+. ........|.|....      ..... .++..+.++||||+...           
T Consensus         2 vVaivG~~n~GKSTL~n~L~g~~~d~~~~e~~~giTi~~~------~~~~~~~~~~~i~~iDtPGh~~~-----------   64 (164)
T cd04171           2 IIGTAGHIDHGKTTLIKALTGIETDRLPEEKKRGITIDLG------FAYLDLPSGKRLGFIDVPGHEKF-----------   64 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCHHHHCCCEEEEEE------EEEEECCCCCEEEEEECCCHHHH-----------
T ss_conf             9999926887299999998496466333333486379854------68786489989999948787999-----------


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-CCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             8998777766420000011223578875454554321025753-221222211110246899999999997531368986
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS-YQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE  187 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~  187 (212)
                        ...........+.++++.++..+...++.+....+...+.| .++++||+|+++++......+++++.++.+.....+
T Consensus        65 --~~~~~~~~~~aD~~llVvda~~g~~~q~~e~~~~~~~~~i~~~ivvlNK~D~v~~~~~~~~~~~i~~~l~~~~~~~~p  142 (164)
T cd04171          65 --IKNMLAGAGGIDLVLLVVAADEGIMPQTREHLEILELLGIKRGLVVLTKADLVDEDWLELVEEEIRELLAGTFLADAP  142 (164)
T ss_pred             --HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCE
T ss_conf             --999999874267258998617788888999999998738872787346342579789999999999999743999982


Q ss_pred             EEEEECCCCCCHHHHHHHHHHH
Q ss_conf             8999888889989999999987
Q gi|254780484|r  188 VIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       188 i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      ++|+||++|+|+++|++.|.+.
T Consensus       143 ii~iSA~tG~Gi~eL~~~I~el  164 (164)
T cd04171         143 IFPVSAVTGEGIEELKEYLDEL  164 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHHC
T ss_conf             9994698982999999999849


No 28 
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed
Probab=99.95  E-value=1.8e-27  Score=177.10  Aligned_cols=153  Identities=22%  Similarity=0.281  Sum_probs=115.1

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      +..+|+|+|+||||||||||+|+|++ .|+|++.||||++.      .+.....++.++.++||+|++.....-+.....
T Consensus       215 ~G~~v~i~G~PN~GKSSL~N~L~~~d-rAIVS~ipGTTRD~------ie~~l~l~G~~v~l~DTAGiR~t~d~IE~~GI~  287 (445)
T PRK05291        215 EGLKVVIAGRPNVGKSSLLNALLGEE-RAIVTDIAGTTRDV------IEEHINLDGIPLRLIDTAGIRETEDEVEKIGIE  287 (445)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCC-CEEECCCCCCCCCE------EEEEEEECCEEEEEEECCCCCCCCCHHHHHHHH
T ss_conf             59869988999876899999985787-46731899974040------223689999899999899766557458899999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             88998777766420000011223578875454554321025753221222211110246899999999997531368986
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE  187 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~  187 (212)
                      .     ........+.++++.|........+.......  ...+.+.|+||+|+..+..                 ...+
T Consensus       288 r-----a~~~~~~ADlil~v~D~s~~~~~~~~~~~~~~--~~~~~i~V~NK~DL~~~~~-----------------~~~~  343 (445)
T PRK05291        288 R-----SRKAIEEADLVLLVLDASEPLTEEDKEILEEF--KNKPVIVVLNKADLTGEKI-----------------DGLP  343 (445)
T ss_pred             H-----HHHHHHHCCEEEEEEECCCCCCCCHHHHHHHC--CCCCEEEEEEHHHCCCCCC-----------------CCCC
T ss_conf             9-----99999839999999879988872259999851--7998799985120466534-----------------7897


Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             899988888998999999998728
Q gi|254780484|r  188 VIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       188 i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      ++.+||++|.|+++|++.|.+.+.
T Consensus       344 ~i~iSak~g~Gi~~L~~~i~~~~~  367 (445)
T PRK05291        344 VIRISAKTGEGIDELEEALKQLVG  367 (445)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             599983788699999999999970


No 29 
>COG1160 Predicted GTPases [General function prediction only]
Probab=99.95  E-value=7.4e-28  Score=179.30  Aligned_cols=172  Identities=24%  Similarity=0.300  Sum_probs=136.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      +..+|||+|+||||||||+|+|+|+++ +.+++.||||++.      .......++..+.++||+|+.......+...  
T Consensus       177 ~~ikiaiiGrPNvGKSsLiN~ilgeeR-~Iv~~~aGTTRD~------I~~~~e~~~~~~~liDTAGiRrk~ki~e~~E--  247 (444)
T COG1160         177 DPIKIAIIGRPNVGKSSLINAILGEER-VIVSDIAGTTRDS------IDIEFERDGRKYVLIDTAGIRRKGKITESVE--  247 (444)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHCCCCE-EEECCCCCCCCCC------EEEEEEECCEEEEEEECCCCCCCCCCCCCEE--
T ss_conf             750899992787870588877506825-9845999862203------3125899881899998778774664124268--


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCH--HHHHHHHHHHHHHHHHCCCCC
Q ss_conf             889987777664200000112235788754545543210257532212222111102--468999999999975313689
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSP--TTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~--~~~~~~~~~~~~~~~~~~~~~  185 (212)
                      ..........+..+..++.+.|+..+..+++..+.......+++.++++||+|++..  ...++..+.+...  .....+
T Consensus       248 ~~Sv~rt~~aI~~a~vvllviDa~~~~~~qD~~ia~~i~~~g~~~vIvvNKWDl~~~~~~~~~~~k~~i~~~--l~~l~~  325 (444)
T COG1160         248 KYSVARTLKAIERADVVLLVIDATEGISEQDLRIAGLIEEAGRGIVIVVNKWDLVEEDEATMEEFKKKLRRK--LPFLDF  325 (444)
T ss_pred             EEEEHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHH--HCCCCC
T ss_conf             875054676786568899999888783688999999999758974999975325785166799999999987--221367


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+++++||++|.|+++|.+.+.+..
T Consensus       326 a~i~~iSA~~~~~i~~l~~~i~~~~  350 (444)
T COG1160         326 APIVFISALTGQGLDKLFEAIKEIY  350 (444)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             7279997047877278899999999


No 30 
>COG0486 ThdF Predicted GTPase [General function prediction only]
Probab=99.95  E-value=4.3e-27  Score=174.87  Aligned_cols=161  Identities=24%  Similarity=0.285  Sum_probs=125.8

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      +..+|+|+|+||||||||+|+|+++++ |+|++.||||++.      .+.....++.++.++||+|++.....-+.....
T Consensus       216 ~G~kvvIiG~PNvGKSSLLNaL~~~d~-AIVTdI~GTTRDv------iee~i~i~G~pv~l~DTAGiRet~d~VE~iGIe  288 (454)
T COG0486         216 EGLKVVIIGRPNVGKSSLLNALLGRDR-AIVTDIAGTTRDV------IEEDINLNGIPVRLVDTAGIRETDDVVERIGIE  288 (454)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCC-EEECCCCCCCCCE------EEEEEEECCEEEEEEECCCCCCCCCHHHHHHHH
T ss_conf             586499987998867999998866786-6742899974103------789999898899998567766673489999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             88998777766420000011223578875454554321025753221222211110246899999999997531368986
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE  187 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~  187 (212)
                           .........+.++++.|......+.+....+ ....+.|+++++||.|+..+......          ......+
T Consensus       289 -----Rs~~~i~~ADlvL~v~D~~~~~~~~d~~~~~-~~~~~~~~i~v~NK~DL~~~~~~~~~----------~~~~~~~  352 (454)
T COG0486         289 -----RAKKAIEEADLVLFVLDASQPLDKEDLALIE-LLPKKKPIIVVLNKADLVSKIELESE----------KLANGDA  352 (454)
T ss_pred             -----HHHHHHHHCCEEEEEEECCCCCCHHHHHHHH-HCCCCCCEEEEEECHHCCCCCCCCHH----------HCCCCCC
T ss_conf             -----9999998599899997088777601177887-24368977999960211564321012----------0267882


Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             899988888998999999998728
Q gi|254780484|r  188 VIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       188 i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      ++.+||++|+|+++|+++|.+...
T Consensus       353 ~i~iSa~t~~Gl~~L~~~i~~~~~  376 (454)
T COG0486         353 IISISAKTGEGLDALREAIKQLFG  376 (454)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             699982576579999999999986


No 31 
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states.  Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments.  This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=99.95  E-value=1.8e-26  Score=171.38  Aligned_cols=162  Identities=22%  Similarity=0.304  Sum_probs=113.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      |.|||+||||||||||+|+|++.+..  ....+++|...+.+...   ........+.++||||+..+..          
T Consensus         1 P~VaivG~~n~GKSTL~n~L~~~~~~--~~~~~g~T~~i~~~~~~---~~~~~~~~i~~iDTPGh~~f~~----------   65 (168)
T cd01887           1 PVVTVMGHVDHGKTTLLDKIRKTNVA--AGEAGGITQHIGAFEVP---AEVLKIPGITFIDTPGHEAFTN----------   65 (168)
T ss_pred             CEEEEEECCCCCHHHHHHHHHCCCCC--EEECCCCEEEECEEEEE---EEECCCCEEEEEECCCCHHHHH----------
T ss_conf             98999948998598999998586750--45169816871539999---8825887189998998167799----------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHH--HHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             99877776642000001122357887545455432102575322122221111024--6899999999997531368986
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPT--TAQETLEKTKYLIRNYPTAHPE  187 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~--~~~~~~~~~~~~~~~~~~~~~~  187 (212)
                         .........+..+++.++..+...++.+....+...+.|+++++||+|+++.+  .....+.+........+.+..+
T Consensus        66 ---~~~~~~~~aD~~ilvvda~~g~~~~~~~~~~~l~~~~~p~ivviNKiD~~~~~~~~v~~~l~~~~~~~~~~~~~~~~  142 (168)
T cd01887          66 ---MRARGASLTDIAILVVAADDGVMPQTIEAIKLAKAANVPFIVALNKIDKPNANPERVKNELSELGLQGEDEWGGDVQ  142 (168)
T ss_pred             ---HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCHHHCCCCCE
T ss_conf             ---99999862688999986466754589999999987699789999893089879899999999975452455289875


Q ss_pred             EEEEECCCCCCHHHHHHHHHHH
Q ss_conf             8999888889989999999987
Q gi|254780484|r  188 VIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       188 i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      ++|+||++|+|+++|++.|.+.
T Consensus       143 iIpvSA~tG~gi~~L~~~i~~~  164 (168)
T cd01887         143 IVPTSAKTGEGIDDLLEAILLL  164 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
T ss_conf             9999899998999999999999


No 32 
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1.  Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box).  Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown.  Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT.  Nog1 is a nucleolar protein that might function in ribosome assembly.  The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to 
Probab=99.94  E-value=3.6e-26  Score=169.57  Aligned_cols=158  Identities=24%  Similarity=0.272  Sum_probs=101.6

Q ss_pred             EECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEE-CCCEEEEEECCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             974899889899999738973798738884145212026655567850-8964999976001011122447898888998
Q gi|254780484|r   34 FSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN-NLPAMALVDMPGYGYARAPKKNVDSWGGLIV  112 (212)
Q Consensus        34 ivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~-~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~  112 (212)
                      |+|+||||||||+|+|+|.+.  .+++.|+||+.+..      +.... +..++.++||||+........... ...   
T Consensus         1 ivG~PNvGKSTL~N~Lt~~~~--~v~~~pgTTr~~~~------g~~~~~~~~~i~~~DtpGi~~~~~~~~~~~-~~~---   68 (176)
T cd01881           1 LVGLPNVGKSTLLNALTNAKP--KVANYPFTTLEPNL------GVVEVPDGARIQVADIPGLIEGASEGRGLG-NQF---   68 (176)
T ss_pred             CCCCCCCCHHHHHHHHHCCCC--EEECCCCCEEEEEE------EEEEECCCCEEEEEECCCCCCCCHHHHHHH-HHH---
T ss_conf             969998889999999968996--03078996761246------799947996699995787545733787899-999---


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCHH------HHH-HHH----------HHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             7777664200000112235788754------545-543----------21025753221222211110246899999999
Q gi|254780484|r  113 RYLSERSTLRCVYLLIDCRHGVKQI------DQD-VFS----------FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK  175 (212)
Q Consensus       113 ~~~~~~~~~~~~~~~~~~~~~~~~~------~~~-~~~----------~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~  175 (212)
                        .......+.++++.|........      +.. ...          ......+|+++++||+|++.+.+..+......
T Consensus        69 --l~~~~~~d~il~vvD~~~~~~~~~~~~~~~~~~i~~el~~~~~~~~~~~~~~kp~i~v~NK~Dl~~~~~~~~~~~~~~  146 (176)
T cd01881          69 --LAHIRRADAILHVVDASEDDDIGGVDPLEDYEILNAELKLYDLETILGLLTAKPVIYVLNKIDLDDAEELEEELVREL  146 (176)
T ss_pred             --HHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHCCCCEEEEEECEECCCHHHHHHHHHHHH
T ss_conf             --987410889999998987655454458999999999999711566555432697199996860347003159999999


Q ss_pred             HHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             99753136898689998888899899999999872
Q gi|254780484|r  176 YLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       176 ~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .     ...+.+++++||++|.|+++|++.|.+.|
T Consensus       147 ~-----~~~~~~ii~iSA~~~~gi~~L~~~i~~~L  176 (176)
T cd01881         147 A-----LEEGAEVVPISAKTEEGLDELIRAIYELL  176 (176)
T ss_pred             H-----HCCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             7-----46899589997778879999999999659


No 33 
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins.  GTPases act as molecular switches regulating diverse cellular processes.  DRG2 and DRG1 comprise the DRG subfamily in eukaryotes.  In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes.  It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding.
Probab=99.94  E-value=4.9e-26  Score=168.80  Aligned_cols=156  Identities=20%  Similarity=0.244  Sum_probs=102.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+|||+||||||||+|+|||++  +.++++|+||..+.      .+++...+.++.++||||+............ ..+
T Consensus         2 ~V~LVG~PN~GKSTLln~LT~a~--~~v~~ypfTT~~pi------~g~~~~~~~~iqlvDtPGli~~a~~g~g~g~-~~l   72 (233)
T cd01896           2 RVALVGFPSVGKSTLLSKLTNTK--SEVAAYEFTTLTCV------PGVLEYKGAKIQLLDLPGIIEGAADGKGRGR-QVI   72 (233)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCC--CCCCCCCCCCCCCE------EEEEEECCEEEEEEECCCCCCCCCCCCCHHH-HHH
T ss_conf             59999999999999999997899--54369897875747------7799989989999967300246333320689-999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHH----------------------------------------------HHHHH
Q ss_conf             98777766420000011223578875454----------------------------------------------55432
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQIDQ----------------------------------------------DVFSF  144 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------------------------------------------~~~~~  144 (212)
                      ..     ....+..+++.|+.......+.                                              .....
T Consensus        73 ~~-----~r~aD~il~VvD~~~~~~~~~~i~~eLe~~gi~l~~~~~~v~i~~~~~~gi~i~~~~~~~~~~~~~v~~il~e  147 (233)
T cd01896          73 AV-----ARTADLILMVLDATKPEGHREILERELEGVGIRLNKRPPNITIKKKKKGGINITSTVPLTKLDEKTIKAILRE  147 (233)
T ss_pred             HH-----HHHCCEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCEEEECCCCCCCCCHHHHHHHHHH
T ss_conf             99-----8758999999847982667899999998605110357876257771358678604566666888999999998


Q ss_pred             ----------------------H--CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHH
Q ss_conf             ----------------------1--0257532212222111102468999999999975313689868999888889989
Q gi|254780484|r  145 ----------------------L--DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE  200 (212)
Q Consensus       145 ----------------------~--~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~  200 (212)
                                            +  ....+|.+.++||+|++..++...    +        ....+++++||.+|.|+|
T Consensus       148 ~~i~~a~v~i~~~~t~dd~~d~i~~n~~y~P~i~V~NKiDl~~~ee~~~----~--------~~~~~~i~ISA~~g~gld  215 (233)
T cd01896         148 YKIHNADVLIREDITVDDLIDVIEGNRVYIPCLYVYNKIDLISIEELDL----L--------ARQPNSVVISAEKGLNLD  215 (233)
T ss_pred             HCCCCCEEEECCCCCHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHH----H--------HCCCCEEEEECCCCCCHH
T ss_conf             2767643786057888898998735767673799997403699899998----6--------467985999888898989


Q ss_pred             HHHHHHHHHHCC
Q ss_conf             999999987287
Q gi|254780484|r  201 VLRKAILETINY  212 (212)
Q Consensus       201 eL~~~I~~~l~~  212 (212)
                      +|++.|++.|++
T Consensus       216 ~L~~~I~~~L~l  227 (233)
T cd01896         216 ELKERIWDKLGL  227 (233)
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999998396


No 34 
>pfam00009 GTP_EFTU Elongation factor Tu GTP binding domain. This domain contains a P-loop motif, also found in several other families such as pfam00071, pfam00025 and pfam00063. Elongation factor Tu consists of three structural domains, this plus two C-terminal beta barrel domains.
Probab=99.94  E-value=1e-25  Score=166.93  Aligned_cols=169  Identities=16%  Similarity=0.244  Sum_probs=119.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCC-----CEE-----EECCEEEEEEEEEEEECCCEEEEEECCHHHHH
Q ss_conf             68689997489988989999973897379873888-----414-----52120266555678508964999976001011
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAP-----GRT-----QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYA   97 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p-----~tt-----~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~   97 (212)
                      .++.|||+|+||||||||+|+|++.... ......     +++     +..+.+...........+..+.++||||+..+
T Consensus         2 ~~rnVaivG~~n~GKSTL~n~Ll~~~~~-i~~~~~~~~~~~~d~~~~E~~rgiTi~~~~~~~~~~~~~i~~iDtPGh~~f   80 (185)
T pfam00009         2 RHRNIGIIGHVDHGKTTLTDALLYVTGA-IDKRGEVKQEGELDRLKEERERGITIKIAAVSFETKKRHINIIDTPGHVDF   80 (185)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCC-CCCCCCCCCCCCCCCCHHHHHCCEEEEEEEEEEEECCCEEEEEECCCCCCH
T ss_conf             9678999938994499999999715487-654643100333365588885782698769999608936899989987143


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             12244789888899877776642000001122357887545455432102575322122221111024689999999999
Q gi|254780484|r   98 RAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYL  177 (212)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~  177 (212)
                      ..             .........+.++++.++..+...++..........+.|.++++||+|+++..+..+..+++.+.
T Consensus        81 ~~-------------~~~~~l~~aD~~vlVvda~~G~~~qt~~~~~~~~~~~~p~iv~vNKiD~v~~~~~~~~~~e~~~~  147 (185)
T pfam00009        81 TK-------------EMIRGAAQADGAILVVDAVEGVMPQTREHLLLAKQLGVPIIVFINKMDRVDDAELDEVVEEISRE  147 (185)
T ss_pred             HH-------------HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             99-------------99999864656429998676853230999999998289879999773277767699999999999


Q ss_pred             -HHHCCC--CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             -753136--898689998888899899999999872
Q gi|254780484|r  178 -IRNYPT--AHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       178 -~~~~~~--~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                       +..+..  ...+++|+||++|+|+++|++.|.+.+
T Consensus       148 ll~~~~~~~~~~pivpiSA~~G~gv~~Ll~~i~~~l  183 (185)
T pfam00009       148 LLEKYGFGGETIPVIPGSALTGEGIDTLLEALDLYL  183 (185)
T ss_pred             HHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             888732489988699967899979899999999778


No 35 
>TIGR03156 GTP_HflX GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like).
Probab=99.94  E-value=3e-26  Score=170.03  Aligned_cols=162  Identities=21%  Similarity=0.227  Sum_probs=113.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      +.+.|.||||||||||||||+|+|+|.+.  .+.+.+++|.++.+.+.     ...++..+.+.||+||.......-...
T Consensus       186 ~~~~p~ValVGYTNAGKSTL~n~Lt~~~~--~~~d~lFaTLd~t~r~~-----~l~~~~~~ll~DTVGFI~~LP~~Li~a  258 (351)
T TIGR03156       186 RAGVPTVALVGYTNAGKSTLFNALTGADV--YAADQLFATLDPTTRRL-----DLPDGGEVLLTDTVGFIRDLPHELVAA  258 (351)
T ss_pred             HCCCCEEEEECCCCCCHHHHHHHHHHCCC--CCCCCCEEECCCCCCEE-----ECCCCCEEEEEECCCHHHHCCHHHHHH
T ss_conf             34997699966788778999999851776--41034313536732048-----879997699981500563088679999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHH----HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             8888998777766420000011223578875454----554321025753221222211110246899999999997531
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQ----DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY  181 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~  181 (212)
                      +...+     .....++..+++.|...+......    ...+.+.....|.+.|+||+|+++++....    ..      
T Consensus       259 F~sTL-----ee~~~aDlllhVvD~S~~~~~~~~~~v~~~L~elg~~~~p~i~V~NKiD~~~~~~~~~----~~------  323 (351)
T TIGR03156       259 FRATL-----EEVREADLLLHVVDASDPDREEQIEAVEEVLEELGAEDIPQLLVYNKIDLLDEPRIER----LE------  323 (351)
T ss_pred             HHHHH-----HHHHHCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEECHHCCCHHHHHH----HH------
T ss_conf             99999-----9998598999980588847899999999999976999998899996701589577899----87------


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             36898689998888899899999999872
Q gi|254780484|r  182 PTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       182 ~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                       ...++.++|||++|+|+++|++.|.+.|
T Consensus       324 -~~~~~~v~ISA~~g~gi~~L~~~I~~~L  351 (351)
T TIGR03156       324 -EGYPEAVFVSAKTGEGLDLLLEAIAERL  351 (351)
T ss_pred             -HCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             -3799879996899989999999999559


No 36 
>pfam10662 PduV-EutP Ethanolamine utilisation - propanediol utilisation. Members of this family function in ethanolamine and propanediol degradation pathways, however the exact roles of these proteins is poorly understood.
Probab=99.93  E-value=3.5e-25  Score=163.94  Aligned_cols=141  Identities=18%  Similarity=0.180  Sum_probs=92.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|||||+||||||||+|+|+|++   .++..+.+++..                 ..++||||.......    .. ..+
T Consensus         3 kVaivGrpNvGKSTLlN~L~g~~---i~~~K~qtt~~~-----------------~~~IDTPG~~~~~~~----~~-~~~   57 (143)
T pfam10662         3 KIMLIGRSGCGKTTLTQALNGEE---LKYKKTQAIEFS-----------------DNMIDTPGEYLENRR----FY-SAL   57 (143)
T ss_pred             EEEEECCCCCCHHHHHHHHCCCC---EEECCCEEEEEC-----------------CCEEECCCCCCCCHH----HH-HHH
T ss_conf             59998999999999999975994---451787079855-----------------748999876656289----99-999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             98777766420000011223578875454554321025753221222211110246899999999997531368986899
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP  190 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  190 (212)
                          ......++.+.++.++...........   ......|++.|+||+|++++++....++++...     .+..+++|
T Consensus        58 ----~~~~~daDvil~vvDa~~~~~~~~~~~---~~~~~kpvIlViNKiD~~~~~~~l~~~~~~~~~-----~~~~~i~~  125 (143)
T pfam10662        58 ----IVTAADADVIALVQDATEPWSVFPPGF---ASMFNKPVIGIITKIDLAKDEANIEMVEEWLNN-----AGAEKIFE  125 (143)
T ss_pred             ----HHHHHHCCEEEEEEECCCCCCCCCHHH---HHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHH-----CCCCEEEE
T ss_conf             ----999964999999987788667568778---975479889999802245756678999999975-----89987999


Q ss_pred             EECCCCCCHHHHHHHHHH
Q ss_conf             988888998999999998
Q gi|254780484|r  191 TSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       191 vSA~~g~Gi~eL~~~I~~  208 (212)
                      |||.+|.|+++|+++|.+
T Consensus       126 iSA~~g~Gid~L~~~l~e  143 (143)
T pfam10662       126 VSAVTNEGIDELFAYLEE  143 (143)
T ss_pred             EECCCCCCHHHHHHHHHC
T ss_conf             889899899999999749


No 37 
>PRK09554 feoB ferrous iron transport protein B; Reviewed
Probab=99.93  E-value=6.3e-25  Score=162.44  Aligned_cols=163  Identities=20%  Similarity=0.226  Sum_probs=119.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+||++|.||+|||||||+|||.+.  .|.+.||+|.+.      ..+.....+..+.++|+||.+......+.....+.
T Consensus         4 i~IALvGNPN~GKSTLFN~LTG~~q--~VgNwPGvTVEk------k~G~~~~~~~~~~ivDLPG~YSL~~~S~e~s~dE~   75 (772)
T PRK09554          4 LTIGLIGNPNSGKTTLFNQLTGARQ--RVGNWAGVTVER------KEGQFSTTDHQVTLVDLPGTYSLTTISSQTSLDEQ   75 (772)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC--EEECCCCCEEEE------EEEEEEECCCEEEEEECCCCCCCCCCCCCCCCHHH
T ss_conf             5699888998789999999868998--357899764742------38999968946999979977869999977773089


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             99877776642000001122357887545455432102575322122221111024689999999999753136898689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVI  189 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~  189 (212)
                      ....... ....+.++.+.|+..  .+..+.+.-.+.+.+.|.++++|++|.+.+.......+.+.+.+      +.|++
T Consensus        76 Var~~ll-~~~pDvvvnVvDAtn--LeRnLyLt~QllElg~PvVvaLNM~D~A~~~Gi~ID~~~Ls~~L------GvPVV  146 (772)
T PRK09554         76 IACHYIL-SGDADLLINVVDASN--LERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIDIDALSARL------GCPVI  146 (772)
T ss_pred             HHHHHHH-CCCCCEEEEEEECCC--HHHHHHHHHHHHHCCCCEEEEEECHHHHHHCCCEECHHHHHHHH------CCCEE
T ss_conf             9999861-399989999801687--54428999999974999899987799898877932899999985------89989


Q ss_pred             EEECCCCCCHHHHHHHHHHH
Q ss_conf             99888889989999999987
Q gi|254780484|r  190 PTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       190 ~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      ++||.+|+|+++|++.|.+.
T Consensus       147 ~~~A~~g~Gi~eL~~ai~~~  166 (772)
T PRK09554        147 PLVSTRGRGIEALKLAIDRY  166 (772)
T ss_pred             EEEECCCCCHHHHHHHHHHH
T ss_conf             99827887999999999975


No 38 
>cd00881 GTP_translation_factor GTP translation factor family.  This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation.  In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function.
Probab=99.92  E-value=5.9e-24  Score=156.85  Aligned_cols=165  Identities=17%  Similarity=0.267  Sum_probs=123.9

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCE---------EEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHH
Q ss_conf             999748998898999997389737987388841---------45212026655567850896499997600101112244
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGR---------TQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKK  102 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~t---------t~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~  102 (212)
                      |+|+|++|+|||||+|+|++.... .......+         .+..+.+...........+..+.++||||+..+..   
T Consensus         2 v~iiGh~d~GKTTL~~~Ll~~~~~-~~~~~~~~~~~~d~~~~E~~rgiTi~~~~~~~~~~~~~i~~iDTPGh~~f~~---   77 (189)
T cd00881           2 VGIAGHVDHGKTTLTERLLYVTGD-IERDGTVEETFLDVLKEERERGITIKSGVATFEWPDRRVNFIDTPGHEDFSS---   77 (189)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCC-CCCCCCEEEEEECCCHHHHHCCCEEEEEEEEEEECCEEEEEEECCCCHHHHH---
T ss_conf             899917998999999999976472-3568625888505777888638413222799998998999996998188999---


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC-
Q ss_conf             7898888998777766420000011223578875454554321025753221222211110246899999999997531-
Q gi|254780484|r  103 NVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY-  181 (212)
Q Consensus       103 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~-  181 (212)
                                .........+.++.+.++..+...++......+...++|+++++||+|++.++...+..+++.+.+... 
T Consensus        78 ----------~~~~~l~~aD~ailvVda~~G~~~qt~~~~~~~~~~~~p~iv~iNKiD~~~~~~~~~~~~ei~~~l~~~~  147 (189)
T cd00881          78 ----------EVIRGLSVSDGAILVVDANEGVQPQTREHLRIAREGGLPIIVAINKIDRVGEEDLEEVLREIKELLGLIG  147 (189)
T ss_pred             ----------HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             ----------9999986468569999879899878999999999769987999989718775629999999999987532


Q ss_pred             ----------CCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             ----------36898689998888899899999999872
Q gi|254780484|r  182 ----------PTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       182 ----------~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                                .....|++|+||++|+|+++|.+.|.+.+
T Consensus       148 ~~~~~~~~~~~~~~~piv~iSA~~G~gv~~Lld~i~~~l  186 (189)
T cd00881         148 FISTKEEGTRNGLLVPIVPGSALTGIGVEELLEAIVEHL  186 (189)
T ss_pred             CHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             102321101258877599988867869799999999768


No 39 
>PRK11058 putative GTPase HflX; Provisional
Probab=99.92  E-value=2.4e-24  Score=159.13  Aligned_cols=165  Identities=19%  Similarity=0.192  Sum_probs=114.5

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      +.+.|.||+|||||||||||+|+|++....  +.+..+.|.++.+-     .....++..+.+.||.||...-...-...
T Consensus       194 ~~~~~~ValVGYTNAGKSTL~n~Lt~~~v~--~~d~LFATLD~t~R-----~~~l~~~~~~lltDTVGFI~~LP~~LveA  266 (426)
T PRK11058        194 KADVPTVSLVGYTNAGKSTLFNRITEARVY--AADQLFATLDPTLR-----RIDVADVGETVLADTVGFIRHLPHDLVAA  266 (426)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCCCCCCCEE-----EEECCCCCEEEEECCCHHHHHCCHHHHHH
T ss_conf             069976999735777789998777528876--32545014786202-----67869998699971506665198999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHH----HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             888899877776642000001122357887545----4554321025753221222211110246899999999997531
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVKQID----QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY  181 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~  181 (212)
                      +...+.+     ...++..+++.|.+.+.....    ....+.+....+|.+.|+||+|++++....  +   ..    .
T Consensus       267 F~sTLeE-----v~~ADlLLhVvD~S~p~~~~q~~~v~~vL~elg~~~~p~i~V~NKiD~~~~~~~~--~---~~----~  332 (426)
T PRK11058        267 FKATLQE-----TRQATLLLHVIDAADVRVQENIEAVNTVLEEIDAHEIPTLLVMNKIDMLDDFEPR--I---DR----D  332 (426)
T ss_pred             HHHHHHH-----HHCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCHHHH--H---HH----H
T ss_conf             9999999-----9639889999849993799999999999997599999779999770238964455--6---66----5


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             368986899988888998999999998728
Q gi|254780484|r  182 PTAHPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       182 ~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      ..+.+..+++||++|.|++.|.+.|.+.|.
T Consensus       333 ~~~~p~~V~iSA~tg~Gi~~L~~~I~~~L~  362 (426)
T PRK11058        333 EENKPIRVWLSAQTGAGIPLLFQALTERLS  362 (426)
T ss_pred             HCCCCCEEEEECCCCCCHHHHHHHHHHHCC
T ss_conf             339987799978999899999999998703


No 40 
>PRK12299 obgE GTPase ObgE; Reviewed
Probab=99.91  E-value=2.4e-24  Score=159.12  Aligned_cols=162  Identities=22%  Similarity=0.262  Sum_probs=110.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      .|+|||.||||||||+|+|++++  +.+.++|+||..++.....     ..+...+.+.|+||+............ ..+
T Consensus       160 DVgLVG~PNaGKSTLl~~is~A~--pkIa~YpFTTl~P~lGvv~-----~~d~~~~~iaDiPGlIegA~~g~GLG~-~FL  231 (334)
T PRK12299        160 DVGLVGLPNAGKSTLISSVSAAK--PKIADYPFTTLHPNLGVVR-----VDDYKSFVIADIPGLIEGASEGAGLGH-RFL  231 (334)
T ss_pred             CCEEEECCCCCHHHHHHHHHCCC--CCCCCCCCEECCCEEEEEE-----ECCCCEEEEEECCCCCCCCCCCCCCHH-HHH
T ss_conf             30146369874669999876476--4335787300387547999-----468867899866743355234777478-998


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHH-HHHHH-----HCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             98777766420000011223578875454-55432-----1025753221222211110246899999999997531368
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQIDQ-DVFSF-----LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~-----~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                      ..     +....+..++.|........+. .+.+.     .....+|.++|+||+|++++++..+.++.+....      
T Consensus       232 rH-----ieR~~~L~~viD~s~~d~~~~~~~l~~EL~~y~~~L~~Kp~ivvlNK~Dl~~~~~~~~~~~~~~~~~------  300 (334)
T PRK12299        232 KH-----IERTRLLLHLVDASSEDPVEDYKTIRNELEKYSPELADKPRILVLNKIDLLDEEERKEKIKELIKAL------  300 (334)
T ss_pred             HH-----HHHCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHC------
T ss_conf             76-----6534369999979988989999999999998506553698799998810688567899999999870------


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             986899988888998999999998728
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      ..++++|||.+|+|+++|++.|.+.|.
T Consensus       301 ~~~v~~ISA~~g~Gl~eL~~~i~~~L~  327 (334)
T PRK12299        301 GGPVFLISAVTGEGLDELLRALWEFLK  327 (334)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             996899978778499999999999999


No 41 
>TIGR00437 feoB ferrous iron transport protein B; InterPro: IPR003373 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system and may play a role in the transport of ferrous iron. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent .; GO: 0005525 GTP binding, 0015093 ferrous iron transmembrane transporter activity, 0015684 ferrous iron transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=99.91  E-value=1.5e-24  Score=160.26  Aligned_cols=153  Identities=25%  Similarity=0.276  Sum_probs=121.9

Q ss_pred             CCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH-HHHHHHHHHHHHH
Q ss_conf             489988989999973897379873888414521202665556785089649999760010111224-4789888899877
Q gi|254780484|r   36 GRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK-KNVDSWGGLIVRY  114 (212)
Q Consensus        36 G~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~-~~~~~~~~~~~~~  114 (212)
                      |.||||||||||+|||.+  ..+++.||+|-+      ..++.....+..+.++|+||.+...... .+........   
T Consensus         1 GNPNVGKStlFN~LTG~~--~~vGNwPG~TVe------k~eg~l~~~g~~i~ivDLPG~YSL~~~S~~dE~v~~dyl---   69 (733)
T TIGR00437         1 GNPNVGKSTLFNALTGAN--QKVGNWPGVTVE------KKEGKLKFQGEDIEIVDLPGIYSLTTFSGLDEKVARDYL---   69 (733)
T ss_pred             CCCCCHHHHHHHHHHCCC--EEEEECCCCEEE------EEEEEEEECCEEEEEEECCCCCCCCCCCCCHHHHHHHHH---
T ss_conf             999815899998741587--078735887078------778897524627899844873005899874279998997---


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECC
Q ss_conf             77664200000112235788754545543210257532212222111102468999999999975313689868999888
Q gi|254780484|r  115 LSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSV  194 (212)
Q Consensus       115 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~  194 (212)
                        .....++++.+.|+..  -+..+-+.-.+.+.+.|.++++|++|...+..+..+.+.+++.+      +.|++++||.
T Consensus        70 --~~e~~DLv~nVVDA~n--LERnL~LTLQL~E~G~p~i~~LN~~DeA~k~GI~Id~~~Lee~L------GvPVv~~~A~  139 (733)
T TIGR00437        70 --LNEKPDLVVNVVDASN--LERNLYLTLQLLELGIPMILALNLVDEAEKKGIRIDEEKLEERL------GVPVVPTSAT  139 (733)
T ss_pred             --HCCCCCEEEEEECHHH--HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCEECHHHHHHHC------CCCEEEEEEE
T ss_conf             --5389967999725667--77899999999971625856872678997729631257775433------8652565321


Q ss_pred             CCCCHHHHHHHHHHH
Q ss_conf             889989999999987
Q gi|254780484|r  195 KRKGIEVLRKAILET  209 (212)
Q Consensus       195 ~g~Gi~eL~~~I~~~  209 (212)
                      +|.|+++|+++|.+.
T Consensus       140 ~g~G~~~L~~~i~~v  154 (733)
T TIGR00437       140 EGRGIEELKDAIREV  154 (733)
T ss_pred             ECCCHHHHHHHHHHH
T ss_conf             057789999999998


No 42 
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]
Probab=99.91  E-value=1.8e-23  Score=154.03  Aligned_cols=159  Identities=24%  Similarity=0.327  Sum_probs=120.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+||++|.||||||||||+|||.+.  .+.+.||.|.+      ..++.....+..+.++|+||.+.......+......
T Consensus         4 ~~valvGNPNvGKTtlFN~LTG~~q--~VgNwpGvTVE------kkeg~~~~~~~~i~ivDLPG~YSL~~~S~DE~Var~   75 (653)
T COG0370           4 LTVALVGNPNVGKTTLFNALTGANQ--KVGNWPGVTVE------KKEGKLKYKGHEIEIVDLPGTYSLTAYSEDEKVARD   75 (653)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC--EECCCCCCEEE------EEEEEEEECCCEEEEEECCCCCCCCCCCCHHHHHHH
T ss_conf             4389856998548999999856674--65478980699------878899735854899868975658889920899999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             99877776642000001122357887545455432102575322122221111024689999999999753136898689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVI  189 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~  189 (212)
                      ...     ....++++.+.|+..  .+...-..-.+.+.++|.++++|++|...+..+..+.+.+.+.+      +.|++
T Consensus        76 ~ll-----~~~~D~ivnVvDA~n--LeRnLyltlQLlE~g~p~ilaLNm~D~A~~~Gi~Id~~~L~~~L------GvPVv  142 (653)
T COG0370          76 FLL-----EGKPDLIVNVVDATN--LERNLYLTLQLLELGIPMILALNMIDEAKKRGIRIDIEKLSKLL------GVPVV  142 (653)
T ss_pred             HHH-----CCCCCEEEEEECCCH--HHHHHHHHHHHHHCCCCEEEEECCHHHHHHCCCCCCHHHHHHHH------CCCEE
T ss_conf             986-----389988999602323--77778999999985998599961275688649712699999986------89889


Q ss_pred             EEECCCCCCHHHHHHHHHHH
Q ss_conf             99888889989999999987
Q gi|254780484|r  190 PTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       190 ~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      ++||++|.|+|+|++++.+.
T Consensus       143 ~tvA~~g~G~~~l~~~i~~~  162 (653)
T COG0370         143 PTVAKRGEGLEELKRAIIEL  162 (653)
T ss_pred             EEEECCCCCHHHHHHHHHHH
T ss_conf             98730588979999999874


No 43 
>PRK12298 obgE GTPase ObgE; Reviewed
Probab=99.91  E-value=6.7e-24  Score=156.54  Aligned_cols=164  Identities=20%  Similarity=0.196  Sum_probs=112.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      .|+|||.||||||||+++++.++  +.+.++|+||..++...+..     .+...+.+.|.||+..-.......... ++
T Consensus       161 DVGLvG~PNAGKSTll~~iS~Ak--PKIAdYpFTTL~PnLGvV~~-----~~~~~fviADIPGLIeGAs~G~GLG~~-FL  232 (380)
T PRK12298        161 DVGLLGLPNAGKSTFIRAVSAAK--PKVADYPFTTLVPNLGVVRV-----DDERSFVIADIPGLIEGAAEGAGLGIR-FL  232 (380)
T ss_pred             CCCEEECCCCCCHHHHHHHHCCC--CCCCCCCCCCCCCEEEEEEE-----CCCCEEEEEECCCCCCCCCCCCCHHHH-HH
T ss_conf             65146369886108998855589--75478875336874679994-----698669998777555775558772899-99


Q ss_pred             HHHHHHHHHHHCCCCCCCCCC----CCCCHHHHHHH----HHH-CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             987777664200000112235----78875454554----321-025753221222211110246899999999997531
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCR----HGVKQIDQDVF----SFL-DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY  181 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~----~~~-~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~  181 (212)
                      ...     ......++++|..    ....+....+.    .+. ....+|.++|+||+|++..++..+.++.+.+.+   
T Consensus       233 rHi-----eRt~~LlhviD~s~~~~~dp~~~~~~i~~EL~~Y~~~L~~kp~iiv~NK~Dl~~~~e~~~~~~~~~~~~---  304 (380)
T PRK12298        233 KHL-----ERCRVLLHLIDIAPIDGSDPVENARIIVNELEKYSPKLAEKPRWLVFNKIDLLDEEEAEERAKEIVEAL---  304 (380)
T ss_pred             HHH-----HHHCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHC---
T ss_conf             998-----753589999968877751999999999999998597660598799998854899799999999999970---


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             368986899988888998999999998728
Q gi|254780484|r  182 PTAHPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       182 ~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                       .+..++++|||.+|+|+++|...|.+.|+
T Consensus       305 -~~~~~v~~ISA~tgeG~~~L~~~i~~~l~  333 (380)
T PRK12298        305 -GWEGPVYLISAASGEGTKELCWDLMTFIE  333 (380)
T ss_pred             -CCCCCEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             -88888799978768799999999999998


No 44 
>COG1084 Predicted GTPase [General function prediction only]
Probab=99.90  E-value=4.2e-23  Score=151.98  Aligned_cols=173  Identities=20%  Similarity=0.270  Sum_probs=119.5

Q ss_pred             CCHHHCC--CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHH
Q ss_conf             6567588--76686899974899889899999738973798738884145212026655567850896499997600101
Q gi|254780484|r   19 PEIGLLP--KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGY   96 (212)
Q Consensus        19 ~~~~~~P--~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~   96 (212)
                      ..++.+|  +.+.|+|.|.|+||||||||+++||+++  ..+.++|+||...+.      +.+..+...++++||||+.+
T Consensus       156 ~~l~~LP~Idp~~pTivVaG~PNVGKSSlv~~lT~Ak--pEvA~YPFTTK~i~v------Ghfe~~~~R~QvIDTPGlLD  227 (346)
T COG1084         156 DHLKKLPAIDPDLPTIVVAGYPNVGKSSLVRKLTTAK--PEVAPYPFTTKGIHV------GHFERGYLRIQVIDTPGLLD  227 (346)
T ss_pred             HHHHCCCCCCCCCCEEEEECCCCCCHHHHHHHHHCCC--CCCCCCCCCCCCEEE------EEEECCCCEEEEECCCCCCC
T ss_conf             9985088779999738985699875899998875489--766788853365467------65504870589842886457


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC----CCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             112244789888899877776642000001122----3578875454554321025753221222211110246899999
Q gi|254780484|r   97 ARAPKKNVDSWGGLIVRYLSERSTLRCVYLLID----CRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLE  172 (212)
Q Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~  172 (212)
                      ....+.+....+......    .....+++..|    +......|...+.+.......|++.|+||+|..+.+..++...
T Consensus       228 RPl~ErN~IE~qAi~AL~----hl~~~IlF~~D~Se~cgy~lE~Q~~L~~eIk~~f~~p~v~V~nK~D~~~~e~~~~~~~  303 (346)
T COG1084         228 RPLEERNEIERQAILALR----HLAGVILFLFDPSETCGYSLEEQISLLEEIKELFKAPIVVVINKIDIADEEKLEEIEA  303 (346)
T ss_pred             CCHHHHCHHHHHHHHHHH----HHCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHH
T ss_conf             885773689999999999----7428589997685002899999999999999853887699974101246667899999


Q ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             9999975313689868999888889989999999987
Q gi|254780484|r  173 KTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       173 ~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      .+..      .++...+.+|+.++.++|++++.+.+.
T Consensus       304 ~~~~------~~~~~~~~~~~~~~~~~d~~~~~v~~~  334 (346)
T COG1084         304 SVLE------EGGEEPLKISATKGCGLDKLREEVRKT  334 (346)
T ss_pred             HHHH------HCCCCCCCEEEEEHHHHHHHHHHHHHH
T ss_conf             9876------326554313543000178899999887


No 45 
>TIGR00450 thdF tRNA modification GTPase TrmE; InterPro: IPR004520   The GTP-binding domain of all TrmE/ThdF orthologues is found in the C-terminal portion of the molecule. The N-terminal half can be removed without affecting the GTP-binding/hydrolysis function of the GTP-binding domain. The last four amino acids of all orthologues of ThdF/TrmE are highly conserved, being either CIGK or CLGK. This matches the Caax (where 'a' represents an aliphatic amino acid, and 'x' represents any amino acid) motif for isoprenylation that anchors small GTP-binding proteins to cell membranes in eukaryotic cells. However, protein isoprenylation has never been shown to occur in bacteria. Interestingly, biochemical experiments have shown that the Escherichia coli TrmE protein peripherally associates with the membrane fraction .    Although the biochemical properties of TrmE have been investigated for the E. coli and Thermotoga maritima proteins, nothing is known about the relationship of this protein to tRNA modification. Orthologues of TrmE are present in eukaryotes and bacteria, but are not present in archaea. In Saccharomyces cerevisiae, Mss1p is a nuclear-encoded mitochondrial protein that is the yeast orthologue of TrmE. Mss1p interacts with the 15S rRNA of the yeast mitochondria, which is equivalent to the 16S rRNA of bacteria. Subsequent analysis of the S. cerevisiae MTO1 gene suggests that MSS1 and MTO1 act together in a pathway involved in optimizing mitochondrial protein synthesis.    TrmE may play a role in tRNA processing and may be directly or indirectly involved in regulating ribosome function.; GO: 0003924 GTPase activity, 0005525 GTP binding, 0006400 tRNA modification, 0005622 intracellular.
Probab=99.90  E-value=7.9e-24  Score=156.14  Aligned_cols=124  Identities=24%  Similarity=0.262  Sum_probs=104.9

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      ++-+|||||.||||||||+||+..+++ |.|++.|||||+      ..+..+..++..+.+.||+|++.....-+..+..
T Consensus       224 ~g~k~ai~G~~NvGKSSLLNa~l~~Dr-AiVS~~kGtTRD------~vE~~~~L~G~~~~~lDTAGiR~~~~~~E~~Gie  296 (473)
T TIGR00450       224 DGFKLAIVGKPNVGKSSLLNALLKQDR-AIVSDIKGTTRD------VVEGDFELNGILVKLLDTAGIREHADKVERLGIE  296 (473)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHCCC-EEEECCCCCCCC------EEEEEEEECCEEEEEEECCCCCCCHHHHHHHHHH
T ss_conf             894799964788757899998762287-055276688320------4420577746789985146751020046677689


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             88998777766420000011223578875454554321025753221222211110
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS  163 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~  163 (212)
                      .     .......+.+++++.|...+..+.+..++......+.|+++|+||.|+..
T Consensus       297 k-----S~~~i~~A~LVi~~~D~~~~~~~ddf~li~~~~k~~k~~~~V~NK~DL~~  347 (473)
T TIGR00450       297 K-----SFKAIKQADLVIYVLDASQPLTKDDFELIITLNKKKKPLILVLNKIDLAI  347 (473)
T ss_pred             H-----HHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             9-----89998605734788874789881058999997321797799973501650


No 46 
>COG2262 HflX GTPases [General function prediction only]
Probab=99.90  E-value=2e-23  Score=153.80  Aligned_cols=164  Identities=20%  Similarity=0.205  Sum_probs=112.2

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      +++.|.|+||||+|||||||||+||+....  +.+.-+.|.++-+-+     ....++..+.+.||.||.......-...
T Consensus       189 ~~~~p~vaLvGYTNAGKSTL~N~LT~~~~~--~~d~LFATLdpttR~-----~~l~~g~~vlLtDTVGFI~~LP~~LV~A  261 (411)
T COG2262         189 RSGIPLVALVGYTNAGKSTLFNALTGADVY--VADQLFATLDPTTRR-----IELGDGRKVLLTDTVGFIRDLPHPLVEA  261 (411)
T ss_pred             CCCCCEEEEEEECCCCHHHHHHHHHCCCEE--CCCCCCCCCCCCEEE-----EEECCCCEEEEECCCCCCCCCCHHHHHH
T ss_conf             169975898732344499999887245713--046664210574048-----9807996499865756715598679999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHH----HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             8888998777766420000011223578875454----554321025753221222211110246899999999997531
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQ----DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY  181 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~  181 (212)
                      +...+.+     ....+..+++.|+..+......    .....+.....|.+.++||+|++.+...   ...+    .. 
T Consensus       262 FksTLEE-----~~~aDlllhVVDaSdp~~~~~~~~v~~vL~el~~~~~p~i~v~NKiD~~~~~~~---~~~~----~~-  328 (411)
T COG2262         262 FKSTLEE-----VKEADLLLHVVDASDPEILEKLEAVEDVLAEIGADEIPIILVLNKIDLLEDEEI---LAEL----ER-  328 (411)
T ss_pred             HHHHHHH-----HHCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCHHH---HHHH----HH-
T ss_conf             9998987-----622777999740688518999999999999748899978999764101573222---3456----63-


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             368986899988888998999999998728
Q gi|254780484|r  182 PTAHPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       182 ~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                        ..++.+++||++|+|+++|++.|.+.+.
T Consensus       329 --~~~~~v~iSA~~~~gl~~L~~~i~~~l~  356 (411)
T COG2262         329 --GSPNPVFISAKTGEGLDLLRERIIELLS  356 (411)
T ss_pred             --CCCCEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             --4897489980667598999999999863


No 47 
>KOG1191 consensus
Probab=99.88  E-value=1e-22  Score=149.75  Aligned_cols=170  Identities=23%  Similarity=0.284  Sum_probs=111.8

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      ..++|||+|+||||||||+|+|+..+ .++|++.||||++      ..+.++..++.+++++||+|+.....  ......
T Consensus       267 ~gl~iaIvGrPNvGKSSLlNaL~~~d-rsIVSpv~GTTRD------aiea~v~~~G~~v~L~DTAGiRe~~~--~~iE~~  337 (531)
T KOG1191         267 SGLQIAIVGRPNVGKSSLLNALSRED-RSIVSPVPGTTRD------AIEAQVTVNGVPVRLSDTAGIREESN--DGIEAL  337 (531)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCC-CEEECCCCCCCHH------HHEEEEECCCEEEEEEECCCCCCCCC--CHHHHH
T ss_conf             57728997699877889998875077-4476789996410------01227630875899973413100268--706777


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCC------------CCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             889987777664200000112235788754545543210257------------53221222211110246899999999
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA------------VSYQIVLTKIDKLSPTTAQETLEKTK  175 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------~~~~~v~nK~D~~~~~~~~~~~~~~~  175 (212)
                      ..  ..........+++..+.++......++..+.+.+...+            .+.+.+.||.|+..+-..-...  ..
T Consensus       338 gI--~rA~k~~~~advi~~vvda~~~~t~sd~~i~~~l~~~~~g~~~~~~~~~~~~~i~~~nk~D~~s~~~~~~~~--~~  413 (531)
T KOG1191         338 GI--ERARKRIERADVILLVVDAEESDTESDLKIARILETEGVGLVVIVNKMEKQRIILVANKSDLVSKIPEMTKI--PV  413 (531)
T ss_pred             HH--HHHHHHHHHCCEEEEEECCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCEEEEECHHHCCCCCCCCCCC--CE
T ss_conf             68--999988765477999963300333253289999887425558970444346237886102215766445677--40


Q ss_pred             HHHHHCCCC-CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             997531368-98689998888899899999999872
Q gi|254780484|r  176 YLIRNYPTA-HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       176 ~~~~~~~~~-~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ......... .+....+|+++++|++.|.+.|.+.+
T Consensus       414 ~~~~~~~~~~~~i~~~vs~~tkeg~~~L~~all~~~  449 (531)
T KOG1191         414 VYPSAEGRSVFPIVVEVSCTTKEGCERLSTALLNIV  449 (531)
T ss_pred             ECCCCCCCCCCCEEEEEEECHHHHHHHHHHHHHHHH
T ss_conf             023533576663378864120044899999999999


No 48 
>PRK12296 obgE GTPase ObgE; Reviewed
Probab=99.88  E-value=4.8e-22  Score=145.85  Aligned_cols=160  Identities=21%  Similarity=0.218  Sum_probs=107.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      .|+|||.||||||||+++|++++  ..+.++|+||..++....      ..++..+.+.|.||+..-.......... .+
T Consensus       161 DVGLvG~PNaGKSTLl~~iS~Ak--pkIA~YpFTTL~PnLGvv------~~~d~~f~iADiPGLIeGAs~g~GLG~~-FL  231 (495)
T PRK12296        161 DVGLVGFPSAGKSSLISAISAAK--PKIADYPFTTLVPNLGVV------SAGDHTFTVADVPGLIPGASEGRGLGLD-FL  231 (495)
T ss_pred             CCCEECCCCCCHHHHHHHHHCCC--CCCCCCCCCCCCCEEEEE------ECCCCEEEEEECCCCCCCCCCCCCCHHH-HH
T ss_conf             31101189996158998875488--765787755457546789------7079528998566434650038984399-99


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCC----CHHHH-----HHHHHH----------CCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             987777664200000112235788----75454-----554321----------02575322122221111024689999
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGV----KQIDQ-----DVFSFL----------DKKAVSYQIVLTKIDKLSPTTAQETL  171 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~-----~~~~~~----------~~~~~~~~~v~nK~D~~~~~~~~~~~  171 (212)
                      ..     +....+.+++.|.....    ...+.     ++..+.          ....+|.++++||+|+.+..+.   .
T Consensus       232 RH-----ieR~~vL~hviD~~~~e~~rDP~~d~~~I~~EL~~Y~~~l~~~~~~~~L~erpqIVvlNKiDlp~a~e~---~  303 (495)
T PRK12296        232 RH-----IERCAVLVHVVDCATLEPGRDPISDIDALEAELAAYTPTLQGDAGLGDLAERPRLVVLNKIDVPDAREL---A  303 (495)
T ss_pred             HH-----HHHCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCHHHHCCCCCCCCCCCCEEEEEECCCCCCHHHH---H
T ss_conf             98-----752547999996887666789699999999999971914304433232101965999966567576999---9


Q ss_pred             HHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             999999753136898689998888899899999999872
Q gi|254780484|r  172 EKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       172 ~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +.+.+.+..   .+.++++|||.+++|+++|...+.+.|
T Consensus       304 e~~~~~l~~---~g~~Vf~ISA~t~eGl~eL~~~l~elv  339 (495)
T PRK12296        304 EFVRPELEE---RGWPVFEVSTVTREGLRPLSFALAELV  339 (495)
T ss_pred             HHHHHHHHH---CCCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             999999987---499579986410038999999999999


No 49 
>PRK12312 infB translation initiation factor IF-2; Provisional
Probab=99.87  E-value=3.5e-21  Score=140.88  Aligned_cols=160  Identities=21%  Similarity=0.316  Sum_probs=123.2

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      .+.+|-|+|+||.++||+||+.+|.+.+..  .....|-|...+.+...      .++..+.|+||||+..+.       
T Consensus       114 ~~R~PvVtimGHVDHGKTsLLD~iR~t~V~--~~EaGGITQhIGA~~v~------~~~~~itFiDTPGHeAFt-------  178 (610)
T PRK12312        114 EKRPPIVTIMGHVDHGKTTLLDTIRKTNVV--ASEAGGITQHIGAYQVE------YQGKKITFIDTPGHEAFT-------  178 (610)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCCCCEECEEEEE------ECCCEEEEECCCCHHHHH-------
T ss_conf             788998999677257722588998548641--34677664400449998------679768997289679899-------


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCH--HHHHHHHHHHHHHHHHCCC
Q ss_conf             88889987777664200000112235788754545543210257532212222111102--4689999999999753136
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSP--TTAQETLEKTKYLIRNYPT  183 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~--~~~~~~~~~~~~~~~~~~~  183 (212)
                            .+..+.....+.++++..+.+++.+|..+-++.....+.|+++++||+|+-+.  +.+...+.. .....+.|.
T Consensus       179 ------~mR~RGa~vtDI~iLVVaaddGv~pQTiEaI~~ak~a~vpiiVAiNKiDkp~a~~~~v~~~L~~-~g~~~E~~G  251 (610)
T PRK12312        179 ------EMRARGAKVTDIVILVVAADDGVKPQTEEAIDHAKAANVPIIVFVNKMDKPNANPDRIKNELSK-YDLVPEEWG  251 (610)
T ss_pred             ------HHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHH-HCCCHHHHC
T ss_conf             ------9997077654579999975789774269999999975998899850446788987899999987-076678857


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             898689998888899899999999
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~  207 (212)
                      +..+++||||++|+||++|.+.|.
T Consensus       252 Gdv~~V~iSAktg~GId~LLe~Il  275 (610)
T PRK12312        252 GDTPFVYGSALKNEGIDELLDSIL  275 (610)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHH
T ss_conf             944599903687989999999999


No 50 
>PRK12297 obgE GTPase ObgE; Reviewed
Probab=99.86  E-value=7.6e-22  Score=144.73  Aligned_cols=161  Identities=22%  Similarity=0.255  Sum_probs=105.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      .|+|||.||||||||++++++++  +.+.++|+||..++......     .+...+.+.|.||+..-.......... .+
T Consensus       160 DVGLvG~PNaGKSTll~~is~A~--pkIa~YpFTTl~P~lGvv~~-----~~~~~~~iADiPGLIeGA~~g~GLG~~-FL  231 (429)
T PRK12297        160 DVGLVGFPNVGKSTLLSVVSNAK--PKIANYHFTTLVPNLGVVET-----DDGRSFVMADLPGLIEGASEGVGLGHQ-FL  231 (429)
T ss_pred             CCCEEECCCCCHHHHHHHHHCCC--CCCCCCCCCCCCCEEEEEEE-----CCCCEEEEEECCCCCCCCCCCCCCCHH-HH
T ss_conf             76336479984578998875489--75578774025766668985-----698669996267456774468886688-88


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCC----CCCHHHHHHHH----H-HCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             9877776642000001122357----88754545543----2-1025753221222211110246899999999997531
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRH----GVKQIDQDVFS----F-LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY  181 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~----~-~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~  181 (212)
                      ..     +......+++.|...    ...+....+..    + .....+|.++++||+|+....+   .++.+.+.+.  
T Consensus       232 rH-----ieR~~~L~hviD~s~~~~~dp~~d~~~i~~EL~~y~~~L~~kp~ivv~NK~Dl~~~~~---~~~~~~~~~~--  301 (429)
T PRK12297        232 RH-----IERTRVIVHVIDMSGSEGRDPIEDYETINKELKKYNLRLLERPQIIVANKMDLPEAEE---NLEEFKEKLA--  301 (429)
T ss_pred             HH-----HHHCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCHHHHCCCEEEEEECCCCCCHHH---HHHHHHHHHH--
T ss_conf             87-----6624679999978787777989999999999998689872696699997645857699---9999999753--


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             368986899988888998999999998728
Q gi|254780484|r  182 PTAHPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       182 ~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                        ...+++++||.+|+|+++|..++.+.|.
T Consensus       302 --~~~~i~~iSa~t~egl~~l~~~i~~~l~  329 (429)
T PRK12297        302 --KGKKVFPISALTKQGLDELLYAIAELLE  329 (429)
T ss_pred             --CCCCEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             --4697899968445199999999999998


No 51 
>KOG1423 consensus
Probab=99.86  E-value=9.3e-21  Score=138.46  Aligned_cols=173  Identities=19%  Similarity=0.263  Sum_probs=114.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+||++|.||||||||.|.+.|++. +.++.++.||+.      ...+....+.+++.|.||||+.........-.....
T Consensus        73 L~vavIG~PNvGKStLtN~mig~kv-~~vS~K~~TTr~------~ilgi~ts~eTQlvf~DTPGlvs~~~~r~~~l~~s~  145 (379)
T KOG1423          73 LYVAVIGAPNVGKSTLTNQMIGQKV-SAVSRKVHTTRH------RILGIITSGETQLVFYDTPGLVSKKMHRRHHLMMSV  145 (379)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCC-CCCCCCCCCEEE------EEEEEEECCCEEEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             8999970897654554457648721-201156653020------135787159658999648764533413567888876


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHH-CCCCCCCCCCCCCCCCCCHH-------------HHHHHHHHHH
Q ss_conf             998777766420000011223578875454554321-02575322122221111024-------------6899999999
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFL-DKKAVSYQIVLTKIDKLSPT-------------TAQETLEKTK  175 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~v~nK~D~~~~~-------------~~~~~~~~~~  175 (212)
                      + .....+...++++.++.|+..............+ ....+|.+++.||+|++...             +......+++
T Consensus       146 l-q~~~~a~q~AD~vvVv~Das~tr~~l~p~vl~~l~~ys~ips~lvmnkid~~k~k~~Ll~l~~~Lt~g~l~~~kl~v~  224 (379)
T KOG1423         146 L-QNPRDAAQNADCVVVVVDASATRTPLHPRVLHMLEEYSKIPSILVMNKIDKLKQKRLLLNLKDLLTNGELAKLKLEVQ  224 (379)
T ss_pred             H-HCHHHHHHHCCEEEEEEECCCCCCCCCHHHHHHHHHHHCCCCEEECCCHHCCHHHHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             5-378988863887999985567767568078777899861872033040002214667766677605551003456588


Q ss_pred             HHHHHC-----------CCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             997531-----------36898689998888899899999999872
Q gi|254780484|r  176 YLIRNY-----------PTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       176 ~~~~~~-----------~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +.+...           |-.+..+|++||++|.||++|+++|....
T Consensus       225 ~~f~~~p~~~~~~~~~gwshfe~vF~vSaL~G~GikdlkqyLmsqa  270 (379)
T KOG1423         225 EKFTDVPSDEKWRTICGWSHFERVFMVSALYGEGIKDLKQYLMSQA  270 (379)
T ss_pred             HHHCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHCC
T ss_conf             8735597433564324764531489984046667899999997237


No 52 
>CHL00189 infB translation initiation factor 2; Provisional
Probab=99.86  E-value=6.9e-21  Score=139.22  Aligned_cols=162  Identities=21%  Similarity=0.300  Sum_probs=124.8

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      .+|-|.||||..+||+||+.+|-..+..  .....|-|...+.+.....  ....+..+.|+||||+..+.         
T Consensus       271 RpPVVTIMGHVDHGKTsLLD~iR~t~Va--~~EaGGITQhIGAy~V~~~--~~~~~~~ITFlDTPGHeAFt---------  337 (770)
T CHL00189        271 RPPIVTILGHVDHGKTTLLDAIRKTNIA--QKEAGGITQKIGAYEVEVP--YKDQNQKIVFLDTPGHEAFS---------  337 (770)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCCCCEECEEEEEEC--CCCCCCEEEEECCCCHHHHH---------
T ss_conf             8998998577257720378888528851--3456765550352999751--57889758995599468899---------


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC--HHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             88998777766420000011223578875454554321025753221222211110--2468999999999975313689
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS--PTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~--~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                          .+..+.....+.+++++.+.++.++|..+.++.....+.|+++++||||+-.  ++.+...+.+. ....+.|.+.
T Consensus       338 ----~MRaRGA~vTDIvILVVAADDGVmPQTiEAI~hakaA~VPiIVAINKiDkp~an~~rVk~eL~e~-gli~EewGGd  412 (770)
T CHL00189        338 ----SMRSRGANVTDIAILIVAADDGVKPQTIEAINHIQAANVPIIVAINKIDKENANIDRVKQELSKY-NLISEKWGGQ  412 (770)
T ss_pred             ----HHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHC-CCCHHHCCCC
T ss_conf             ----99862786666799999657885672799999998769988999877458998857899999986-9552223795


Q ss_pred             CCEEEEECCCCCCHHHHHHHHH
Q ss_conf             8689998888899899999999
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~  207 (212)
                      .++++|||++|+||++|.+.|.
T Consensus       413 ~~~V~ISAktg~gId~LLE~Il  434 (770)
T CHL00189        413 TPMIPISALQGTNIDKLLEMIL  434 (770)
T ss_pred             EEEEEEEECCCCCHHHHHHHHH
T ss_conf             5999966167988799999999


No 53 
>PRK05306 infB translation initiation factor IF-2; Validated
Probab=99.84  E-value=3.7e-20  Score=135.03  Aligned_cols=161  Identities=23%  Similarity=0.329  Sum_probs=123.6

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      ...+|-|.||||.++||+||+.+|.+.+..  .....|-|...+.+...     ...+..+.|+||||+..+.       
T Consensus       338 ~~r~pvvt~mghvdhgkt~lld~~r~~~v~--~~e~ggitq~iga~~v~-----~~~~~~itf~dtpgh~af~-------  403 (839)
T PRK05306        338 VPRPPVVTIMGHVDHGKTSLLDAIRKTKVA--AGEAGGITQHIGAYQVE-----TENGKKITFLDTPGHEAFT-------  403 (839)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCCCCEEEEEEEE-----ECCCCEEEEECCCCHHHHH-------
T ss_conf             668988988577467731489998628753--55678755222349999-----5699879985588558899-------


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC--HHHHHHHHHHHHHHHHHCCC
Q ss_conf             8888998777766420000011223578875454554321025753221222211110--24689999999999753136
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS--PTTAQETLEKTKYLIRNYPT  183 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~--~~~~~~~~~~~~~~~~~~~~  183 (212)
                            .+..+.....+.+++++.+.++.+.|..+.++.....+.|+++++||||+-.  ++.+...+.. .....+.|.
T Consensus       404 ------~mr~rga~~tdi~ilvvaaddgv~pqt~eai~~~~~a~vp~ivaink~d~~~a~~~~v~~~l~~-~~~~~e~~g  476 (839)
T PRK05306        404 ------AMRARGAQVTDIVVLVVAADDGVMPQTIEAINHAKAAGVPIIVAINKIDKPGANPDRVKQELTE-YGLVPEEWG  476 (839)
T ss_pred             ------HHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHH-CCCCHHHCC
T ss_conf             ------9986357654369999977777567789999999974998899974046788988999999998-498645428


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             898689998888899899999999
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~  207 (212)
                      +..++++|||++|.|||+|.+.|+
T Consensus       477 g~~~~v~~sa~~~~~~~~l~e~i~  500 (839)
T PRK05306        477 GDTIFVPVSAKTGEGIDELLEAIL  500 (839)
T ss_pred             CCEEEEEEEECCCCCHHHHHHHHH
T ss_conf             944899815157887899999999


No 54 
>cd01889 SelB_euk SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner.  This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and euk
Probab=99.83  E-value=1.6e-19  Score=131.31  Aligned_cols=167  Identities=21%  Similarity=0.271  Sum_probs=114.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECC-----CCCEEEECCEEEEE--------EEEEEEECCCEEEEEECCHHHHH
Q ss_conf             899974899889899999738973798738-----88414521202665--------55678508964999976001011
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSN-----APGRTQHLNFFVPK--------DFSNLKNNLPAMALVDMPGYGYA   97 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~-----~p~tt~~~~~~~~~--------~~~~~~~~~~~~~~~DtpG~~~~   97 (212)
                      -|+++|+.++|||||..+|++....+....     .-|.|...++....        ...........+.++||||+..+
T Consensus         2 NV~iiGHVDhGKTTL~~~L~~~~~~~~~D~~~eE~eRGITi~~g~~~~~~~~~~~~~~~~~~~~~~~~i~~IDtPGH~df   81 (192)
T cd01889           2 NVGVLGHVDSGKTSLAKALSEIASTAAFDKNPQSQERGITLDLGFSSFYVDKPKHLRELINPGEENLQITLVDCPGHASL   81 (192)
T ss_pred             EEEEEEECCCCHHHHHHHHHHHCCCHHHHCCHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCEEEEEEECCCCHHH
T ss_conf             89999761789999999998333501221358899779716710013785144221123234677458999877983889


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             12244789888899877776642000001122357887545455432102575322122221111024689999999999
Q gi|254780484|r   98 RAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYL  177 (212)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~  177 (212)
                      ..             .........+..+.+.++..+...|..+........+.|.++++||+|+++.++.+...+.+.+.
T Consensus        82 ~~-------------~~~~g~~~~D~ailvVda~~G~~~QT~eh~~~~~~~~~~~iv~iNK~D~v~~~~~~~~~~~i~~~  148 (192)
T cd01889          82 IR-------------TIIGGAQIIDLMLLVVDATKGIQTQTAECLVIGEILCKKLIVVLNKIDLIPEEERERKIEKMKKK  148 (192)
T ss_pred             HH-------------HHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             98-------------88888743265279998788887899999999998589979999741278815779999999999


Q ss_pred             ----HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             ----753136898689998888899899999999872
Q gi|254780484|r  178 ----IRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       178 ----~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                          +........+++|+||++|.|+++|.+.|.+.+
T Consensus       149 l~~~l~~~~~~~~~iipiSA~~G~gi~eL~~~i~~li  185 (192)
T cd01889         149 LQKTLEKTRFKNSPIIPVSAKPGGGEAELGKDLNNLI  185 (192)
T ss_pred             HHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             9999865389998499957898849899998887618


No 55 
>cd01890 LepA LepA subfamily.  LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome.  LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea.  This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont.  Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype.
Probab=99.83  E-value=1.2e-19  Score=132.18  Aligned_cols=163  Identities=19%  Similarity=0.206  Sum_probs=105.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCE-------EEECCEEEEEEEEEEEE-----CCCEEEEEECCHHHHHH
Q ss_conf             8999748998898999997389737987388841-------45212026655567850-----89649999760010111
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGR-------TQHLNFFVPKDFSNLKN-----NLPAMALVDMPGYGYAR   98 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~t-------t~~~~~~~~~~~~~~~~-----~~~~~~~~DtpG~~~~~   98 (212)
                      .|||+|++++|||||+++|..............+       .+..+.+.........+     ....+.++||||+..+.
T Consensus         2 NiaiiGHvd~GKTTL~~~ll~~tg~i~~~~~~~~~~D~~~~E~eRgiTi~~~~~~~~~~~~~~~~~~in~iDtPGh~dF~   81 (179)
T cd01890           2 NFSIIAHIDHGKSTLADRLLELTGTVSKREMKEQVLDSMDLERERGITIKAQTVRLNYKAKDGQEYLLNLIDTPGHVDFS   81 (179)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEECCCCHHHHHCCCEEEEEEEEEEEECCCCCCEEEEEEECCCCCCCH
T ss_conf             59999489989899999999985995414573244165176786386687433688841367871489999899864517


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             22447898888998777766420000011223578875454554321025753221222211110246899999999997
Q gi|254780484|r   99 APKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLI  178 (212)
Q Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~  178 (212)
                      ..             ........+..+.+.++..+...+...........+.|.++++||+|+...+ ..+..+.+++.+
T Consensus        82 ~~-------------~~~al~~~D~allVVda~~Gv~~qT~~~~~~a~~~~~p~ivviNKiD~~~ad-~~~v~~~i~~~~  147 (179)
T cd01890          82 YE-------------VSRSLAACEGALLLVDATQGVEAQTLANFYLALENNLEIIPVINKIDLPSAD-PERVKQQIEDVL  147 (179)
T ss_pred             HH-------------HHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCC-HHHHHHHHHHHH
T ss_conf             78-------------9889975442789986477873748999999987699889998655567789-999999999986


Q ss_pred             HHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             53136898689998888899899999999872
Q gi|254780484|r  179 RNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       179 ~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                         .....+++++||++|.|+++|++.|.++|
T Consensus       148 ---g~~~~~~v~vSA~~g~gv~~Ll~~i~~~i  176 (179)
T cd01890         148 ---GLDPSEAILVSAKTGLGVEDLLEAIVERI  176 (179)
T ss_pred             ---CCCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             ---88976748843788979899999999648


No 56 
>PRK04004 translation initiation factor IF-2; Validated
Probab=99.83  E-value=1.5e-19  Score=131.55  Aligned_cols=165  Identities=18%  Similarity=0.232  Sum_probs=118.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEE------------EECCCEEEEEECCHHH
Q ss_conf             6868999748998898999997389737987388841452120266555678------------5089649999760010
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNL------------KNNLPAMALVDMPGYG   95 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~------------~~~~~~~~~~DtpG~~   95 (212)
                      ..|-|+|+||..+||+||+.+|-+.+..  .....|-|...+.+........            ....+++.|+||||+.
T Consensus         4 R~PIvtimGHVDhGKTsLLD~iR~t~V~--~~EaGGITQhIGA~~v~~~~~~~~~~~~~~~~~~~~~ipgllfiDTPGHe   81 (592)
T PRK04004          4 RQPIVVVLGHVDHGKTTLLDKIRGTAVA--AKEAGGITQHIGATEVPIDVIEKIAGPLVKRLPLKLKIPGLLFIDTPGHE   81 (592)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCCCCEECEEEECCCCHHHHCCCCCCCCCCCCCCCCCEEECCCCHH
T ss_conf             8988999787377763689998628773--55577623230659841231011034433443323456775576599659


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCH-----------
Q ss_conf             111224478988889987777664200000112235788754545543210257532212222111102-----------
Q gi|254780484|r   96 YARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSP-----------  164 (212)
Q Consensus        96 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~-----------  164 (212)
                      .+.             .+..+.....+.++++.++.+++.+|..+-++.+...+.|+++++||+|++.-           
T Consensus        82 aFt-------------~mR~RGa~vtDiaILVVa~~dGv~pQT~EaI~~~k~~~vP~IVAiNKiDr~~gw~~~~~~~~~~  148 (592)
T PRK04004         82 AFS-------------NLRKRGGALADIAILVVDINEGFQPQTIESLNILKSRKTPFVVAANKIDRIPGWKSVEGAPFLE  148 (592)
T ss_pred             HHH-------------HHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHHH
T ss_conf             999-------------9997367457889999977888676279999999975998899986223566677676741123


Q ss_pred             ------HHH----HHHHHHHHHHHHHC------------CCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             ------468----99999999997531------------36898689998888899899999999
Q gi|254780484|r  165 ------TTA----QETLEKTKYLIRNY------------PTAHPEVIPTSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       165 ------~~~----~~~~~~~~~~~~~~------------~~~~~~i~~vSA~~g~Gi~eL~~~I~  207 (212)
                            ...    ++.+..+...+.++            +.+..+++|+||++|+||++|...|.
T Consensus       149 ~~~~q~~~v~~~l~~~~~~vi~~l~e~G~~~e~~~~~~d~g~~v~~VpvSA~tGeGi~dLL~~i~  213 (592)
T PRK04004        149 SFKKQSERVQAELEEKLYELIGELYELGFSADRFDRVSDFTKTVAIVPVSAKTGEGIPDLLMVLA  213 (592)
T ss_pred             HHHHCCHHHHHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCCCCEEEEECCCCCCCCHHHHHHHHH
T ss_conf             22317388999998888888899987287632214543458814899782056899899999999


No 57 
>COG0536 Obg Predicted GTPase [General function prediction only]
Probab=99.82  E-value=3.9e-20  Score=134.87  Aligned_cols=163  Identities=18%  Similarity=0.148  Sum_probs=104.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      .|++||.||||||||+|+++.+|  ..+.++|+||..++...+..     .....+.+.|.||+..-...........-.
T Consensus       161 DVGLVG~PNaGKSTlls~vS~Ak--PKIadYpFTTL~PnLGvV~~-----~~~~sfv~ADIPGLIEGAs~G~GLG~~FLr  233 (369)
T COG0536         161 DVGLVGLPNAGKSTLLSAVSAAK--PKIADYPFTTLVPNLGVVRV-----DGGESFVVADIPGLIEGASEGVGLGLRFLR  233 (369)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHCC--CCCCCCCCCCCCCCCCEEEE-----CCCCEEEEECCCCCCCCCCCCCCCCHHHHH
T ss_conf             11412589885798998886068--85448865302475307996-----488607993475323564468876388887


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCC----CHHH----HHHHHH-HCCCCCCCCCCCCCCCCCCH-HHHHHHHHHHHHHHHH
Q ss_conf             987777664200000112235788----7545----455432-10257532212222111102-4689999999999753
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGV----KQID----QDVFSF-LDKKAVSYQIVLTKIDKLSP-TTAQETLEKTKYLIRN  180 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~----~~~~----~~~~~~-~~~~~~~~~~v~nK~D~~~~-~~~~~~~~~~~~~~~~  180 (212)
                      +      +......++++|.....    .+..    .++..+ .....+|.++++||+|...+ ++.+...+.+.+.   
T Consensus       234 H------IERt~vL~hviD~s~~~~~dp~~~~~~i~~EL~~Y~~~L~~K~~ivv~NKiD~~~~~e~~~~~~~~l~~~---  304 (369)
T COG0536         234 H------IERTRVLLHVIDLSPIDGRDPIEDYQTIRNELEKYSPKLAEKPRIVVLNKIDLPLDEEELEELKKALAEA---  304 (369)
T ss_pred             H------HHHHHEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHH---
T ss_conf             8------8865154799856765677989999999999998577753585699985557766789999999999874---


Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             1368986899988888998999999998728
Q gi|254780484|r  181 YPTAHPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       181 ~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                       .. ....++|||.+++|+++|...+.+.+.
T Consensus       305 -~~-~~~~~~ISa~t~~g~~~L~~~~~~~l~  333 (369)
T COG0536         305 -LG-WEVFYLISALTREGLDELLRALAELLE  333 (369)
T ss_pred             -CC-CCCCEEEEHHCCCCHHHHHHHHHHHHH
T ss_conf             -08-876315543102487999999999999


No 58 
>TIGR00475 selB selenocysteine-specific translation elongation factor; InterPro: IPR004535   In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3' or 5' non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation .   This family describes the elongation factor SelB, a close homologue of EF-Tu. It may function by replacing EF-Tu. A C-terminal domain not found in EF-Tu is in all SelB sequences in the seed alignment except that from Methanococcus jannaschii. This family should not include an equivalent protein for eukaryotes. ; GO: 0003723 RNA binding, 0003746 translation elongation factor activity, 0005525 GTP binding, 0001514 selenocysteine incorporation, 0005737 cytoplasm.
Probab=99.82  E-value=2.7e-19  Score=130.03  Aligned_cols=167  Identities=21%  Similarity=0.355  Sum_probs=140.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECC--CEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089--6499997600101112244789888
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL--PAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~--~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      -||..||-.+||++|+.+|||-.. .++...|--....+++-+-.++....++  ....|+|-||++             
T Consensus         2 ~~at~GHvDHGKT~L~k~LTgi~s-tsa~~lPeEkqKRG~tIDLGfAy~~l~~~n~~l~~iDvPGHe-------------   67 (627)
T TIGR00475         2 IIATAGHVDHGKTTLLKALTGIDS-TSADRLPEEKQKRGMTIDLGFAYLPLPDINKRLGFIDVPGHE-------------   67 (627)
T ss_pred             EEEEECCCCHHHHHHHHHHCCCCC-HHHHCCCCCCCCCCCEEECCCEECCCCCCCCCCEEEECCCHH-------------
T ss_conf             687312445047999998506430-123127741025766246042003677777133478559738-------------


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-CCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC-CC
Q ss_conf             8998777766420000011223578875454554321025753-221222211110246899999999997531368-98
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS-YQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA-HP  186 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~-~~  186 (212)
                      .+....++........+.++++..+...|..+....+...+.| .++|+||+|.++.+.+......+++.+.++... .-
T Consensus        68 ~fl~n~lAg~~~i~~alLvVda~eG~~~QT~EHL~vl~~l~~~~~ivvltK~D~~d~~~~~~~E~~~~~~l~~~~~~~n~  147 (627)
T TIGR00475        68 KFLSNALAGIGGIDAALLVVDADEGVMTQTKEHLAVLKLLGIPELIVVLTKADRVDEEEVKRVEEELKEILEEYEFLKNA  147 (627)
T ss_pred             HHHHHHHHHHHHHHHHEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999866756540100354157788532389999999708961999973467456589999999999998764321157


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             6899988888998999999998728
Q gi|254780484|r  187 EVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       187 ~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      .++.+||.+|+||++|++.|.+.+.
T Consensus       148 ~~~~~SA~tG~Gi~~Lk~~L~~L~e  172 (627)
T TIGR00475       148 KIFKTSAKTGQGIEELKKELKNLLE  172 (627)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             4799913468777899999986577


No 59 
>KOG1489 consensus
Probab=99.81  E-value=6e-20  Score=133.80  Aligned_cols=162  Identities=20%  Similarity=0.191  Sum_probs=104.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      ++.|++||.||||||||+|||+.+|.  .+.++++||..+.....     ...+..++.+.|.||+............. 
T Consensus       196 iadvGLVG~PNAGKSTLL~als~AKp--kVa~YaFTTL~P~iG~v-----~yddf~q~tVADiPGiI~GAh~nkGlG~~-  267 (366)
T KOG1489         196 IADVGLVGFPNAGKSTLLNALSRAKP--KVAHYAFTTLRPHIGTV-----NYDDFSQITVADIPGIIEGAHMNKGLGYK-  267 (366)
T ss_pred             ECCCCEECCCCCCHHHHHHHHHCCCC--CCCCCCEEEECCCCCEE-----ECCCCCEEEECCCCCCCCCCCCCCCCCHH-
T ss_conf             05543212898867889877640587--54554203444641125-----13545146850476534454346765489-


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCC----CCHHHHHHHHH-----HCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             8998777766420000011223578----87545455432-----10257532212222111102468999999999975
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHG----VKQIDQDVFSF-----LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR  179 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~-----~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~  179 (212)
                      ++..     +.......++.|....    .+.+...+..+     ......|.++|.||+|..  +..++.++++...+ 
T Consensus       268 FLrH-----iER~~~l~fVvD~s~~~~~~p~~~~~lL~~ELe~yek~L~~rp~liVaNKiD~~--eae~~~l~~L~~~l-  339 (366)
T KOG1489         268 FLRH-----IERCKGLLFVVDLSGKQLRNPWQQLQLLIEELELYEKGLADRPALIVANKIDLP--EAEKNLLSSLAKRL-  339 (366)
T ss_pred             HHHH-----HHHHCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCH--HHHHHHHHHHHHHC-
T ss_conf             9998-----875334899997787555887899999999999986542358538997446736--67888999999873-


Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             3136898689998888899899999999872
Q gi|254780484|r  180 NYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       180 ~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                          ..+-++++||++++|+++|++.|.+.+
T Consensus       340 ----q~~~V~pvsA~~~egl~~ll~~lr~~~  366 (366)
T KOG1489         340 ----QNPHVVPVSAKSGEGLEELLNGLRELL  366 (366)
T ss_pred             ----CCCCEEEEEECCCCCHHHHHHHHHHCC
T ss_conf             ----798178764004645688998776309


No 60 
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2).  eIF2 is a heterotrimeric translation initiation factor that consists of alpha, beta, and gamma subunits.  The GTP-bound gamma subunit also binds initiator methionyl-tRNA and delivers it to the 40S ribosomal subunit.  Following hydrolysis of GTP to GDP, eIF2:GDP is released from the ribosome.  The gamma subunit has no intrinsic GTPase activity, but is stimulated by the GTPase activating protein (GAP) eIF5, and GDP/GTP exchange is stimulated by the guanine nucleotide exchange factor (GEF) eIF2B.  eIF2B is a heteropentamer, and the epsilon chain binds eIF2.  Both eIF5 and eIF2B-epsilon are known to bind strongly to eIF2-beta, but have also been shown to bind directly to eIF2-gamma.  It is possible that eIF2-beta serves simply as a high-affinity docking site for eIF5 and eIF2B-epsilon, or that eIF2-beta serves a regulatory role.  eIF2-gamma is found only in eukaryotes and archaea.  It is closely related to SelB, the sel
Probab=99.80  E-value=1.3e-18  Score=126.17  Aligned_cols=166  Identities=22%  Similarity=0.283  Sum_probs=110.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCE--EEECCCCCEEEECC-------------------EEEEEEEEEE--------EE
Q ss_conf             8999748998898999997389737--98738884145212-------------------0266555678--------50
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNL--ARTSNAPGRTQHLN-------------------FFVPKDFSNL--------KN   81 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~--a~~~~~p~tt~~~~-------------------~~~~~~~~~~--------~~   81 (212)
                      .|+++|+..+|||||+-+|+|....  ...... +-|...+                   ..........        ..
T Consensus         2 Ni~iiGHVDhGKSTLi~~L~g~~~~~~~~e~er-~it~klg~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (203)
T cd01888           2 NIGTIGHVAHGKSTLVKALSGVWTVRFKEELER-NITIKLGYANAKIYKCPNCGCPRPYCYRSKEDSPECECPGCGGETK   80 (203)
T ss_pred             EEEEEEEECCCHHHHHHHHHCCCHHHHHHHHHC-CCCHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCCEEEECCCCCCCC
T ss_conf             699998857879999999708512440788867-7603111456666511121223101111012442145314565431


Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC-CHHHHHHHHHHCCCCCC-CCCCCCCC
Q ss_conf             89649999760010111224478988889987777664200000112235788-75454554321025753-22122221
Q gi|254780484|r   82 NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGV-KQIDQDVFSFLDKKAVS-YQIVLTKI  159 (212)
Q Consensus        82 ~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~-~~~v~nK~  159 (212)
                      ....+.++|+||+..+.             ..........+..++++++..+. ..|..+....+...+.+ .++++||+
T Consensus        81 ~~r~~tiiD~PGH~df~-------------~nmi~Gas~aD~aiLvVdA~eG~~~~QT~eH~~l~~~lgv~~iIV~vNKm  147 (203)
T cd01888          81 LVRHVSFVDCPGHEILM-------------ATMLSGAAVMDGALLLIAANEPCPQPQTSEHLAALEIMGLKHIIIVQNKI  147 (203)
T ss_pred             CEEEEEEEECCCHHHHH-------------HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             12479998689879999-------------99997664347668986436677507799999999984998636775077


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             111024689999999999753136898689998888899899999999872
Q gi|254780484|r  160 DKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       160 D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      |+++.+...+..+++...+..+.....+++|+||++|.||++|++.|.+.+
T Consensus       148 Dlv~~~~~~~~~~ei~~~l~~~~~~~~~iIPiSA~~G~NI~~ll~~i~~~i  198 (203)
T cd01888         148 DLVKEEQALENYEQIKKFVKGTIAENAPIIPISAQLKYNIDVLLEYIVKKI  198 (203)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             778867899999999998552168998599914788979999999998678


No 61 
>COG1163 DRG Predicted GTPase [General function prediction only]
Probab=99.80  E-value=1.8e-19  Score=131.02  Aligned_cols=169  Identities=20%  Similarity=0.162  Sum_probs=104.3

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHH
Q ss_conf             88766868999748998898999997389737987388841452120266555678508964999976001011122447
Q gi|254780484|r   24 LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKN  103 (212)
Q Consensus        24 ~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~  103 (212)
                      .+++.--+|++||.||||||||+|+|||.+.  .+..+|+||..+      ..+++...+..++++|+||+.........
T Consensus        58 V~KsGda~v~lVGfPsvGKStLL~~LTnt~s--eva~y~FTTl~~------vPG~l~Y~ga~IQild~Pgii~gas~g~g  129 (365)
T COG1163          58 VKKSGDATVALVGFPSVGKSTLLNKLTNTKS--EVADYPFTTLEP------VPGMLEYKGAQIQLLDLPGIIEGASSGRG  129 (365)
T ss_pred             EECCCCEEEEEECCCCCCHHHHHHHHHCCCC--CCCCCCCEECCC------CCCEEEECCCEEEEECCCCCCCCCCCCCC
T ss_conf             7425773899976887458999988768876--434567410244------57447547816999727631257656888


Q ss_pred             HHH------------------------HHHHH-HHHHHHHHHHC----C-------------------------------
Q ss_conf             898------------------------88899-87777664200----0-------------------------------
Q gi|254780484|r  104 VDS------------------------WGGLI-VRYLSERSTLR----C-------------------------------  123 (212)
Q Consensus       104 ~~~------------------------~~~~~-~~~~~~~~~~~----~-------------------------------  123 (212)
                      ...                        ..... +.....+....    .                               
T Consensus       130 rG~~vls~~R~ADlIiiVld~~~~~~~~~~i~~ELe~~GIrlnk~~p~V~I~kk~~gGI~i~~t~~l~~~d~~~ir~iL~  209 (365)
T COG1163         130 RGRQVLSVARNADLIIIVLDVFEDPHHRDIIERELEDVGIRLNKRPPDVTIKKKESGGIRINGTGPLTHLDEDTVRAILR  209 (365)
T ss_pred             CCCEEEEEECCCCEEEEEEECCCCHHHHHHHHHHHHHCCEEECCCCCCEEEEEECCCCEEEECCCCCCCCCHHHHHHHHH
T ss_conf             76465465215888999971688824889999999856768217999659999525987980454566689999999999


Q ss_pred             --CCCCCC--CCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCH
Q ss_conf             --001122--3578875454554321025753221222211110246899999999997531368986899988888998
Q gi|254780484|r  124 --VYLLID--CRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI  199 (212)
Q Consensus       124 --~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi  199 (212)
                        -++-.+  ........+....-.....-+|.+.++||+|++..++...    +.+        ..+.+++||.+|+|+
T Consensus       210 Ey~I~nA~V~Ir~dvTlDd~id~l~~nrvY~p~l~v~NKiD~~~~e~~~~----l~~--------~~~~v~isa~~~~nl  277 (365)
T COG1163         210 EYRIHNADVLIREDVTLDDLIDALEGNRVYKPALYVVNKIDLPGLEELER----LAR--------KPNSVPISAKKGINL  277 (365)
T ss_pred             HHCCCCEEEEEECCCCHHHHHHHHHHCCEEEEEEEEEECCCCCCHHHHHH----HHH--------CCCEEEEECCCCCCH
T ss_conf             72836306999468868999999841621323689995255668788999----973--------456289865568798


Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             9999999987287
Q gi|254780484|r  200 EVLRKAILETINY  212 (212)
Q Consensus       200 ~eL~~~I~~~l~~  212 (212)
                      |+|++.|++.|++
T Consensus       278 d~L~e~i~~~L~l  290 (365)
T COG1163         278 DELKERIWDVLGL  290 (365)
T ss_pred             HHHHHHHHHHHCE
T ss_conf             8999999987481


No 62 
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional
Probab=99.80  E-value=1.7e-18  Score=125.52  Aligned_cols=161  Identities=20%  Similarity=0.363  Sum_probs=125.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCC--CEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897--3798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRK--NLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~--~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      -|+-+|+-.+|||||+.||||-+  ++.. -..=|-|.+.++....     ..++..+.++|.||++.+           
T Consensus         2 IigTAGHVDHGKTsLvkALTG~dtDRL~E-Ek~RGiTIdLGFA~~~-----l~~g~~~g~VDVPGHErF-----------   64 (615)
T PRK10512          2 IIATAGHVDHGKTTLLQAITGVNADRLPE-EKKRGMTIDLGYAYWP-----QPDGRVLGFIDVPGHEKF-----------   64 (615)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCHH-HHHHCCEEEECEEEEE-----CCCCCEEEEEECCCHHHH-----------
T ss_conf             89963654778999999986888656977-8971872771307555-----799978999879983899-----------


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-CCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             8998777766420000011223578875454554321025753-221222211110246899999999997531368986
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS-YQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE  187 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~  187 (212)
                        ...+.+...-.+.+..++.+..+++.|..+..+.+...+++ .++++||+|+++++..+...+++.+.+...+....|
T Consensus        65 --IknMlAG~~gid~vlLVVAAdeGvMPQT~EHl~Il~lLgi~~giV~lTK~Dlvd~e~l~~v~~ei~~~l~~t~l~~~p  142 (615)
T PRK10512         65 --LSNMLAGVGGIDHALLVVACDDGVMAQTREHLAILQLTGNPMLTVALTKADRVDEARIDEVRRQVLEVLREYGFAEAK  142 (615)
T ss_pred             --HHHHHHHHHHCCEEEEEEECCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             --999974464378899999889987723799999999819982899997765689799999999999998447876797


Q ss_pred             EEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             89998888899899999999872
Q gi|254780484|r  188 VIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       188 i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +++|||.+|.||++|++.|.+..
T Consensus       143 i~~vSa~tg~Gi~~L~~~L~~l~  165 (615)
T PRK10512        143 LFVTAATEGRGIDALREHLLQLP  165 (615)
T ss_pred             EEECCCCCCCCHHHHHHHHHHHC
T ss_conf             52014566679999999998625


No 63 
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily.  BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants.  BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well.  The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli.  It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes.  It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes.  In addition, BipA from enteropathogenic E. co
Probab=99.80  E-value=5.7e-18  Score=122.46  Aligned_cols=169  Identities=18%  Similarity=0.220  Sum_probs=113.5

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCC-CEE-------EECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHH
Q ss_conf             68689997489988989999973897-379-------8738884145212026655567850896499997600101112
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRK-NLA-------RTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARA   99 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~-~~a-------~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~   99 (212)
                      |+..|+++|+.++|||||+.+|+..- ...       .+.+.-.-.+..+.+...........+..+.++||||+..+..
T Consensus         1 nIRNv~iiGHvd~GKTTL~~~Ll~~tg~~~~~~~~~~~~~D~~~~E~ergiTI~~~~~~~~~~~~~~n~IDtPGH~dF~~   80 (194)
T cd01891           1 DIRNIAIIAHVDHGKTTLVDALLKQSGTFRENEEVEERVMDSNDLERERGITILAKNTAVTYKDTKINIVDTPGHADFGG   80 (194)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEEECCCHHHHHCCCCEEEEEEEEEECCEEEEEEECCCCHHHHH
T ss_conf             98789999068987999999999974876304652168614758888728763345899998998899998998477777


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             24478988889987777664200000112235788754545543210257532212222111102468999999999975
Q gi|254780484|r  100 PKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR  179 (212)
Q Consensus       100 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~  179 (212)
                                   .........+..+.+.++..+...|...........+.|.++++||+|+.+.+ ..+..+++.+.+.
T Consensus        81 -------------~~~~~~~~~D~ailVVdA~~Gv~~QT~~~l~~a~~~~~~~iv~iNK~D~~~a~-~~~v~~ei~~~~~  146 (194)
T cd01891          81 -------------EVERVLSMVDGVLLLVDASEGPMPQTRFVLKKALELGLKPIVVINKIDRPDAR-PEEVVDEVFDLFI  146 (194)
T ss_pred             -------------HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCC-HHHHHHHHHHHHH
T ss_conf             -------------89877643446789865378975899999999987299749988564589888-9999999999998


Q ss_pred             HCCCC----CCCEEEEECCCC----------CCHHHHHHHHHHHH
Q ss_conf             31368----986899988888----------99899999999872
Q gi|254780484|r  180 NYPTA----HPEVIPTSSVKR----------KGIEVLRKAILETI  210 (212)
Q Consensus       180 ~~~~~----~~~i~~vSA~~g----------~Gi~eL~~~I~~~l  210 (212)
                      .+...    ..|++++||++|          ++|++|.+.|.+.+
T Consensus       147 ~~~~~~~~~~~pii~~SA~~G~~~d~~~~~~~~~~~ll~ai~~~i  191 (194)
T cd01891         147 ELGATEEQLDFPVLYASAKNGWASLNLEDPSEDLEPLFDTIIEHV  191 (194)
T ss_pred             HCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHC
T ss_conf             639993335885787256553357788656465999999999658


No 64 
>KOG2486 consensus
Probab=99.79  E-value=9.7e-20  Score=132.62  Aligned_cols=191  Identities=35%  Similarity=0.431  Sum_probs=142.0

Q ss_pred             EEEEE--CCCHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECC-CCCEEEECCEEEEEEEEEEEECCCEEEEE
Q ss_conf             47862--3656758876686899974899889899999738973798738-88414521202665556785089649999
Q gi|254780484|r   13 IFLRG--VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSN-APGRTQHLNFFVPKDFSNLKNNLPAMALV   89 (212)
Q Consensus        13 ~~~~~--~~~~~~~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~-~p~tt~~~~~~~~~~~~~~~~~~~~~~~~   89 (212)
                      .+-.|  +....+.|+..+|++++.|++|||||||+|-++..+..+.++. +++.|...+++...         ..+.++
T Consensus       118 ~~V~~~~s~~~~D~Pk~~~pe~~~~g~SNVGKSSLln~~~r~k~~~~t~k~K~g~Tq~in~f~v~---------~~~~~v  188 (320)
T KOG2486         118 KRVHGDGSVTAEDCPKDKRPELAFYGRSNVGKSSLLNDLVRVKNIADTSKSKNGKTQAINHFHVG---------KSWYEV  188 (320)
T ss_pred             EEEECCCCCEECCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECC---------CEEEEE
T ss_conf             14422565222247778885266624776227888765432145564037887651132001205---------548998


Q ss_pred             ECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHH--H
Q ss_conf             76001011122447898888998777766420000011223578875454554321025753221222211110246--8
Q gi|254780484|r   90 DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTT--A  167 (212)
Q Consensus        90 DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~--~  167 (212)
                      |.||........+....+......+.........+....+...+....|...++++.+...|.-.|+||||+..+..  .
T Consensus       189 DlPG~~~a~y~~~~~~d~~~~t~~Y~leR~nLv~~FLLvd~sv~i~~~D~~~i~~~ge~~VP~t~vfTK~DK~k~~~~~~  268 (320)
T KOG2486         189 DLPGYGRAGYGFELPADWDKFTKSYLLERENLVRVFLLVDASVPIQPTDNPEIAWLGENNVPMTSVFTKCDKQKKVKRTG  268 (320)
T ss_pred             ECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHEEEEEEECCCCCCCCCHHHHHHHHHCCCCEEEEEEHHHHHHHCCCCC
T ss_conf             46886545678557414767578888726533115666303678899876999887524997388630244555302235


Q ss_pred             HH---HHHH-HHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
Q ss_conf             99---9999-999975313689868999888889989999999987287
Q gi|254780484|r  168 QE---TLEK-TKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETINY  212 (212)
Q Consensus       168 ~~---~~~~-~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~~  212 (212)
                      .+   .+.. ...+.........|-+.+|+.++.|+++|+=.|.+.-+|
T Consensus       269 kKp~~~i~~~f~~l~~~~f~~~~Pw~~~Ssvt~~Grd~Ll~~i~q~~~~  317 (320)
T KOG2486         269 KKPGLNIKINFQGLIRGVFLVDLPWIYVSSVTSLGRDLLLLHIAQLRGY  317 (320)
T ss_pred             CCCCCCCEEEHHHCCCCCEECCCCCEEEECCCCCCCEEEEEEHHHHHCC
T ss_conf             5754001210200150004115870132043425720011016644252


No 65 
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]
Probab=99.79  E-value=1.7e-18  Score=125.42  Aligned_cols=164  Identities=20%  Similarity=0.263  Sum_probs=122.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             66868999748998898999997389737987388841452120266555678508964999976001011122447898
Q gi|254780484|r   27 AGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDS  106 (212)
Q Consensus        27 ~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~  106 (212)
                      ...|-|+++|+..+|||||+.++-+.+..  .....+-|...+.++......   ....+.|+||||+..+.        
T Consensus         3 ~R~PvVtimGHVDHGKTtLLD~IR~t~Va--~~EaGGITQhIGA~~v~~~~~---~~~~itFiDTPGHeAFt--------   69 (509)
T COG0532           3 LRPPVVTIMGHVDHGKTTLLDKIRKTNVA--AGEAGGITQHIGAYQVPLDVI---KIPGITFIDTPGHEAFT--------   69 (509)
T ss_pred             CCCCEEEEECCCCCCCCCHHHHHHCCCCC--CCCCCCEEEEEEEEEEEECCC---CCCEEEEECCCCHHHHH--------
T ss_conf             88988999674358842016667417643--566785001743499986468---86528997489578888--------


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHH-HHHHHHCCCCC
Q ss_conf             88899877776642000001122357887545455432102575322122221111024689999999-99975313689
Q gi|254780484|r  107 WGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKT-KYLIRNYPTAH  185 (212)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~-~~~~~~~~~~~  185 (212)
                           .+........++++++.+..++.++|..+-++.....+.|+++++||+|+.+..-.....+.. .....+.|.+.
T Consensus        70 -----~mRaRGa~vtDIaILVVa~dDGv~pQTiEAI~hak~a~vP~iVAiNKiDk~~~np~~v~~el~~~gl~~E~~gg~  144 (509)
T COG0532          70 -----AMRARGASVTDIAILVVAADDGVMPQTIEAINHAKAAGVPIVVAINKIDKPEANPDKVKQELQEYGLVPEEWGGD  144 (509)
T ss_pred             -----HHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCHHHCCCC
T ss_conf             -----787557754457999997567856617999999987799989998543279988789999887779887661881


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             86899988888998999999998
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      ..++|+||++|+|+++|...|.-
T Consensus       145 v~~VpvSA~tg~Gi~eLL~~ill  167 (509)
T COG0532         145 VIFVPVSAKTGEGIDELLELILL  167 (509)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHH
T ss_conf             49997432478797999999998


No 66 
>TIGR02729 Obg_CgtA GTP-binding protein Obg/CgtA; InterPro: IPR014100   This entry describes a universal, mostly one-gene-per-genome GTP-binding protein that associates with ribosomal subunits and appears to play a role in ribosomal RNA maturation. Mutations in this gene are pleiotropic, but it appears that effects on cellular functions such as chromosome partition may be secondary to the effect on ribosome structure..
Probab=99.78  E-value=3.8e-19  Score=129.21  Aligned_cols=117  Identities=22%  Similarity=0.193  Sum_probs=79.7

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECC----CEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             9997489988989999973897379873888414521202665556785089----649999760010111224478988
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL----PAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~----~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      |+|||.||||||||+|+++++|  ..++++|+||..|+..      ++..++    .++++.|.||+..-.+...-....
T Consensus       161 VGLvGfPNAGKSTLLs~~S~Ak--PKiAdYPFTTL~P~LG------vv~~~~~~Y~~~fviADIPGLIEGAs~G~GLG~~  232 (296)
T TIGR02729       161 VGLVGFPNAGKSTLLSAISNAK--PKIADYPFTTLEPNLG------VVRVDDNKYERSFVIADIPGLIEGASEGKGLGHK  232 (296)
T ss_pred             EEEECCCCCCHHHHHHHHHCCC--CEECCCCCCCCCCCEE------EEEECCCCEEEEEEEEECCCCHHHHHCCCCCCHH
T ss_conf             2103578874688888876278--8223878745653112------8987487416889998568615666268875335


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCC-----C----CHHHHHHHHHH-----CCCCCCCCCCCCCCCCC
Q ss_conf             88998777766420000011223578-----8----75454554321-----02575322122221111
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHG-----V----KQIDQDVFSFL-----DKKAVSYQIVLTKIDKL  162 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~-----~----~~~~~~~~~~~-----~~~~~~~~~v~nK~D~~  162 (212)
                      .-.+      +......++++|....     .    .+....+.+++     ....+|.++|+||||+.
T Consensus       233 FLKH------IERt~~L~hviD~~~~qlSkh~~~~p~~~y~~l~~EL~~Y~~~L~~k~~~iv~NK~Dl~  295 (296)
T TIGR02729       233 FLKH------IERTRLLLHVIDASGIQLSKHDGRDPIEDYETLRNELELYSPELADKPQIIVLNKIDLL  295 (296)
T ss_pred             HHHH------HHHEEEEEEEEECCCCEEEECCCCCHHHHHHHHHHHHHHCCHHHCCCCEEEEEEECCCC
T ss_conf             5457------52026688798068753424289888999999999997508736278079998606778


No 67 
>KOG1145 consensus
Probab=99.75  E-value=1.9e-17  Score=119.50  Aligned_cols=161  Identities=22%  Similarity=0.341  Sum_probs=120.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      .+.+|-|.|||+..+||+||+.+|-+....|.  ...|-|...+.+....     .++..+.|.||||+..+.       
T Consensus       150 ~~RpPVVTiMGHVDHGKTTLLD~lRks~VAA~--E~GGITQhIGAF~V~~-----p~G~~iTFLDTPGHaAF~-------  215 (683)
T KOG1145         150 EPRPPVVTIMGHVDHGKTTLLDALRKSSVAAG--EAGGITQHIGAFTVTL-----PSGKSITFLDTPGHAAFS-------  215 (683)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHCCEEHH--HCCCCCCEECEEEEEC-----CCCCEEEEECCCCHHHHH-------
T ss_conf             88998699860135770019988740722013--2377100002299963-----899778875687478899-------


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC--HHHHHHHHHHHHHHHHHCCC
Q ss_conf             8888998777766420000011223578875454554321025753221222211110--24689999999999753136
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS--PTTAQETLEKTKYLIRNYPT  183 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~--~~~~~~~~~~~~~~~~~~~~  183 (212)
                            .+........+.+..+..+.++.++|..+.+........|+++.+||+|+-.  ++.....+.... ...+-..
T Consensus       216 ------aMRaRGA~vtDIvVLVVAadDGVmpQT~EaIkhAk~A~VpiVvAinKiDkp~a~pekv~~eL~~~g-i~~E~~G  288 (683)
T KOG1145         216 ------AMRARGANVTDIVVLVVAADDGVMPQTLEAIKHAKSANVPIVVAINKIDKPGANPEKVKRELLSQG-IVVEDLG  288 (683)
T ss_pred             ------HHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHCC-CCHHHCC
T ss_conf             ------998626864447999997267756768999998876599789998436789989899999998769-3277707


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             898689998888899899999999
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~  207 (212)
                      ++.+++|+||++|.|++.|.+++.
T Consensus       289 GdVQvipiSAl~g~nl~~L~eail  312 (683)
T KOG1145         289 GDVQVIPISALTGENLDLLEEAIL  312 (683)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHH
T ss_conf             823699865114798689999999


No 68 
>cd01884 EF_Tu EF-Tu subfamily.  This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts.  It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors.  The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family.  EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function.  When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors.  Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=99.74  E-value=4.5e-17  Score=117.30  Aligned_cols=167  Identities=16%  Similarity=0.200  Sum_probs=110.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCC--C-E--EEE---CCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHH
Q ss_conf             89997489988989999973897--3-7--987---38884145212026655567850896499997600101112244
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRK--N-L--ART---SNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKK  102 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~--~-~--a~~---~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~  102 (212)
                      .|+++|+..+|||||..+|+..-  . .  ...   .+..-..+..+.+..............+.++||||+..+.    
T Consensus         4 Ni~iiGHVDhGKTTL~~~l~~~~~~~~~~~~~~~~~~D~~~~EreRGiTI~~~~~~~~~~~~~~~~IDtPGH~dF~----   79 (195)
T cd01884           4 NVGTIGHVDHGKTTLTAAITKVLAKKGGAKFKKYDEIDKAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYI----   79 (195)
T ss_pred             EEEEEEECCCCHHHHHHHHHHHHHHHCCCCCCCCHHCCCCHHHHCCCCCCCCEEEEEECCCEEEEECCCCCHHHHH----
T ss_conf             9999960588698999999998866344441120010054666505886144189996088169962689607788----


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC-CCCCCCCCCHHHHHHHHH-HHHHHHHH
Q ss_conf             7898888998777766420000011223578875454554321025753221-222211110246899999-99999753
Q gi|254780484|r  103 NVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQI-VLTKIDKLSPTTAQETLE-KTKYLIRN  180 (212)
Q Consensus       103 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-v~nK~D~~~~~~~~~~~~-~~~~~~~~  180 (212)
                               ..........+..+.++++..+...|..+........+.+.++ ++||+|++++.+.-+.++ ++.+++..
T Consensus        80 ---------~~~i~g~~~~D~aiLVVdA~eGv~~QT~eh~~la~~lgi~~iiV~iNK~D~~~~~~~~~~v~~ei~~~l~~  150 (195)
T cd01884          80 ---------KNMITGAAQMDGAILVVSATDGPMPQTREHLLLARQVGVPYIVVFLNKADMVDDEELLELVEMEVRELLSK  150 (195)
T ss_pred             ---------HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             ---------89986351136268998527787478999999999809996279996877898789999999999999984


Q ss_pred             CCC--CCCCEEEEECCCCC----------CHHHHHHHHHHHH
Q ss_conf             136--89868999888889----------9899999999872
Q gi|254780484|r  181 YPT--AHPEVIPTSSVKRK----------GIEVLRKAILETI  210 (212)
Q Consensus       181 ~~~--~~~~i~~vSA~~g~----------Gi~eL~~~I~~~l  210 (212)
                      ...  ...+++|+||++|+          |+..|.+.|.+++
T Consensus       151 ~g~~~~~~p~ip~Sa~~g~~~~~~~~~~~~i~~Lldai~~~i  192 (195)
T cd01884         151 YGFDGDNTPIVRGSALKALEGDDPNKWVKKILELLDALDSYI  192 (195)
T ss_pred             CCCCCCCCEEEEEEHHHHHCCCCCCCCCCCHHHHHHHHHHHC
T ss_conf             299955682999773875357888755369999999999648


No 69 
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated
Probab=99.73  E-value=3.9e-17  Score=117.64  Aligned_cols=166  Identities=23%  Similarity=0.300  Sum_probs=115.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCC--EEEECCCCCEEEECCEEEEEE-----------E---------EEEEECCCEEEE
Q ss_conf             899974899889899999738973--798738884145212026655-----------5---------678508964999
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKN--LARTSNAPGRTQHLNFFVPKD-----------F---------SNLKNNLPAMAL   88 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~--~a~~~~~p~tt~~~~~~~~~~-----------~---------~~~~~~~~~~~~   88 (212)
                      .|+.+|+..+|||||+.||+|-..  .... ..-+.|...++.....           +         .........+.+
T Consensus        10 NIgtiGHVDHGKTTLv~aLTg~~tdr~~eE-~~RGiTI~LG~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~is~   88 (410)
T PRK04000         10 NIGMVGHVDHGKTTLVQALTGVWTDTHSEE-LKRGITIRLGYADATIYKCPNCEGPEAYTTEPTCPKCGSETELLRRVSF   88 (410)
T ss_pred             EEEEEEEECCCHHHHHHHHHCCCCCCCHHH-HHCCCCCCCCCCCEEHHCCCCCCCCCCEEEECCCCCCCCCCCCCCEEEE
T ss_conf             699996517869999988739754238878-8648812105101001205455544413530233444555443316999


Q ss_pred             EECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC-CHHHHHHHHHHCCCCCC-CCCCCCCCCCCCHHH
Q ss_conf             9760010111224478988889987777664200000112235788-75454554321025753-221222211110246
Q gi|254780484|r   89 VDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGV-KQIDQDVFSFLDKKAVS-YQIVLTKIDKLSPTT  166 (212)
Q Consensus        89 ~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~-~~~v~nK~D~~~~~~  166 (212)
                      +|+||+..+-             ..+.......+.+++++++..+. ..|..+....+...+++ .++++||+|+++++.
T Consensus        89 VD~PGHe~fi-------------~nMi~Gas~~D~alLVVaA~eG~p~pQT~EHl~i~~~lgi~~~iV~lnK~Dlv~~e~  155 (410)
T PRK04000         89 VDAPGHETLM-------------ATMLSGAALMDGAVLVIAANEPCPQPQTKEHLMALDIIGIKNIVIVQNKIDLVSKEK  155 (410)
T ss_pred             EECCCHHHHH-------------HHHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEECCCCCCHHH
T ss_conf             9798879999-------------999840212667999986577876771499999999809983799996256789899


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             89999999999753136898689998888899899999999872
Q gi|254780484|r  167 AQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       167 ~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ..+..+++.+.+..+.....|++|+||.+|.||+.|++.|.+.+
T Consensus       156 ~~~~~~ei~~~l~g~~~~~~piipvSa~~g~~i~~L~~~l~~~~  199 (410)
T PRK04000        156 ALENYEQIKEFVKGTVAENAPIIPVSALHGVNIDALIEAIEEEI  199 (410)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHC
T ss_conf             99999999998706765689999964777889408999898627


No 70 
>pfam00025 Arf ADP-ribosylation factor family. Pfam combines a number of different Prosite families together
Probab=99.73  E-value=2.8e-17  Score=118.48  Aligned_cols=157  Identities=15%  Similarity=0.142  Sum_probs=93.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      .-.+|.++|.+|||||||++++.+.+. ..  ..|+..  .+      .......+..+.++||+|.......-      
T Consensus        13 k~~Ki~llG~~~vGKTsll~~~~~~~~-~~--~~pTig--~~------~~~v~~~~~~~~iwDt~Gqe~~~~~~------   75 (174)
T pfam00025        13 KEMRILILGLDNAGKTTILYKLKLGEI-VT--TIPTIG--FN------VETVTYKNVKFTVWDVGGQESLRPLW------   75 (174)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHCCCC-CC--CCCCCC--CE------EEEEEECCEEEEEEECCCCCCCCHHH------
T ss_conf             666999999999988999999954998-87--447468--23------89999899999998279870232679------


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCC--HHHHHH---HHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             8899877776642000001122357887--545455---43210257532212222111102468999999999975313
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVK--QIDQDV---FSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP  182 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~---~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~  182 (212)
                          ..+   ......++++.|......  .....+   .........|++++.||+|+.+.....+..+....  ....
T Consensus        76 ----~~y---~~~a~~ii~V~D~t~~~s~~~~~~~l~~~l~~~~~~~~piliv~NK~DL~~~~~~~ei~~~~~~--~~~~  146 (174)
T pfam00025        76 ----RNY---FPNTDAVIFVVDSADRDRIEEAKEELHALLNEEELADAPLLILANKQDLPGAMSEAEIRELLGL--HELK  146 (174)
T ss_pred             ----HHH---HCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHHHH--HHCC
T ss_conf             ----988---4178268999867867879999999999875423589708998725667678999999999978--6441


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             6898689998888899899999999872
Q gi|254780484|r  183 TAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       183 ~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ....+++++||++|+||+|+.++|.+.+
T Consensus       147 ~~~~~~~~~SAktG~gI~e~f~~L~~~I  174 (174)
T pfam00025       147 SRPWEIQGCSAVTGEGLDEGLDWLSNYI  174 (174)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             7996899998867959899999999539


No 71 
>TIGR01393 lepA GTP-binding protein LepA; InterPro: IPR006297   LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function of the proteins in this family are unknown. ; GO: 0005525 GTP binding.
Probab=99.73  E-value=1.8e-17  Score=119.55  Aligned_cols=164  Identities=18%  Similarity=0.173  Sum_probs=114.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCE---------------EEECCEEEEEEEEEEEECCCEEEEEECC
Q ss_conf             6868999748998898999997389737987388841---------------4521202665556785089649999760
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGR---------------TQHLNFFVPKDFSNLKNNLPAMALVDMP   92 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~t---------------t~~~~~~~~~~~~~~~~~~~~~~~~Dtp   92 (212)
                      ++.-.+|+-|-.+|||||--+|...-.  .++..--+               |-..+..+.............+.|+|||
T Consensus         2 ~IRNFsIIAHIDHGKSTLADRlle~T~--~~s~R~m~~Q~LD~MDlERERGITIK~qaV~l~Yk~~~DGe~Y~LNLIDTP   79 (598)
T TIGR01393         2 NIRNFSIIAHIDHGKSTLADRLLEKTG--AVSEREMREQVLDSMDLERERGITIKAQAVRLKYKVAKDGETYVLNLIDTP   79 (598)
T ss_pred             CCCCEEEEEEECCCCCHHHHHHHHHCC--CCCCHHHHHCCCCCCCEEECCCCEEECCCEEEEEEEECCCCEEEEEEECCC
T ss_conf             875267884624893248899998617--456202543057751000005820115634753375338878899645288


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             01011122447898888998777766420000011223578875454554321025753221222211110246899999
Q gi|254780484|r   93 GYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLE  172 (212)
Q Consensus        93 G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~  172 (212)
                      ||-++..             ...+..+.+-..++++|+.++...|.....-...+.+.-+++|+||+|+ +..+.+...+
T Consensus        80 GHVDFsY-------------EVSRSLAACEGALL~VDA~QGvEAQT~aN~YlAlE~dLeIIPViNKIDL-P~Adpe~v~~  145 (598)
T TIGR01393        80 GHVDFSY-------------EVSRSLAACEGALLLVDAAQGVEAQTLANVYLALENDLEIIPVINKIDL-PSADPERVKK  145 (598)
T ss_pred             CCCCCCH-------------HHHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEECCCCC-CCCCHHHHHH
T ss_conf             9721273-------------7888888716403561410323588899998875618758477825368-8888589999


Q ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             99999753136898689998888899899999999872
Q gi|254780484|r  173 KTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       173 ~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ++.+.   ....-.+++.+|||+|.||++|+++|.+.+
T Consensus       146 eIe~~---iGld~~~ai~~SAKtG~Gi~e~LEaIv~~v  180 (598)
T TIGR01393       146 EIEEV---IGLDASEAILASAKTGIGIEEILEAIVKRV  180 (598)
T ss_pred             HHHHH---CCCCCCCCEEEEECCCCCHHHHHHHHHHCC
T ss_conf             87654---188964303875036788899988971018


No 72 
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=99.73  E-value=4.4e-17  Score=117.36  Aligned_cols=154  Identities=16%  Similarity=0.245  Sum_probs=92.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.+|||||||+|++++.+.....  .||..  ..+      .........+.++||+|.......          
T Consensus         1 ~I~llG~~~~GKTsll~~~~~~~f~~~~--~pTig--~~~------~~i~~~~~~l~iwDt~G~e~~~~l----------   60 (159)
T cd04159           1 EITLVGLQNSGKTTLVNVIAGGQFSEDT--IPTVG--FNM------RKVTKGNVTLKVWDLGGQPRFRSM----------   60 (159)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCCCCCC--CCCCC--EEE------EEEEECCEEEEEEECCCHHHHHHH----------
T ss_conf             9899999998699999999759998861--67325--058------999989999999979835877999----------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHH-----HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             987777664200000112235788754-----545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQI-----DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                      ...+   .......+++.|......-.     ...+.........|++++.||+|+.+.....+..+....  .......
T Consensus        61 ~~~y---~~~~~~ii~V~D~sd~~s~~~~~~~l~~~~~~~~~~~~piliv~NK~Dl~~~~~~~~i~~~~~~--~~~~~~~  135 (159)
T cd04159          61 WERY---CRGVNAIVYVVDAADRTALEAAKNELHDLLEKPSLEGIPLLVLGNKNDLPGALSVDELIEQMNL--KSITDRE  135 (159)
T ss_pred             HHHH---HCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHHHH--HHHHCCC
T ss_conf             9987---4686368751577878899999999999985443489828988835676434789999999999--9873499


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             868999888889989999999987
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      .+++++||++|.||+++.++|.++
T Consensus       136 ~~~~~~SAktg~gI~e~f~wL~~~  159 (159)
T cd04159         136 VSCYSISCKEKTNIDIVLDWLIKH  159 (159)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHCC
T ss_conf             879999796896989999999659


No 73 
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=99.73  E-value=3.5e-17  Score=117.94  Aligned_cols=157  Identities=16%  Similarity=0.252  Sum_probs=94.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             66868999748998898999997389737987388841452120266555678508964999976001011122447898
Q gi|254780484|r   27 AGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDS  106 (212)
Q Consensus        27 ~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~  106 (212)
                      ...|+|+++|.+|||||||+|++++.+. ..  ..|+..  .+      ......++..+.+.|++|.......      
T Consensus        12 ~~~~Ki~ilG~~~sGKTsll~~l~~~~~-~~--~~pT~g--~~------~~~v~~~~~~~~lwD~~G~~~~~~~------   74 (173)
T cd04155          12 SEEPRILILGLDNAGKTTILKQLASEDI-SH--ITPTQG--FN------IKTVQSDGFKLNVWDIGGQRAIRPY------   74 (173)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCC-CC--CCCCCC--EE------EEEEEECCEEEEEEECCCCHHHHHH------
T ss_conf             8775899997999988999999856998-66--068113--23------7999989999999855875101268------


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCC--HHH---HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             88899877776642000001122357887--545---4554321025753221222211110246899999999997531
Q gi|254780484|r  107 WGGLIVRYLSERSTLRCVYLLIDCRHGVK--QID---QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY  181 (212)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~---~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~  181 (212)
                      .    ..+   .......+++.|......  +..   ............|++++.||+|+......++..+.+..  ...
T Consensus        75 ~----~~y---~~~a~~iI~VvD~td~~~~~~~~~~l~~~l~~~~~~~~PiLiv~NK~Dl~~a~~~~eI~~~l~l--~~~  145 (173)
T cd04155          75 W----RNY---FENTDCLIYVIDSADKKRLEEAGAELVELLEEEKLAGVPVLVFANKQDLATAAPAEEIAEALNL--HDL  145 (173)
T ss_pred             H----HHH---CCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHHHCH--HHC
T ss_conf             9----976---5556379999966756889999999999974130069838999976667778999999998587--643


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             3689868999888889989999999987
Q gi|254780484|r  182 PTAHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       182 ~~~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      ......++++||++|+||+|..+.|.+.
T Consensus       146 ~~~~~~i~~~SA~tG~Gi~E~f~WL~~n  173 (173)
T cd04155         146 RDRTWHIQACSAKTGEGLQEGMNWVCKN  173 (173)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHCC
T ss_conf             4887589995785793989999998549


No 74 
>KOG1490 consensus
Probab=99.73  E-value=1.4e-17  Score=120.27  Aligned_cols=177  Identities=19%  Similarity=0.245  Sum_probs=112.9

Q ss_pred             CHHHCC--CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHH
Q ss_conf             567588--766868999748998898999997389737987388841452120266555678508964999976001011
Q gi|254780484|r   20 EIGLLP--KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYA   97 (212)
Q Consensus        20 ~~~~~P--~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~   97 (212)
                      .++++|  .++-++..++|+|||||||++|.++.++.  .+-++++||...-.      +.....-..+..+||||+...
T Consensus       157 hl~rlPsIDp~trTlllcG~PNVGKSSf~~~vtradv--evqpYaFTTksL~v------GH~dykYlrwQViDTPGILD~  228 (620)
T KOG1490         157 HLSRLPAIDPNTRTLLVCGYPNVGKSSFNNKVTRADD--EVQPYAFTTKLLLV------GHLDYKYLRWQVIDTPGILDR  228 (620)
T ss_pred             HHHCCCCCCCCCCEEEEECCCCCCCHHHCCCCCCCCC--CCCCCCCCCCHHHH------HHHHHHEEEEEECCCCCCCCC
T ss_conf             9854787788867179852788773764355201555--55776655101210------020324023440388412476


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC--CCCC-HHHHHHHHHHC--CCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             1224478988889987777664200000112235--7887-54545543210--25753221222211110246899999
Q gi|254780484|r   98 RAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR--HGVK-QIDQDVFSFLD--KKAVSYQIVLTKIDKLSPTTAQETLE  172 (212)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~-~~~~~~~~~~~--~~~~~~~~v~nK~D~~~~~~~~~~~~  172 (212)
                      .....+.............-    ..+++..|.+  .+.. .....++..+.  -...|+++|+||+|.+.+++..+.-.
T Consensus       229 plEdrN~IEmqsITALAHLr----aaVLYfmDLSe~CGySva~QvkLfhsIKpLFaNK~~IlvlNK~D~m~~edL~~~~~  304 (620)
T KOG1490         229 PEEDRNIIEMQIITALAHLR----SAVLYFMDLSEMCGYSVAAQVKLYHSIKPLFANKVTILVLNKIDAMRPEDLDQKNQ  304 (620)
T ss_pred             CHHHHHHHHHHHHHHHHHHH----HHHEEEEECHHHHCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHH
T ss_conf             05432179999999998756----56411343221208889999999987678862884699952002568656687889


Q ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             99999753136898689998888899899999999872
Q gi|254780484|r  173 KTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       173 ~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ++-+.+..  .+..+++..|+.+-+|+..++..-++.|
T Consensus       305 ~ll~~~~~--~~~v~v~~tS~~~eegVm~Vrt~ACe~L  340 (620)
T KOG1490         305 ELLQTIID--DGNVKVVQTSCVQEEGVMDVRTTACEAL  340 (620)
T ss_pred             HHHHHHHH--CCCCEEEEECCCCHHCEEEHHHHHHHHH
T ss_conf             99999886--0483388732554002000777899999


No 75 
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=99.72  E-value=6.2e-17  Score=116.47  Aligned_cols=155  Identities=16%  Similarity=0.203  Sum_probs=92.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      .-.+|.++|.+|||||||+|++++.+. ..+.++.|..          .......+..+.++||+|.......-..    
T Consensus        13 ~~~KililG~~~sGKTsll~~l~~~~~-~~~~pT~G~~----------~~~~~~~~~~l~iwD~~G~e~~~~~~~~----   77 (173)
T cd04154          13 REMRILILGLDNAGKTTILKKLLGEDI-DTISPTLGFQ----------IKTLEYEGYKLNIWDVGGQKTLRPYWRN----   77 (173)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHCCCCC-CCCCCCCCEE----------EEEEEECCEEEEEEECCCCCCCCHHHHH----
T ss_conf             731899998999788999999839998-9726705777----------8999989999999966886020058999----


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCC--HHHHH---HHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             8899877776642000001122357887--54545---543210257532212222111102468999999999975313
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVK--QIDQD---VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP  182 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~---~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~  182 (212)
                            +   ......++++.|......  .....   ..........|++++.||+|+.+.....+..+....  ....
T Consensus        78 ------y---~~~a~~ii~VvD~td~~~~~~~~~~l~~ll~~~~~~~~pili~~NK~Dl~~~~~~~ei~~~l~l--~~~~  146 (173)
T cd04154          78 ------Y---FESTDALIWVVDSSDRLRLDDCKRELKELLQEERLAGATLLILANKQDLPGALSEEEIREALEL--DKIS  146 (173)
T ss_pred             ------H---HCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHHHHH--HHCC
T ss_conf             ------7---2266538999855657889999999999986354159847999876567778899999999868--7445


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             68986899988888998999999998
Q gi|254780484|r  183 TAHPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       183 ~~~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      .....++++||++|+||+++.++|.+
T Consensus       147 ~~~~~~~~~SAktG~gI~e~f~wL~~  172 (173)
T cd04154         147 SHHWRIQPCSAVTGEGLLQGIDWLVD  172 (173)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHC
T ss_conf             79829999889669298999999864


No 76 
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=99.71  E-value=8.2e-17  Score=115.80  Aligned_cols=160  Identities=15%  Similarity=0.150  Sum_probs=91.3

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99974899889899999738973798738884145212026655567850896499997600101112244789888899
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLI  111 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~  111 (212)
                      |.++|.+|||||||+|++............+..+.+.+    .........+..+.++||+|.......-          
T Consensus         2 ivilG~~~~GKTsll~~l~~~~~~~~~~~~~~~~~Tvg----~~~~~i~~~~~~l~iwD~~Gqe~~~~l~----------   67 (167)
T cd04160           2 VLILGLDNAGKTTFLEQLKTLFSKYKGLPPSKITPTVG----LNIGTIEVGNARLKFWDLGGQESLRSLW----------   67 (167)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC----EEEEEEEECCEEEEEEECCCCHHHHHHH----------
T ss_conf             99999999888899998875036767776554035313----2689999899999999689878887899----------


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCHH--HH---HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             87777664200000112235788754--54---55432102575322122221111024689999999999753136898
Q gi|254780484|r  112 VRYLSERSTLRCVYLLIDCRHGVKQI--DQ---DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP  186 (212)
Q Consensus       112 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~---~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (212)
                      ..+   .......+++.|......-.  ..   ...........|++++.||+|+-+....++..+..............
T Consensus        68 ~~y---~~~a~~ii~VvD~sd~~~~~~~~~~l~~~~~~~~~~~~pili~~NK~Dl~~~~~~~ei~~~~~~~~~~~~~~~~  144 (167)
T cd04160          68 DKY---YAECHAIIYVIDSTDRERFEESKSALEKVLRNEALEGVPLLILANKQDLPDALSVEEIKEVFQDKAEEIGRRDC  144 (167)
T ss_pred             HHH---CCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCC
T ss_conf             874---28987899998668678899999999997511024896299997066766577899999999999998546998


Q ss_pred             CEEEEECCCCCCHHHHHHHHHH
Q ss_conf             6899988888998999999998
Q gi|254780484|r  187 EVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       187 ~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      .++++||++|+|+++..++|.+
T Consensus       145 ~~~~~SAktG~Gv~e~f~wL~~  166 (167)
T cd04160         145 LVLPVSALEGTGVREGIEWLVE  166 (167)
T ss_pred             EEEEEECCCCCCHHHHHHHHHC
T ss_conf             9999887829498999999965


No 77 
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=99.70  E-value=8.4e-17  Score=115.73  Aligned_cols=152  Identities=17%  Similarity=0.221  Sum_probs=91.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|.++|.+|||||||++++.+.+. .  ...||.  ..+      ..........+.++||+|.......-.        
T Consensus         1 Ki~ilG~~~vGKTsll~~l~~~~~-~--~~~pTi--g~~------~~~i~~~~~~l~iwDt~G~~~~~~~~~--------   61 (158)
T cd00878           1 RILILGLDGAGKTTILYKLKLGEV-V--TTIPTI--GFN------VETVEYKNVSFTVWDVGGQDKIRPLWK--------   61 (158)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCC-C--CCCCEE--CCC------EEEEEECCEEEEEEECCCCCCCCHHHH--------
T ss_conf             999999999988999999953998-8--744560--740------899984889999998899722144899--------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCC--HHHHH---HHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9877776642000001122357887--54545---543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVK--QIDQD---VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~---~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                        .+   ......++++.|......  .....   ..........|++++.||+|+.+.....+..+....  .......
T Consensus        62 --~y---~~~a~~~i~V~D~t~~~s~~~~~~~~~~~~~~~~~~~~piliv~NK~Dl~~~~~~~ei~~~l~~--~~~~~~~  134 (158)
T cd00878          62 --HY---YENTNGIIFVVDSSDRERIEEAKEELHKLLNEEELKGVPLLIFANKQDLPGALSVSELIEKLGL--EKILGRR  134 (158)
T ss_pred             --HH---HCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHH--HHHCCCC
T ss_conf             --87---2768776899837988899999999999986605576538987605476657899999999858--7510799


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             86899988888998999999998
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      ..++++||++|+||+|+.++|.+
T Consensus       135 ~~~~~~SAktg~gI~e~f~~L~e  157 (158)
T cd00878         135 WHIQPCSAVTGDGLDEGLDWLLQ  157 (158)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHC
T ss_conf             89999988879298999999956


No 78 
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional
Probab=99.69  E-value=7e-16  Score=110.44  Aligned_cols=167  Identities=20%  Similarity=0.279  Sum_probs=116.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEE-EECCCCCEEEECCEEEEEE-----------E----------------EEEEEC
Q ss_conf             89997489988989999973897379-8738884145212026655-----------5----------------678508
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLA-RTSNAPGRTQHLNFFVPKD-----------F----------------SNLKNN   82 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a-~~~~~p~tt~~~~~~~~~~-----------~----------------~~~~~~   82 (212)
                      .|+.+|+..+|||||+.||+|-...- .....-+-|...++.....           +                +.....
T Consensus        39 NIGtiGHVDHGKTTLvkALTgv~t~r~~eE~~RgiTI~LGya~~kiykc~~~~~p~~y~~~~s~~~~~~~c~~c~~~~t~  118 (460)
T PTZ00327         39 NIGTIGHVAHGKSTVVKALSGVKTVRFHREKVRNITIKLGYANAKIYKCTKCPPPACYKSYPSSKPDNPQCPGCGHKMTL  118 (460)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCHHHCHHHHHCCCEEEECCCCEEEECCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCC
T ss_conf             89887462898999999986775010656787587212054330111365677631010146666555445555654312


Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC-CHHHHHHHHHHCCCCCC-CCCCCCCCC
Q ss_conf             9649999760010111224478988889987777664200000112235788-75454554321025753-221222211
Q gi|254780484|r   83 LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGV-KQIDQDVFSFLDKKAVS-YQIVLTKID  160 (212)
Q Consensus        83 ~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~-~~~v~nK~D  160 (212)
                      ...+.++|.||+..+             ...+.......+..++++.+..+. ..|..+....+...+.+ .++++||+|
T Consensus       119 ~Rh~s~VDcPGH~~l-------------~~nmi~Ga~~mD~aiLvvaa~eg~P~pQT~EHl~~~~~~gi~~~iv~~nK~D  185 (460)
T PTZ00327        119 KRHVSFVDCPGHDIL-------------MATMLNGAAVMDAALLLIAANESCPQPQTSEHLAAVEIMKLKHIIILQNKID  185 (460)
T ss_pred             CEEEEEEECCCHHHH-------------HHHHHHCHHHCCEEEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             204899868987999-------------9998747633767999998688887646899999999728971999953544


Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             11024689999999999753136898689998888899899999999872
Q gi|254780484|r  161 KLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ++++++..+..+++++.+..+.....|++|+||..+.|++.|.+.|.+.+
T Consensus       186 lV~~e~~~~~~~ei~~~l~~t~~~~~PIIpvSA~~~~nid~L~~~i~~~i  235 (460)
T PTZ00327        186 LIKEVQALDQYEEIRNFIDGTIAENAPIIPISAQLKYNIDVLLEYICTQI  235 (460)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCEEECCHHHCCCHHHHHHHHHHHC
T ss_conf             55889999999999998525767799987565445058799999999758


No 79 
>cd04165 GTPBP1_like GTPBP1-like.  Mammalian GTP binding protein 1 (GTPBP1), GTPBP2, and nematode homologs AGP-1 and CGP-1 are GTPases whose specific functions remain unknown.  In mouse, GTPBP1 is expressed in macrophages, in smooth muscle cells of various tissues and in some neurons of the cerebral cortex; GTPBP2 tissue distribution appears to overlap that of GTPBP1.  In human leukemia and macrophage cell lines, expression of both GTPBP1 and GTPBP2 is enhanced by interferon-gamma (IFN-gamma).  The chromosomal location of both genes has been identified in humans, with GTPBP1 located in chromosome 22q12-13.1 and GTPBP2 located in chromosome 6p21-12.  Human glioblastoma multiforme (GBM), a highly-malignant astrocytic glioma and the most common cancer in the central nervous system, has been linked to chromosomal deletions and a translocation on chromosome 6.  The GBM translocation results in a fusion of GTPBP2 and PTPRZ1, a protein involved in oligodendrocyte differentiation, recovery, and
Probab=99.66  E-value=3.4e-15  Score=106.48  Aligned_cols=167  Identities=19%  Similarity=0.272  Sum_probs=109.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCE-----EEE-------CCCCCEEEECC------------------EEEEEEEEEEE
Q ss_conf             8999748998898999997389737-----987-------38884145212------------------02665556785
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNL-----ART-------SNAPGRTQHLN------------------FFVPKDFSNLK   80 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~-----a~~-------~~~p~tt~~~~------------------~~~~~~~~~~~   80 (212)
                      +|+++|+..+|||||+-+|+....-     +..       .-..|.|....                  ...........
T Consensus         1 Rv~v~GhVD~GKSTL~G~Lt~g~lDdGrg~ar~~~~rh~hE~~~G~Tssi~~~~lgf~~~g~~~~~~~~~~~~~~~~~~~   80 (224)
T cd04165           1 RVAVVGNVDAGKSTLLGVLTQGELDNGRGKARLNLFRHKHEVESGRTSSVSNEILGFDSDGEVVNYPDNHLSESDIEICE   80 (224)
T ss_pred             CEEEEECCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCEECCCCCCCCCCCEEEEC
T ss_conf             98999485884889999985677422210677787761899972654411565540101453202134765442201213


Q ss_pred             ECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             08964999976001011122447898888998777766420000011223578875454554321025753221222211
Q gi|254780484|r   81 NNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKID  160 (212)
Q Consensus        81 ~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D  160 (212)
                      .....+.++|+||+..+...  ..         ........+..+.++++..+...+..+....+...++|+++++||+|
T Consensus        81 ~~~k~it~iD~pGH~~y~kt--~i---------~G~~~~~~d~~~LvV~A~~G~~~~T~ehl~l~~~l~ip~~vvitKiD  149 (224)
T cd04165          81 KSSKLVTFIDLAGHERYLKT--TL---------FGLTGYAPDYAMLVVAANAGIIGMTKEHLGLALALNIPVFVVVTKID  149 (224)
T ss_pred             CCCCEEEEEECCCHHHHHHH--HH---------HHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             67867999978873999999--99---------87635568989999317889779999999999983999899998977


Q ss_pred             CCCHHHHHHHHHHHHHHHHHC-----------------------CCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             110246899999999997531-----------------------368986899988888998999999998
Q gi|254780484|r  161 KLSPTTAQETLEKTKYLIRNY-----------------------PTAHPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~-----------------------~~~~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      ++++...++.+++++..++..                       +....|+|.+|+.+|+|++.|+..|..
T Consensus       150 l~~~~~l~~~~~~i~~~lk~p~~~k~p~~v~~~~d~~~~a~~~~~~~ivPIf~vS~VtG~Gi~~L~~fL~~  220 (224)
T cd04165         150 LAPANILQETLKDLKRILKVPGVRKLPVPVKSDDDVVLAASNFSSERIVPIFQVSNVTGEGLDLLHAFLNL  220 (224)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCEECCCHHHHHHHHHCCCCCCCCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             68989999999999999704475568702168588999986488677746799765898799999999987


No 80 
>pfam00071 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ral, Ran, Rap Ypt1 and more. Shares P-loop motif with GTP_EFTU, arf and myosin_head. See pfam00009 pfam00025, pfam00063. As regards Rab GTPases, these are important regulators of vesicle formation, motility and fusion. They share a fold in common with all Ras GTPases: this is a six-stranded beta-sheet surrounded by five alpha-helices.
Probab=99.66  E-value=1.1e-15  Score=109.31  Aligned_cols=156  Identities=17%  Similarity=0.122  Sum_probs=85.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+|++.+.+..  ....|+.....    .............+.++||+|.......          
T Consensus         1 Ki~vvG~~~vGKTsli~r~~~~~f~--~~~~~t~~~~~----~~~~~~~~~~~~~~~i~Dt~G~e~~~~~----------   64 (162)
T pfam00071         1 KLVLVGDGGVGKSSLLIRFTQNKFP--EEYIPTIGVDF----YTKTIEVDGKTVKLQIWDTAGQERFRAL----------   64 (162)
T ss_pred             CEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCEEEE----EEEEEEECCEEEEEEEEECCCCHHHHHH----------
T ss_conf             9899997997799999999619999--87477413556----7899999999999999978987204678----------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCH-HHHHHHH---HHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             98777766420000011223578875-4545543---2102575322122221111024689999999999753136898
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQ-IDQDVFS---FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP  186 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~---~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (212)
                      ....   ....+..+++.+......- ......+   .......|++++.||+|+.....+.  .++.++....+   +.
T Consensus        65 ~~~~---~~~ad~~iivfd~~~~~S~~~i~~~~~~i~~~~~~~~piilvgnK~Dl~~~~~i~--~~e~~~~a~~~---~~  136 (162)
T pfam00071        65 RPLY---YRGAQGFLLVYDITSRDSFENVKKWLEEILRHADDNVPIVLVGNKCDLEDQRVVS--TEEGEALAKEL---GL  136 (162)
T ss_pred             HHHH---HCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHCCCCC--HHHHHHHHHHH---CC
T ss_conf             8998---6257655042348988999999999999998579886288997524746518899--99999999980---99


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             689998888899899999999872
Q gi|254780484|r  187 EVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       187 ~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +++++||++|.||+++++.|.+.+
T Consensus       137 ~y~e~Sak~g~gI~~~F~~i~~~i  160 (162)
T pfam00071       137 PFMETSAKTNENVEEAFEELAREI  160 (162)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             799973788829999999999996


No 81 
>KOG0462 consensus
Probab=99.65  E-value=1.1e-15  Score=109.22  Aligned_cols=174  Identities=18%  Similarity=0.182  Sum_probs=119.5

Q ss_pred             CHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEE-------EECCCCCEEEECCEEEEEEEEEEEECC---CEEEEE
Q ss_conf             5675887668689997489988989999973897379-------873888414521202665556785089---649999
Q gi|254780484|r   20 EIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLA-------RTSNAPGRTQHLNFFVPKDFSNLKNNL---PAMALV   89 (212)
Q Consensus        20 ~~~~~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a-------~~~~~p~tt~~~~~~~~~~~~~~~~~~---~~~~~~   89 (212)
                      .++..|.+++..++|+-+..+|||||..+|+..--..       ...+.-...+..+.+.-.....+....   .-+.++
T Consensus        51 ~~~~~P~~~iRNfsIIAHVDHGKSTLaDrLLe~tg~i~~~~~q~q~LDkl~vERERGITIkaQtasify~~~~~ylLNLI  130 (650)
T KOG0462          51 EFSLDPVENIRNFSIIAHVDHGKSTLADRLLELTGTIDNNIGQEQVLDKLQVERERGITIKAQTASIFYKDGQSYLLNLI  130 (650)
T ss_pred             CCCCCCHHHCCCEEEEEEECCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEEEEEECCCCEEEEEE
T ss_conf             00139066313137999842770168999999828778887556642454456652847875123799975873288750


Q ss_pred             ECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             76001011122447898888998777766420000011223578875454554321025753221222211110246899
Q gi|254780484|r   90 DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQE  169 (212)
Q Consensus        90 DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~  169 (212)
                      ||||+-++...-..             ....+..++.+.|+..+...|....+....+.+..++.|+||+|+-. .+.+.
T Consensus       131 DTPGHvDFs~EVsR-------------slaac~G~lLvVDA~qGvqAQT~anf~lAfe~~L~iIpVlNKIDlp~-adpe~  196 (650)
T KOG0462         131 DTPGHVDFSGEVSR-------------SLAACDGALLVVDASQGVQAQTVANFYLAFEAGLAIIPVLNKIDLPS-ADPER  196 (650)
T ss_pred             CCCCCCCCCCEEHE-------------HHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCC-CCHHH
T ss_conf             58985555410001-------------26535715999976768128899999999985974888653157898-89899


Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             99999999753136898689998888899899999999872
Q gi|254780484|r  170 TLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ....+.+.+   .....+++.+||++|+|+++|.++|.+++
T Consensus       197 V~~q~~~lF---~~~~~~~i~vSAK~G~~v~~lL~AII~rV  234 (650)
T KOG0462         197 VENQLFELF---DIPPAEVIYVSAKTGLNVEELLEAIIRRV  234 (650)
T ss_pred             HHHHHHHHH---CCCCCCEEEEEECCCCCHHHHHHHHHHHC
T ss_conf             999999986---68961248887025756888999999637


No 82 
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily.  Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice.  This isoform is associated with membrane ruffles and promotes macropinosome formation.  Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further re
Probab=99.64  E-value=6.9e-16  Score=110.48  Aligned_cols=158  Identities=15%  Similarity=0.073  Sum_probs=87.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+++++..+..  ..-.|+....    ..............+.++||+|.+..........     
T Consensus         2 KivlvGd~~VGKTsli~r~~~~~f~--~~y~~Tig~d----~~~k~~~v~~~~~~l~iwDtaGqe~f~~l~~~y~-----   70 (170)
T cd04108           2 KVIVVGDLSVGKTCLINRFCKDVFD--KNYKATIGVD----FEMERFEILGVPFSLQLWDTAGQERFKCIASTYY-----   70 (170)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCCCEE----EEEEEEEECCEEEEEEEEECCCCCCCCCCHHHHH-----
T ss_conf             8999998998989999999639889--9725634505----8999999999999999998999974664437773-----


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCC--HHHHH---HHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9877776642000001122357887--54545---543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVK--QIDQD---VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~---~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                              ......+.+.+......  .....   ..........+++++.||+|+..+.+.....++..+....   .+
T Consensus        71 --------r~a~~~ilvyDvt~~~Sf~~~~~w~~~~~~~~~~~~~~i~LvgNK~DL~~~~~~~~~~~~~~~~a~~---~~  139 (170)
T cd04108          71 --------RGAQAIIIVFDLTDVASLEHTRQWLEDALKENDPSSVLLFLVGTKKDLSSPAQYALMEQDAIKLAAE---MQ  139 (170)
T ss_pred             --------CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCEEEEEHHHHHHHHHH---CC
T ss_conf             --------2787589999789878999999999999985089998299999841379875576448999999987---79


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++.+||++|.||+++.+.|.+.+
T Consensus       140 ~~~~E~SAk~g~nV~e~F~~ia~~~  164 (170)
T cd04108         140 AEYWSVSALSGENVREFFFRVAALT  164 (170)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             8799985578818799999999999


No 83 
>PRK12317 elongation factor 1-alpha; Reviewed
Probab=99.63  E-value=8e-15  Score=104.36  Aligned_cols=160  Identities=15%  Similarity=0.230  Sum_probs=102.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHH---CC------------------CC--EEEECCCCCEEEECCEEEEEEEEEEEECCCEE
Q ss_conf             689997489988989999973---89------------------73--79873888414521202665556785089649
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILV---NR------------------KN--LARTSNAPGRTQHLNFFVPKDFSNLKNNLPAM   86 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~---g~------------------~~--~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~   86 (212)
                      ..|+++|+.++|||||+-+|+   |.                  ..  .+-..+.....+..+.+.......+......+
T Consensus         8 l~i~~~GhVD~GKSTL~G~Ll~~~g~~~~~~~~~~~~~~~~~g~~s~~~a~~~D~~~eEr~rGiTid~~~~~f~~~~~~~   87 (426)
T PRK12317          8 LNLAVIGHVDHGKSTLVGRLLYETGAVDEHIIEEYEEEAKKKGKESFKFAWVMDRLKEERERGVTIDLAHKKFETDKYYF   87 (426)
T ss_pred             EEEEEEEECCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHCCCEEEEEEEEEECCCCEE
T ss_conf             49999952287688887689877299448999999989986487752143212578668755827883169995498169


Q ss_pred             EEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC--CCCHHHHHHHHHHCCCCCC-CCCCCCCCCCCC
Q ss_conf             9997600101112244789888899877776642000001122357--8875454554321025753-221222211110
Q gi|254780484|r   87 ALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH--GVKQIDQDVFSFLDKKAVS-YQIVLTKIDKLS  163 (212)
Q Consensus        87 ~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~~~  163 (212)
                      .++|+||+..+..             .+.......+..+++.++..  +...|..+........+++ +++++||+|+++
T Consensus        88 ~iiD~PGH~~fi~-------------nmi~Gas~~D~ailvV~A~~~~G~~~QT~eHl~l~~~lgi~~iiV~vnKmD~v~  154 (426)
T PRK12317         88 TIIDCPGHRDFVK-------------NMITGASQADAAVLVVSARDAGGVMPQTREHVFLARTLGINQLIVAINKMDAVN  154 (426)
T ss_pred             EEEECCCCHHHHH-------------HHHHHHCCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCC
T ss_conf             9987896366787-------------787453467727999963656676477899999999809983999995333567


Q ss_pred             --HHHHHHHHHHHHHHHHHCC--CCCCCEEEEECCCCCCHHHH
Q ss_conf             --2468999999999975313--68986899988888998999
Q gi|254780484|r  164 --PTTAQETLEKTKYLIRNYP--TAHPEVIPTSSVKRKGIEVL  202 (212)
Q Consensus       164 --~~~~~~~~~~~~~~~~~~~--~~~~~i~~vSA~~g~Gi~eL  202 (212)
                        .+..++....+...++...  ....+++|+||.+|+|+.+.
T Consensus       155 ~~~~~~~~i~~~~~~~l~~~g~~~~~i~~iPiSa~~Gdni~~~  197 (426)
T PRK12317        155 YDEKRYNEVKEEVSKLLKMVGYKPDDIPFIPVSAFEGDNVVKK  197 (426)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCC
T ss_conf             7889999999999999997098803470887532346564116


No 84 
>COG3596 Predicted GTPase [General function prediction only]
Probab=99.63  E-value=3.6e-15  Score=106.37  Aligned_cols=166  Identities=20%  Similarity=0.250  Sum_probs=105.0

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99974899889899999738973798738884145212026655567850896499997600101112244789888899
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLI  111 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~  111 (212)
                      |-|+|+|+||||||+|||+... ...++..+.++......      ....++..+.++||||.+..+.........    
T Consensus        42 vLi~G~TG~GKSSliNALF~~~-~~~v~~vg~~t~~~~~~------~~~~~~~~l~lwDtPG~gdg~~~D~~~r~~----  110 (296)
T COG3596          42 VLLMGATGAGKSSLINALFQGE-VKEVSKVGVGTDITTRL------RLSYDGENLVLWDTPGLGDGKDKDAEHRQL----  110 (296)
T ss_pred             EEEECCCCCCHHHHHHHHHHCC-CCEEEECCCCCCCHHHH------HHHCCCCCEEEECCCCCCCCHHHHHHHHHH----
T ss_conf             8974377776889999997026-73421046688701567------741266524884378855320221899999----


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHC--CCCCCCCCCCCCCCCCCH------------HHHHHHHHHHHHH
Q ss_conf             87777664200000112235788754545543210--257532212222111102------------4689999999999
Q gi|254780484|r  112 VRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLD--KKAVSYQIVLTKIDKLSP------------TTAQETLEKTKYL  177 (212)
Q Consensus       112 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~v~nK~D~~~~------------~~~~~~~~~~~~~  177 (212)
                        +.......+++.+..+........+..+.....  ..+.+.++++|.+|...+            ...++.+++..+.
T Consensus       111 --~~d~l~~~DLvL~l~~~~draL~~d~~f~~dVi~~~~~~~~i~~VtQ~D~a~p~~~W~~~~~~p~~a~~qfi~~k~~~  188 (296)
T COG3596         111 --YRDYLPKLDLVLWLIKADDRALGTDEDFLRDVIILGLDKRVLFVVTQADRAEPGREWDSAGHQPSPAIKQFIEEKAEA  188 (296)
T ss_pred             --HHHHHHHCCEEEEECCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEEHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             --998863224799961477700147799999999860576069997366543655430002599987899999999999


Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             753136898689998888899899999999872
Q gi|254780484|r  178 IRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       178 ~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +..+...-.|++.+|+..++|+++|...|.+.+
T Consensus       189 ~~~~~q~V~pV~~~~~r~~wgl~~l~~ali~~l  221 (296)
T COG3596         189 LGRLFQEVKPVVAVSGRLPWGLKELVRALITAL  221 (296)
T ss_pred             HHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHC
T ss_conf             999876317747752546766899999999867


No 85 
>PRK12736 elongation factor Tu; Reviewed
Probab=99.63  E-value=7.1e-15  Score=104.63  Aligned_cols=166  Identities=19%  Similarity=0.240  Sum_probs=109.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCC-----EEEE---CCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHH
Q ss_conf             899974899889899999738973-----7987---38884145212026655567850896499997600101112244
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKN-----LART---SNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKK  102 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~-----~a~~---~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~  102 (212)
                      .|+++|+.++|||||+-+|++.-.     .+..   .+..--.+..+.+.......+..+...+.++|+||+..+..   
T Consensus        14 ni~~~GHVD~GKSTL~g~L~~~~~~~~~~~~~~~~~~D~~~eEr~rGiTid~~~~~~~t~~~~~~~iD~PGH~~fi~---   90 (394)
T PRK12736         14 NIGTIGHVDHGKTTLTAAITKVLAERGLAQAKDYASIDAAPEEKARGITINTAHVEYETEKRHYAHVDCPGHADYVK---   90 (394)
T ss_pred             EEEEEEECCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHCCCCEEEEEEEEEECCCEEEEEEECCCCHHHHC---
T ss_conf             99999512884898998975045450651022223311665562478217841899972883699988897254311---


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCC-CCCCCCCCHHHHHHHHH-HHHHHHHH
Q ss_conf             78988889987777664200000112235788754545543210257532212-22211110246899999-99999753
Q gi|254780484|r  103 NVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIV-LTKIDKLSPTTAQETLE-KTKYLIRN  180 (212)
Q Consensus       103 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v-~nK~D~~~~~~~~~~~~-~~~~~~~~  180 (212)
                                .+.......+..++++++..+...|..+....+...+.+.++| +||+|++++++..+.++ ++...+..
T Consensus        91 ----------nmi~Ga~~~D~alLVV~A~~G~~~QT~EHl~l~~~lgv~~~IV~vnK~D~v~~~~~~~~v~~~i~~~l~~  160 (394)
T PRK12736         91 ----------NMITGAAQMDGAILVVAATDGPMPQTREHILLARQVGVPYIVVFLNKVDLVDDEELLELVEMEVRELLSE  160 (394)
T ss_pred             ----------CEEEEECCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             ----------0444353466589999858774677999999999829991599998878998399999999999999987


Q ss_pred             CCC--CCCCEEEEECCCCC--------CHHHHHHHHHHH
Q ss_conf             136--89868999888889--------989999999987
Q gi|254780484|r  181 YPT--AHPEVIPTSSVKRK--------GIEVLRKAILET  209 (212)
Q Consensus       181 ~~~--~~~~i~~vSA~~g~--------Gi~eL~~~I~~~  209 (212)
                      ...  ...+++++|+.++.        ++.+|.+.+.+.
T Consensus       161 ~g~~~~~ip~i~~s~~~~~~~~~~~~~~i~~Ll~~ld~~  199 (394)
T PRK12736        161 YDFPGDDIPVIRGSALKALEGDPKWEDAIMELMDAVDEY  199 (394)
T ss_pred             CCCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             699912060998454361368873577899999999852


No 86 
>PRK12735 elongation factor Tu; Reviewed
Probab=99.62  E-value=1.6e-14  Score=102.65  Aligned_cols=168  Identities=17%  Similarity=0.215  Sum_probs=109.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC-----EEEEC---CCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH
Q ss_conf             6899974899889899999738973-----79873---888414521202665556785089649999760010111224
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKN-----LARTS---NAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~-----~a~~~---~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~  101 (212)
                      ..|+++|+.++|||||+-+|++.-.     .+..+   +...-.+..+.+..............+.++|.||+..+.   
T Consensus        13 ini~~~GHVD~GKSTL~g~Lt~~~~~~~~~~~~~~~~~D~~~eEr~rGiTid~~~~~fet~~~~~~~iD~PGHe~fi---   89 (396)
T PRK12735         13 VNVGTIGHVDHGKTTLTAAITTVLAKKGGGEAKAYDQIDNAPEEKARGITINTSHVEYETANRHYAHVDCPGHADYV---   89 (396)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHCCCHHHHCCCEEEEEEEEEEECCCEEEEEEECCCHHHHH---
T ss_conf             49999942688589899998614545246431221221166567437737985699997398059998368668877---


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCC-CCCCCCCCHHHHHHHHH-HHHHHHH
Q ss_conf             478988889987777664200000112235788754545543210257532212-22211110246899999-9999975
Q gi|254780484|r  102 KNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIV-LTKIDKLSPTTAQETLE-KTKYLIR  179 (212)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v-~nK~D~~~~~~~~~~~~-~~~~~~~  179 (212)
                                ..+.......+..++++++..+...|..+....+...+.+.++| +||+|++++++..+..+ ++.+.+.
T Consensus        90 ----------knMI~Ga~~aD~alLVV~A~~G~~~QTrEHl~l~~~lgv~~~iV~vnK~D~v~~~~~~e~v~~~i~~~l~  159 (396)
T PRK12735         90 ----------KNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFLNKCDMVDDEELLELVEMEVRELLS  159 (396)
T ss_pred             ----------HHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             ----------6664100425679999986878753169999999983998589999875888819999999999999998


Q ss_pred             HCCC--CCCCEEEEECCCCC----------CHHHHHHHHHHHH
Q ss_conf             3136--89868999888889----------9899999999872
Q gi|254780484|r  180 NYPT--AHPEVIPTSSVKRK----------GIEVLRKAILETI  210 (212)
Q Consensus       180 ~~~~--~~~~i~~vSA~~g~----------Gi~eL~~~I~~~l  210 (212)
                      ....  ...|++++||..+.          ++.+|.+.|.+.+
T Consensus       160 ~~~f~~~~~piv~~S~~~~~~~~~~~~~~~~i~~Ll~~l~~~~  202 (396)
T PRK12735        160 KYDFPGDDTPIIRGSALKALEGDAEWIGEAKILELMEALDSYI  202 (396)
T ss_pred             HCCCCCCCCCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             5599966477999673372258874344477999999988526


No 87 
>cd04166 CysN_ATPS CysN_ATPS subfamily.  CysN, together with protein CysD, form the ATP sulfurylase (ATPS) complex in some bacteria and lower eukaryotes.  ATPS catalyzes the production of ATP sulfurylase (APS) and pyrophosphate (PPi) from ATP and sulfate.  CysD, which catalyzes ATP hydrolysis, is a member of the ATP pyrophosphatase (ATP PPase) family.  CysN hydrolysis of GTP is required for CysD hydrolysis of ATP; however, CysN hydrolysis of GTP is not dependent on CysD hydrolysis of ATP.  CysN is an example of lateral gene transfer followed by acquisition of new function.  In many organisms, an ATPS exists which is not GTP-dependent and shares no sequence or structural similarity to CysN.
Probab=99.62  E-value=1.1e-14  Score=103.63  Aligned_cols=158  Identities=16%  Similarity=0.190  Sum_probs=103.7

Q ss_pred             EEEEECCCCCCHHHHHHHHH---CCC---------CEEE-----------ECCCCCEEEECCEEEEEEEEEEEECCCEEE
Q ss_conf             89997489988989999973---897---------3798-----------738884145212026655567850896499
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILV---NRK---------NLAR-----------TSNAPGRTQHLNFFVPKDFSNLKNNLPAMA   87 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~---g~~---------~~a~-----------~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~   87 (212)
                      +++++|+..+|||||+-+|+   |.-         ..+.           ..+.....+..+.+.......+......+.
T Consensus         1 ~~vv~GHVD~GKSTL~g~LL~~~g~i~~~~~~~~~~~~~~~~~~~~~~a~~lD~~~~ErerGiTId~~~~~f~~~~~~~~   80 (208)
T cd04166           1 RFLTCGSVDDGKSTLIGRLLYDSKSIFEDQLAALESKSCGTGGEPLDLALLVDGLQAEREQGITIDVAYRYFSTPKRKFI   80 (208)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCHHHHHHCCCCHHHHHCCCCEEEEEEEEEECCCEEE
T ss_conf             96999748898889999999982996789999999887541676300034346868788269794105899981992699


Q ss_pred             EEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-CCCCCCCCCCCCH--
Q ss_conf             9976001011122447898888998777766420000011223578875454554321025753-2212222111102--
Q gi|254780484|r   88 LVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS-YQIVLTKIDKLSP--  164 (212)
Q Consensus        88 ~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~~~~--  164 (212)
                      ++|+||+..+.             ..........+..+.+.++..+..+|..+....+...+.+ .++++||+|+++-  
T Consensus        81 iiDtPGH~dfi-------------~nmi~gas~aD~ailVVda~~G~~~QT~eh~~~~~~lgi~~iIv~vNKmD~v~~~e  147 (208)
T cd04166          81 IADTPGHEQYT-------------RNMVTGASTADLAILLVDARKGVLEQTRRHSYILSLLGIRHVVVAVNKMDLVDYSE  147 (208)
T ss_pred             EEECCCCHHHH-------------HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCH
T ss_conf             98789628899-------------99999986377479999758887278999999999749983999998857689998


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHH
Q ss_conf             4689999999999753136898689998888899899
Q gi|254780484|r  165 TTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEV  201 (212)
Q Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~e  201 (212)
                      ..-++..+++...++.......+++|+||.+|.||-+
T Consensus       148 ~~f~~i~~~~~~~l~~~~~~~~~~IPiSa~~GdNi~~  184 (208)
T cd04166         148 EVFEEIVADYLAFAAKLGIEDITFIPISALDGDNVVS  184 (208)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCC
T ss_conf             9999999999999997499887199812677888786


No 88 
>cd01893 Miro1 Miro1 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the N-terminal GTPase domain of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=99.62  E-value=1.2e-14  Score=103.44  Aligned_cols=159  Identities=16%  Similarity=0.112  Sum_probs=90.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||++++++.+.   ....|.+-..     .............+.++||+|.+........      
T Consensus         1 lKiv~vGd~~VGKTsli~r~~~~~F---~~~~~~t~~~-----~~~~~~~~~~~v~l~i~DtaG~e~~~~~~~~------   66 (166)
T cd01893           1 VRIVLIGDEGVGKSSLIMSLVSEEF---PENVPRVLPE-----ITIPADVTPERVPTTIVDTSSRPQDRANLAA------   66 (166)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCC---CCCCCCCCCC-----EEEEEEECCEEEEEEEEECCCCCCCCHHHHH------
T ss_conf             9899999999899999999984978---8877763456-----8999998890999999989987230245798------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--CHHH---HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             9987777664200000112235788--7545---4554321025753221222211110246899999999997531368
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--KQID---QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~---~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                          ..   ......+.+.+.....  ....   ..... ......|++++.||+|+.+.................+. .
T Consensus        67 ----~~---~~a~~~ilvydit~~~Sf~~i~~~w~~~i~-~~~~~~piilvGNK~DL~~~r~~~~~e~~~~~~~~~~~-~  137 (166)
T cd01893          67 ----EI---RKANVICLVYSVDRPSTLERIRTKWLPLIR-RLGVKVPIILVGNKSDLRDGSSQAGLEEEMLPIMNEFR-E  137 (166)
T ss_pred             ----HH---CCCCEEEEEECCCCHHHHHHHHHHHHHHHH-HHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHC-C
T ss_conf             ----73---689889999708987789999999999999-86899968999988654002503358899999999730-7


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             986899988888998999999998728
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      ...++.+||++|+||+++++.+.+.+-
T Consensus       138 ~~~~~EtSAktg~nV~e~F~~~~k~~l  164 (166)
T cd01893         138 IETCVECSAKTLINVSEVFYYAQKAVL  164 (166)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             488999065889198999999999980


No 89 
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=99.62  E-value=3.4e-15  Score=106.51  Aligned_cols=155  Identities=17%  Similarity=0.210  Sum_probs=88.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||++++++.+...  .-.|+.. .    ..............+.++||+|.+........       
T Consensus         2 KvvlvGd~~VGKTsli~r~~~~~F~~--~y~pTi~-~----~~~~~~~~~~~~v~l~iwDtaG~e~~~~l~~~-------   67 (164)
T cd04139           2 KVIVVGAGGVGKSALTLQFMYDEFVE--DYEPTKA-D----SYRKKVVLDGEDVQLNILDTAGQEDYAAIRDN-------   67 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCCC--CCCCCCC-C----EEEEEEEECCEEEEEEEEECCCCHHHHHHHHH-------
T ss_conf             79999999988999999997198987--7488544-1----68999999999999999989886624889999-------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCC-----HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9877776642000001122357887-----54545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVK-----QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                         ..   ...+..+.+.+......     ...............|++++.||+|+.....+.  .++.++....+   +
T Consensus        68 ---~~---~~a~~~ilvydvt~~~Sf~~~~~~~~~~~~~~~~~~~piilVgNK~DL~~~r~v~--~~e~~~~a~~~---~  136 (164)
T cd04139          68 ---YH---RSGEGFLLVFSITDMESFTATAEFREQILRVKDDDNVPLLLVGNKCDLEDKRQVS--SEEAANLARQW---G  136 (164)
T ss_pred             ---HH---HHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEHHHHHCCCCC--HHHHHHHHHHC---C
T ss_conf             ---88---6376889999779778899999999999986087886369873303233417789--99999999983---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++.+||++|.||+++.+.|.+.+
T Consensus       137 ~~~~E~SAk~g~nV~~~F~~l~~~i  161 (164)
T cd04139         137 VPYVETSAKTRQNVEKAFYDLVREI  161 (164)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9899982687908899999999999


No 90 
>KOG0410 consensus
Probab=99.62  E-value=3.6e-15  Score=106.33  Aligned_cols=158  Identities=21%  Similarity=0.147  Sum_probs=95.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      ...-|.|++|||+|+|||||+|+||+....+..--+.  |.++     .-......++..+.+.||-||.......-...
T Consensus       175 ~~s~pviavVGYTNaGKsTLikaLT~Aal~p~drLFA--TLDp-----T~h~a~Lpsg~~vlltDTvGFisdLP~~LvaA  247 (410)
T KOG0410         175 GESSPVIAVVGYTNAGKSTLIKALTKAALYPNDRLFA--TLDP-----TLHSAHLPSGNFVLLTDTVGFISDLPIQLVAA  247 (410)
T ss_pred             CCCCCEEEEEEECCCCHHHHHHHHHHHHCCCCCHHHE--ECCC-----HHHHCCCCCCCEEEEEECHHHHHHCCHHHHHH
T ss_conf             5778628999634766889999987500583000110--1253-----13430079986799960346665474999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHH-HHHHHHCCCCC-------CCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             8888998777766420000011223578875454-55432102575-------322122221111024689999999999
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQ-DVFSFLDKKAV-------SYQIVLTKIDKLSPTTAQETLEKTKYL  177 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~-------~~~~v~nK~D~~~~~~~~~~~~~~~~~  177 (212)
                      +...+.     .....++.+++.|...+..+... ....-+...+.       .++-|.||+|.....-           
T Consensus       248 F~ATLe-----eVaeadlllHvvDiShP~ae~q~e~Vl~vL~~igv~~~pkl~~mieVdnkiD~e~~~~-----------  311 (410)
T KOG0410         248 FQATLE-----EVAEADLLLHVVDISHPNAEEQRETVLHVLNQIGVPSEPKLQNMIEVDNKIDYEEDEV-----------  311 (410)
T ss_pred             HHHHHH-----HHHHCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCCCC-----------
T ss_conf             999999-----8752344899861579668888989999997469984777767874212356655667-----------


Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             753136898689998888899899999999872
Q gi|254780484|r  178 IRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       178 ~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                       ..   .....+++||++|.|+++|.+.+...+
T Consensus       312 -e~---E~n~~v~isaltgdgl~el~~a~~~kv  340 (410)
T KOG0410         312 -EE---EKNLDVGISALTGDGLEELLKAEETKV  340 (410)
T ss_pred             -CC---CCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             -53---557851430156754799999888876


No 91 
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=99.62  E-value=4.6e-15  Score=105.72  Aligned_cols=155  Identities=17%  Similarity=0.171  Sum_probs=83.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.+|||||||+++++..+..  ....|+.....    .............+.++||+|.+......        
T Consensus         1 ~Ki~vvG~~~vGKTsli~~~~~~~f~--~~~~~Tig~d~----~~~~~~~~~~~~~l~iwDt~G~e~~~~l~--------   66 (159)
T cd00154           1 FKIVLIGDSGVGKTSLLLRFVDGKFD--ENYKSTIGVDF----KSKTIEIDGKTVKLQIWDTAGQERFRSIT--------   66 (159)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEEE----EEEEEEECCEEEEEEEEECCCCHHHHHHH--------
T ss_conf             98999996996899999999709999--98488666479----99999999999999999789826577889--------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCC--HHH--HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             99877776642000001122357887--545--45543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVK--QID--QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~--~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                        ....   ...++.+.+.+......  ...  ............|++++.||+|+....++.  .+........   .+
T Consensus        67 --~~~~---~~~d~~ilv~d~~~~~Sf~~~~~~~~~i~~~~~~~~~iilvgnK~DL~~~~~v~--~~~~~~~a~~---~~  136 (159)
T cd00154          67 --PSYY---RGAHGAILVYDITNRESFENLDKWLKELKEYAPENIPIILVGNKIDLEDQRQVS--TEEAQQFAKE---NG  136 (159)
T ss_pred             --HHHH---HHCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHCCCCC--HHHHHHHHHH---CC
T ss_conf             --9997---541275672448988999999999999998689888269999745630116899--9999999998---69


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             86899988888998999999998
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      .+++.+||++|+||+++++.|.+
T Consensus       137 ~~~~e~SAk~~~~i~~~F~~i~~  159 (159)
T cd00154         137 LLFFETSAKTGENVEELFQSLAE  159 (159)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHC
T ss_conf             97999876888198999999869


No 92 
>PRK00049 elongation factor Tu; Reviewed
Probab=99.62  E-value=1.8e-14  Score=102.37  Aligned_cols=167  Identities=16%  Similarity=0.199  Sum_probs=108.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC------E---EEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHH
Q ss_conf             6899974899889899999738973------7---987388841452120266555678508964999976001011122
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKN------L---ARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAP  100 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~------~---a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~  100 (212)
                      ..|+++|+-++|||||+-+|++.-.      .   ....+..-..+..+.+.......+..+...+.++|.||+..+-. 
T Consensus        13 ~ni~~~GHVD~GKSTL~g~Lt~~l~~~~g~~~~~~~~~~D~~~eEr~rGiTid~~~~~~~t~~~~~~~iD~PGH~~fik-   91 (397)
T PRK00049         13 VNVGTIGHVDHGKTTLTAAITKVLAKKYGGAEAKAYDQIDNAPEEKARGITINTAHVEYETEKRHYAHVDCPGHADYVK-   91 (397)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHCCCCHHHHHCCCEEEEEEEEEECCCCEEEEECCCCHHHHHH-
T ss_conf             2999991258889999999986666543853100133302576676258169987999972881499951786388899-


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCC-CCCCCCCCHHHHHHHHH-HHHHHH
Q ss_conf             4478988889987777664200000112235788754545543210257532212-22211110246899999-999997
Q gi|254780484|r  101 KKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIV-LTKIDKLSPTTAQETLE-KTKYLI  178 (212)
Q Consensus       101 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v-~nK~D~~~~~~~~~~~~-~~~~~~  178 (212)
                                  .+.......+..+.++++..+...|..+........+.+.++| +||+|++++++..+.++ ++++.+
T Consensus        92 ------------nmI~Ga~~~D~alLVV~A~~G~~~QT~EHl~l~~~LGv~~~iV~vnK~D~v~~~~~~~~v~~~i~~~l  159 (397)
T PRK00049         92 ------------NMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFLNKCDMVDDEELLELVEMEVRELL  159 (397)
T ss_pred             ------------HHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHH
T ss_conf             ------------98730121567999997488866528999999998099827999986688885999999999999999


Q ss_pred             HHCCC--CCCCEEEEECCCCC----------CHHHHHHHHHHH
Q ss_conf             53136--89868999888889----------989999999987
Q gi|254780484|r  179 RNYPT--AHPEVIPTSSVKRK----------GIEVLRKAILET  209 (212)
Q Consensus       179 ~~~~~--~~~~i~~vSA~~g~----------Gi~eL~~~I~~~  209 (212)
                      ..+..  ...+++++||.++.          |+.+|.+.+.+.
T Consensus       160 ~~~~f~~~~ipiv~~S~~~~~~~~~~~~~~~~i~~Ll~~ld~~  202 (397)
T PRK00049        160 SKYDFPGDDTPIIRGSALKALEEIGDPEWEAKILELMEAVDSY  202 (397)
T ss_pred             HHCCCCCCCCCEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             8469984447689855003114778653178999999999864


No 93 
>cd04128 Spg1 Spg1p.  Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase.  Spg1p is an essential gene that localizes to the spindle pole bodies.  When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p.  Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p.  The existence of a SIN-related pathway in plants has been proposed.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP.  Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are
Probab=99.62  E-value=4.7e-15  Score=105.65  Aligned_cols=157  Identities=13%  Similarity=0.122  Sum_probs=84.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||++++++... . ..-.|+....    ..............+.++||+|.+.+....        
T Consensus         1 iKivlvGd~~VGKTsLi~rf~~~~F-~-~~y~~Tig~d----~~~k~i~v~~~~v~l~iwDtaGqe~f~~~~--------   66 (182)
T cd04128           1 LKIGLLGDAQIGKTSLMVKYVEGEF-D-EDYIQTLGVN----FMEKTISIRGTEITFSIWDLGGQREFINML--------   66 (182)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC-C-CCCCCCCEEE----EEEEEEEECCEEEEEEEEECCCCHHHHHHH--------
T ss_conf             9899999999898999999953999-9-9988873389----899999999999999998677648789999--------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC-----CHHHHHHHHHHCCCCCCCCCCCCCCCCCCH---HHHHHHHHHHHHHHHHC
Q ss_conf             9987777664200000112235788-----754545543210257532212222111102---46899999999997531
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV-----KQIDQDVFSFLDKKAVSYQIVLTKIDKLSP---TTAQETLEKTKYLIRNY  181 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~---~~~~~~~~~~~~~~~~~  181 (212)
                        ..+..   -....+.+.+.....     ..+... ...... ..+.++|.||+|+..+   +..+...+...+...  
T Consensus        67 --~~y~~---~a~~~ilvfDit~~~Sf~~~~~w~~~-i~~~~~-~~~~ilVGnK~DL~~~~~~~~~~~~~~~~~~~a~--  137 (182)
T cd04128          67 --PLVCN---DAVAILFMFDLTRKSTLNSIKEWYRQ-ARGFNK-TAIPILVGTKYDLFADLPPEEQEEITKQARKYAK--  137 (182)
T ss_pred             --HHHHC---CCCEEEEEEECCCHHHHHHHHHHHHH-HHHHCC-CCCEEEEEECCCCCCCCCCHHEEHHHHHHHHHHH--
T ss_conf             --99864---78789999978998999989999999-997689-9988999986635565562231024899999999--


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             36898689998888899899999999872
Q gi|254780484|r  182 PTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       182 ~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                       ..+-+++.+||++|.|++++++.|.+.+
T Consensus       138 -~~~~~f~etSAk~~~nV~e~F~~i~~~i  165 (182)
T cd04128         138 -AMKAPLIFCSTSHSINVQKIFKIVLAKA  165 (182)
T ss_pred             -HCCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             -8499899994799979899999999999


No 94 
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=99.62  E-value=5.7e-15  Score=105.18  Aligned_cols=155  Identities=17%  Similarity=0.207  Sum_probs=85.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+|++++.+..  ..-.|+ ...    ..............+.++||+|..........       
T Consensus         1 Ki~ivG~~~vGKTsli~r~~~~~f~--~~~~pT-i~~----~~~~~~~~~~~~~~l~i~Dt~g~~~~~~~~~~-------   66 (160)
T cd00876           1 KVVVLGAGGVGKSAITIQFVKGTFV--EEYDPT-IED----SYRKTIVVDGETYTLDILDTAGQEEFSAMRDL-------   66 (160)
T ss_pred             CEEEECCCCCCHHHHHHHHHHCCCC--CCCCCC-EEE----EEEEEEEECCEEEEEEEEECCCCHHHHHHHHH-------
T ss_conf             9999996996799999999619599--877883-004----89999997669999999979996235578899-------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCC--CHH---HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             987777664200000112235788--754---545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGV--KQI---DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~---~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                         ..   ...++.+.+.+.....  ...   ...+.........|++++.||+|+.....+.  .+..+......   +
T Consensus        67 ---~~---~~a~~~ilvfd~~~~~Sf~~i~~~~~~i~~~~~~~~~piilvgnK~Dl~~~~~V~--~~e~~~~a~~~---~  135 (160)
T cd00876          67 ---YI---RQGDGFILVYSITDRESFEEIKGYREQILRVKDDEDIPIVLVGNKCDLENERQVS--KEEGKALAKEW---G  135 (160)
T ss_pred             ---HH---HHCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHCCCCC--HHHHHHHHHHC---C
T ss_conf             ---97---6436899973289878999999999999997287886299999745622307899--99999999984---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++.+||++|.||+++++.|.+.|
T Consensus       136 ~~y~e~Sak~g~nV~e~F~~i~~~i  160 (160)
T cd00876         136 CPFIETSAKDNINIDEVFKLLVREI  160 (160)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHC
T ss_conf             9799984798949899999999729


No 95 
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily.  Arl4 (Arf-like 4) is highly expressed in testicular germ cells, and is found in the nucleus and nucleolus.  In mice, Arl4 is developmentally expressed during embryogenesis, and a role in somite formation and central nervous system differentiation has been proposed.  Arl7 has been identified as the only Arf/Arl protein to be induced by agonists of liver X-receptor and retinoid X-receptor and by cholesterol loading in human macrophages.  Arl7 is proposed to play a role in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway.  Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily.
Probab=99.61  E-value=1.6e-14  Score=102.70  Aligned_cols=161  Identities=15%  Similarity=0.129  Sum_probs=89.8

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|.++|.+|||||||++++...+. ..  ..||..-.  ..... ..........+.++||+|.+.....-....    
T Consensus         4 ~kIvilG~~~~GKTsil~r~~~~~f-~~--~~pTiG~~--~~~~~-~~~~~~~~v~l~iwDtaGqe~~r~l~~~Y~----   73 (183)
T cd04152           4 LHIVMLGLDSAGKTTVLYRLKFNEF-VN--TVPTKGFN--TEKIK-VSLGNSKGITFHFWDVGGQEKLRPLWKSYT----   73 (183)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCC-CC--CCCCCCEE--EEEEE-EECCCCCEEEEEEEECCCCCCCCEEHHHHH----
T ss_conf             9999999999988999999964986-77--68703557--89999-961678667999997898734510087674----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHH-----HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99877776642000001122357887545-----4554321025753221222211110246899999999997531368
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQID-----QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                               .....++++.|......-..     ............|++++.||+|+-+.....+..+... ........
T Consensus        74 ---------r~a~g~i~V~D~td~~~~~~~~~~l~~~~~~~~~~~~piliv~NK~Dl~~~~~~~ei~~~l~-l~~~~~~~  143 (183)
T cd04152          74 ---------RCTDGIVFVVDSVDVERMEEAKTELHKITRFSENQGVPVLVLANKQDLPNALSVSEVEKLLA-LHELSAST  143 (183)
T ss_pred             ---------CCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCCHHHHHHHHH-HHHHHCCC
T ss_conf             ---------67867899996776889999999999997321237962999986677766878899999971-99986669


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             98689998888899899999999872
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ...+.++||++|+||++..+.|.+.+
T Consensus       144 ~~~i~~tSA~tG~gI~e~f~~L~~~i  169 (183)
T cd04152         144 PWHVQPACAIIGEGLQEGLEKLYEMI  169 (183)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             98999727997969899999999999


No 96 
>cd04117 Rab15 Rab15 subfamily.  Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to
Probab=99.61  E-value=1.4e-14  Score=102.88  Aligned_cols=156  Identities=14%  Similarity=0.139  Sum_probs=87.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|-++||||||++++++.+..  ....|+.....    .............+.++||+|.+..........     
T Consensus         2 KIvllGd~~VGKTsli~r~~~~~f~--~~~~~Tig~~~----~~k~v~~~~~~i~l~iwDtaGqe~~~~~~~~y~-----   70 (161)
T cd04117           2 RLLLIGDSGVGKTCLLCRFTDNEFH--SSHISTIGVDF----KMKTIEVDGIKVRIQIWDTAGQERYQTITKQYY-----   70 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCCEEEE----EEEEEEECCEEEEEEEEECCCCCCCCCCHHHHH-----
T ss_conf             8999994998589999999429989--98788720898----899999999999999997999602363558887-----


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCC--CH--HHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             987777664200000112235788--75--45455432102575322122221111024689999999999753136898
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGV--KQ--IDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP  186 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~--~~--~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (212)
                              .....++.+.|.....  ..  ..............|.+++.||+|+.....+..  ++..+....+   +-
T Consensus        71 --------r~a~~~ilvyDvt~~~Sf~~l~~w~~~i~~~~~~~~~~ilVgNK~Dl~~~r~v~~--~~~~~~a~~~---~~  137 (161)
T cd04117          71 --------RRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQVGD--EQGNKLAKEY---GM  137 (161)
T ss_pred             --------HHHCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHCCCCCH--HHHHHHHHHC---CC
T ss_conf             --------6416889961489889999999999999987899864999873278786277999--9999999986---99


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             689998888899899999999872
Q gi|254780484|r  187 EVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       187 ~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +++.+||++|.||+++.+.|.+.|
T Consensus       138 ~~~etSAk~~~nV~e~F~~l~~~i  161 (161)
T cd04117         138 DFFETSACTNSNIKESFTRLTELV  161 (161)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHC
T ss_conf             799967789829899999999649


No 97 
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=99.60  E-value=1e-14  Score=103.68  Aligned_cols=153  Identities=16%  Similarity=0.173  Sum_probs=90.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|.++|..|||||||++++...+.   ....||..  .+      .......+..+.++|++|.......-..       
T Consensus         1 Kil~lG~~~~GKTsll~~~~~~~~---~~~~pTig--~~------~~~i~~~~~~~~iwD~~G~e~~r~~~~~-------   62 (158)
T cd04151           1 RILILGLDNAGKTTILYRLQLGEV---VTTIPTIG--FN------VETVTYKNLKFQVWDLGGQTSIRPYWRC-------   62 (158)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCC---CCCCCCCC--CC------EEEEEECCEEEEEEECCCCCCCCHHHHH-------
T ss_conf             999999999989999999970996---77578488--24------6999989889999967986244627887-------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCH--H---HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             98777766420000011223578875--4---545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQ--I---DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~---~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                         +   -.....++++.|......-  .   .............|++++.||+|+.......+..+.+..  .......
T Consensus        63 ---y---~~~~~~ii~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~piliv~NK~Dl~~~~~~~~i~~~l~l--~~~~~~~  134 (158)
T cd04151          63 ---Y---YSNTDAIIYVVDSTDRDRLGTAKEELHAMLEEEELKGAVLLVFANKQDMPGALSEAEISEKLGL--SELKDRT  134 (158)
T ss_pred             ---H---CCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHH--HHHHCCC
T ss_conf             ---4---6678899999745787899999999999983465369819999976677657799999999859--8741699


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             868999888889989999999987
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      ..++++||++|+||+|..++|.++
T Consensus       135 ~~~~~tSA~tG~gV~e~f~wL~~t  158 (158)
T cd04151         135 WSIFKTSAIKGEGLDEGMDWLVNT  158 (158)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHCC
T ss_conf             689996787893999999998569


No 98 
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=99.60  E-value=5.7e-15  Score=105.20  Aligned_cols=153  Identities=18%  Similarity=0.199  Sum_probs=88.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|.++|.+|||||||++++...+. ..  ..||..  .+     ...........+.++||+|.+.....-...      
T Consensus         1 KivilG~~~~GKTsil~r~~~~~~-~~--~~pTig--~~-----~~~~~~~~~~~l~iwD~~G~e~~~~~~~~y------   64 (160)
T cd04156           1 QVLLLGLDSAGKSTLLYKLKHAEL-VT--TIPTVG--FN-----VEMLQLEKHLSLTVWDVGGQEKMRTVWKCY------   64 (160)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCC-CC--CCCCCC--EE-----EEEEEECCEEEEEEEECCCCCCCCHHHHHH------
T ss_conf             999999999999999999956987-77--577615--03-----899998998999999789862474158877------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCC--HHHHH---HHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC-CCC
Q ss_conf             9877776642000001122357887--54545---54321025753221222211110246899999999997531-368
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVK--QIDQD---VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY-PTA  184 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~---~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~-~~~  184 (212)
                             ....+.++++.|......  .....   ..........|++++.||.|+......++......  +..+ ...
T Consensus        65 -------~~~a~~iI~V~D~td~~~~~~~~~~~~~~l~~~~~~~~pili~~NK~Dl~~~~~~~ei~~~l~--~~~~~~~~  135 (160)
T cd04156          65 -------LENTDGLVYVVDSSDEARLDESQKELKHILKNEHIKGVPVVLLANKQDLPGALTAEEITRRFK--LKKYCSDR  135 (160)
T ss_pred             -------HCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHHH--HHHHHHCC
T ss_conf             -------456778999985686788787999999998663537874999998633656679999999986--99998539


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             986899988888998999999998
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      ...++++||++|+||+++.+.|.+
T Consensus       136 ~~~i~~~SAktGegi~e~f~~la~  159 (160)
T cd04156         136 DWYVQPCSAVTGEGLAEAFRKLAS  159 (160)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHC
T ss_conf             999998668849599999999857


No 99 
>cd04132 Rho4_like Rho4-like subfamily.  Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis.  Rho4 also plays a role in cell morphogenesis.  Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules.  The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP.  In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=99.60  E-value=7.9e-15  Score=104.37  Aligned_cols=159  Identities=13%  Similarity=0.131  Sum_probs=84.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||++++++....  ..-.|+.  ...  ..............+.++||+|.+.........      
T Consensus         2 KivlvGd~~VGKTsli~r~~~~~F~--~~~~pTi--~~~--~~~~~~~~~~~~v~l~iwDtaG~e~~~~l~~~~------   69 (187)
T cd04132           2 KIVVVGDGGCGKTCLLIVYSQGKFP--EEYVPTV--FEN--YVTNIQGPNGKIIELALWDTAGQEEYDRLRPLS------   69 (187)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCE--EEE--EEEEEEEECCEEEEEEEEECCCCCCCCCCHHHH------
T ss_conf             8999994997699999999639899--9758966--479--999999549989999999699971105343445------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHHHH--CCCCCCCCCCCCCCCCCCHHHHHH--HHHHHHHHHHHCCCC
Q ss_conf             98777766420000011223578--875454554321--025753221222211110246899--999999997531368
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHG--VKQIDQDVFSFL--DKKAVSYQIVLTKIDKLSPTTAQE--TLEKTKYLIRNYPTA  184 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~~~--~~~~~~~~~~~~~~~  184 (212)
                          .   ......+.+.+....  +...........  .....|+++|.||+|+....+...  ..+...+....  .+
T Consensus        70 ----~---~~a~~~ilvydit~~~Sf~~i~~~W~~~i~~~~~~~piilVgnK~DL~~~~~~~~~v~~e~~~~~a~~--~~  140 (187)
T cd04132          70 ----Y---PDVDVLLICYAVDNPTSLDNVEDKWFPEVNHFCPGTPIMLVGLKTDLRKDKNLDRKVTPAQAESVAKK--QG  140 (187)
T ss_pred             ----H---HHCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHCCCCCCCHHHHHHHHHH--CC
T ss_conf             ----3---00348889503687677999999999999986899997999987221221223765789999999998--59


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             98689998888899899999999872
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ..+++.+||++|+||+++++.|.+.+
T Consensus       141 ~~~y~EtSAk~g~nV~e~F~~l~~~i  166 (187)
T cd04132         141 AFAYLECSAKTMENVEEVFDTAIEEA  166 (187)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             97899957688929899999999999


No 100
>PRK05433 GTP-binding protein LepA; Provisional
Probab=99.60  E-value=3.3e-15  Score=106.60  Aligned_cols=169  Identities=17%  Similarity=0.187  Sum_probs=112.4

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHCCCC-EEE-EC-----CCCCEEEECCEEEEEEEEEEEE-----CCCEEEEEECC
Q ss_conf             876686899974899889899999738973-798-73-----8884145212026655567850-----89649999760
Q gi|254780484|r   25 PKAGPPEIAFSGRSNVGKSSLINILVNRKN-LAR-TS-----NAPGRTQHLNFFVPKDFSNLKN-----NLPAMALVDMP   92 (212)
Q Consensus        25 P~~~~p~VaivG~~NvGKSSLiNaL~g~~~-~a~-~~-----~~p~tt~~~~~~~~~~~~~~~~-----~~~~~~~~Dtp   92 (212)
                      +.+++..++|+.|-.+|||||-.+|...-- +.. ..     +.--..+..+.+.-.....+.+     ....+.++|||
T Consensus         3 ~~~~IRNf~IiAHIDhGKSTLaDrlL~~tg~i~~~~~~~q~lD~m~~ErERGITIka~~v~~~y~~~~g~~y~lNLIDTP   82 (601)
T PRK05433          3 DMKNIRNFSIIAHIDHGKSTLADRLIELTGTLSEREMKAQVLDSMDLERERGITIKAQAVRLNYKAKDGETYQLNLIDTP   82 (601)
T ss_pred             CHHCCCEEEEEEECCCCHHHHHHHHHHHCCCCCCCCCHHHCCCCHHHHHHCCCEEEEEEEEEEEECCCCCEEEEEEECCC
T ss_conf             33204558999943788888999999970997744323331454155765583697867999988489967999985489


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             01011122447898888998777766420000011223578875454554321025753221222211110246899999
Q gi|254780484|r   93 GYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLE  172 (212)
Q Consensus        93 G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~  172 (212)
                      |+-.+...-             ......+...+.+.|+..+...|.........+.+.+.+.++||+|+.. .+.+...+
T Consensus        83 GHVDF~~EV-------------sRSL~aceGalLlVDa~qGVqaQT~an~~~A~~~~L~iIpviNKIDlp~-Ad~e~v~~  148 (601)
T PRK05433         83 GHVDFSYEV-------------SRSLAACEGALLVVDASQGVEAQTLANVYLALENDLEIIPVLNKIDLPA-ADPERVKQ  148 (601)
T ss_pred             CCCCCCEEE-------------EEEHHHCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCCC-CCHHHHHH
T ss_conf             856645045-------------5603340725999976878560069999999987996577786146888-99899999


Q ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             99999753136898689998888899899999999872
Q gi|254780484|r  173 KTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       173 ~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ++.+.+   .....+++.+||++|.|+++|.++|.+.+
T Consensus       149 qi~~~i---gl~~~eil~vSAKtG~GV~~lLdaIV~~i  183 (601)
T PRK05433        149 EIEDII---GIDASDAVLVSAKTGIGIEEVLEAIVERI  183 (601)
T ss_pred             HHHHHH---CCCHHHHHHHHHHCCCCHHHHHHHHHHHC
T ss_conf             999886---89647777775233888799999999747


No 101
>PTZ00258 GTP-binding protein; Provisional
Probab=99.59  E-value=2.7e-14  Score=101.29  Aligned_cols=72  Identities=21%  Similarity=0.162  Sum_probs=52.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEE-----------EECCCEEEEEECCHHHH
Q ss_conf             6868999748998898999997389737987388841452120266555678-----------50896499997600101
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNL-----------KNNLPAMALVDMPGYGY   96 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~-----------~~~~~~~~~~DtpG~~~   96 (212)
                      +-.+++|||.|||||||||||||...  +...++|++|..+|..........           ..-...+.++|.||+-.
T Consensus        21 ~~m~iGivGlPNvGKSTlFnAlT~~~--v~~aNyPF~TIepN~gvv~VpD~Rl~~l~~~~~~kk~ipa~ve~vDIAGLV~   98 (392)
T PTZ00258         21 NNLKMGIVGLPNVGKSTTFNALSKQQ--VPAENFPFCTIDPNTARVPVPDERFDKLCQFFKPKSIVPATLDIVDIAGLVK   98 (392)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCC--CCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCEEEEEEEEECCCCCC
T ss_conf             78556786699997899999987799--7424899888778327996784568899875187761014689997345578


Q ss_pred             HHHHH
Q ss_conf             11224
Q gi|254780484|r   97 ARAPK  101 (212)
Q Consensus        97 ~~~~~  101 (212)
                      ....+
T Consensus        99 GAs~G  103 (392)
T PTZ00258         99 GASKG  103 (392)
T ss_pred             CCCCC
T ss_conf             73026


No 102
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=99.59  E-value=1.5e-14  Score=102.74  Aligned_cols=154  Identities=14%  Similarity=0.127  Sum_probs=85.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||+++++...-...  ..|+    .+................+.++||+|.+.........     
T Consensus         1 iKivllGd~~VGKTsli~r~~~~~f~~~--~~~T----ig~~~~~~~~~~~~~~~~l~iwDtaG~e~f~~~~~~y-----   69 (161)
T cd04124           1 VKIILLGDSAVGKSKLVERFLMDGYEPQ--QLST----YALTLYKHNAKFEGKTILVDFWDTAGQERFQTMHASY-----   69 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCCCC--CCCC----CCEEEEEEEEEECCEEEEEEEEECCCCCCCCHHHHHH-----
T ss_conf             9899999899678999999980977997--2665----4157999999999999999999799984343246997-----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHH-HHHHHHHH--CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             9987777664200000112235788754-54554321--02575322122221111024689999999999753136898
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQI-DQDVFSFL--DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP  186 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (212)
                           .   .....++.+.|......-. .....+.+  .....|.+++.||+|+-.. ..++    ..+...   ..+-
T Consensus        70 -----~---~~a~~~ilvfDit~~~Sf~~~~~w~~~i~~~~~~~p~ilVgNK~DL~~~-~~~~----~~~~a~---~~~~  133 (161)
T cd04124          70 -----Y---HKAHACILVFDVTRKITYKNLSKWYEELREYRPEIPCIVVANKIDLDPS-VTQK----KFNFAE---KHNL  133 (161)
T ss_pred             -----H---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCH-HHHH----HHHHHH---HCCC
T ss_conf             -----3---5687679999689778899999999999986869989999997117742-5899----999999---8699


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             689998888899899999999872
Q gi|254780484|r  187 EVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       187 ~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +++.+||++|.||+++.+.|.+.+
T Consensus       134 ~f~etSAk~g~nV~e~F~~l~~~~  157 (161)
T cd04124         134 PLYYVSAADGTNVVKLFQDAIKLA  157 (161)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             199990783809799999999999


No 103
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily.  Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation.  It is expressed ubiquitously, with elevated levels in muscle and brain.  Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth.  TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell.  TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb.  The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb.  Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le
Probab=99.59  E-value=5.7e-15  Score=105.21  Aligned_cols=155  Identities=19%  Similarity=0.190  Sum_probs=87.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||++++++.+..  ..-.|+....     .............+.++||+|.+.........      
T Consensus         3 KIvlvGd~~VGKTsli~r~~~~~f~--~~y~~Ti~~~-----~~k~i~~~~~~~~l~iwDtaG~e~~~~~~~~~------   69 (180)
T cd04137           3 KIAVLGSRSVGKSSLTVQFVEGHFV--ESYYPTIENT-----FSKIIRYKGQDYHLEIVDTAGQDEYSILPQKY------   69 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCCCCC-----CCEEEEECCEEEEEEEEECCCCCCCCHHHHHH------
T ss_conf             8999998998899999999709789--9858812441-----13799999999999999899870100667999------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHH-----HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             987777664200000112235788754-----545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQI-----DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                          ..   .....+.+.+......-.     .............|++++.||+|+.....+.  .++.++....+   +
T Consensus        70 ----~~---~a~~~ilvydvt~~~Sf~~~~~~~~~~~~~~~~~~~piilVgNK~DL~~~r~V~--~~e~~~~a~~~---~  137 (180)
T cd04137          70 ----SI---GIHGYILVYSVTSRKSFEVVKVIYDKILDMLGKESVPIVLVGNKSDLHTQRQVS--TEEGKELAESW---G  137 (180)
T ss_pred             ----HH---HCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHCCCC--HHHHHHHHHHC---C
T ss_conf             ----86---355789997438878899999999999997588888679776534624407889--99999999983---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++.+||++|.|++++++.|.+.+
T Consensus       138 ~~f~EtSAk~g~nV~e~F~~l~~~i  162 (180)
T cd04137         138 AAFLESSARENENVEEAFELLIEEI  162 (180)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9899977688919899999999999


No 104
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily.  EF1 is responsible for the GTP-dependent binding of aminoacyl-tRNAs to the ribosomes.  EF1 is composed of four subunits: the alpha chain which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains.  This subfamily is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF1-alpha) and eukaryotes (eEF1-alpha).  eEF1-alpha interacts with the actin of the eukaryotic cytoskeleton and may thereby play a role in cellular transformation and apoptosis.  EF-Tu can have no such role in bacteria.  In humans, the isoform eEF1A2 is overexpressed in 2/3 of breast cancers and has been identified as a putative oncogene.  This subfamily also includes Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation in
Probab=99.59  E-value=5.8e-14  Score=99.41  Aligned_cols=157  Identities=13%  Similarity=0.203  Sum_probs=95.9

Q ss_pred             EEEECCCCCCHHHHHHHHH---CC------------------C--CEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEE
Q ss_conf             9997489988989999973---89------------------7--37987388841452120266555678508964999
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILV---NR------------------K--NLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMAL   88 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~---g~------------------~--~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~   88 (212)
                      |+++|+.++|||||+-+|+   |.                  .  ..|-+.+.....+..+.+.......+......+.+
T Consensus         2 i~iiGHvD~GKSTL~g~lL~~~g~i~~~~~~k~~~~~~~~gk~s~~~a~~lD~~~~ErerGiTI~~~~~~f~~~~~~~~i   81 (219)
T cd01883           2 LVVIGHVDAGKSTTTGHLLYLLGGVDKRTIEKYEKEAKEMGKGSFKYAWVLDTLKEERERGVTIDVGLAKFETEKYRFTI   81 (219)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHCCCCEEEEEEEEEECCEEEEE
T ss_conf             89996689989999999999859976889999999998549987505566138987985892588589999849936999


Q ss_pred             EECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC-------CCHHHHHHHHHHCCCCCC-CCCCCCCCC
Q ss_conf             976001011122447898888998777766420000011223578-------875454554321025753-221222211
Q gi|254780484|r   89 VDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG-------VKQIDQDVFSFLDKKAVS-YQIVLTKID  160 (212)
Q Consensus        89 ~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~-~~~v~nK~D  160 (212)
                      +|+||+..+..             .........+..+.++++..+       ...|..+....+...+++ .++++||+|
T Consensus        82 iDtPGH~df~~-------------~mi~g~~~ad~ailvvda~~g~~e~g~~~~~QTreH~~l~~~lGik~iIVavNKMD  148 (219)
T cd01883          82 LDAPGHRDFVP-------------NMITGASQADVAVLVVDARKGEFEAGFEKGGQTREHALLARTLGVKQLIVAVNKMD  148 (219)
T ss_pred             EECCCCHHHHH-------------HHHHHHHHCCEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             87897266788-------------99987753166899998576751036677765999999999849974899998753


Q ss_pred             CCCHHHHHH----HHHHHHHHHHHCC--CCCCCEEEEECCCCCCHHH
Q ss_conf             110246899----9999999975313--6898689998888899899
Q gi|254780484|r  161 KLSPTTAQE----TLEKTKYLIRNYP--TAHPEVIPTSSVKRKGIEV  201 (212)
Q Consensus       161 ~~~~~~~~~----~~~~~~~~~~~~~--~~~~~i~~vSA~~g~Gi~e  201 (212)
                      ++..+-.+.    ..+++...+....  ....+++|+||..|+||-+
T Consensus       149 ~v~~~y~~~rf~~i~~~~~~~l~~~g~~~~~~~~IPiSa~~GdNi~~  195 (219)
T cd01883         149 DVTVNWSEERYDEIKKELSPFLKKVGYNPKDVPFIPISGLTGDNLIE  195 (219)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCC
T ss_conf             68865259999999999999999829995661599933676630466


No 105
>PTZ00132 GTP-binding nuclear protein; Provisional
Probab=99.58  E-value=1.3e-14  Score=103.17  Aligned_cols=154  Identities=10%  Similarity=0.063  Sum_probs=85.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+++++.....  ..-.||....    ..............+.++||+|.+.+........     
T Consensus         8 KIvllGd~~VGKTsLi~r~~~~~F~--~~y~pTig~d----~~~~~~~~~~~~i~l~IwDTaGqe~f~sl~~~yy-----   76 (209)
T PTZ00132          8 KLILVGDGGVGKTTFVKRHLTGEFE--KKYIATLGVE----VHPLKFYTNRGKICFNVWDTAGQEKFGGLRDGYY-----   76 (209)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEE----EEEEEEEECCEEEEEEEEECCCCCCCCCCCCHHH-----
T ss_conf             9999999996789999999719969--9877760279----8999999999999999998999744556651442-----


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCC--CHHHHHHHHHH-CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             987777664200000112235788--75454554321-025753221222211110246899999999997531368986
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGV--KQIDQDVFSFL-DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE  187 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~-~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~  187 (212)
                              .-..+.+.+.|.....  ......+.+.. .....|++++.||+|+.+. .+..  +.. +...   ..+-+
T Consensus        77 --------r~a~~~ilVfDit~~~SF~~l~~W~~ei~~~~~~ipivLVGNK~DL~~r-~V~~--~~~-~~a~---~~~~~  141 (209)
T PTZ00132         77 --------IKGQCAIIMFDVTSRITYKNVPNWHRDITRVCENIPIVLVGNKVDVKDR-QVKA--KQI-TFHR---KKNLQ  141 (209)
T ss_pred             --------CCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC-CCCH--HHH-HHHH---HCCCE
T ss_conf             --------4898899984378878999999999999986899878999762322413-5579--999-9999---87998


Q ss_pred             EEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             89998888899899999999872
Q gi|254780484|r  188 VIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       188 i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ++.+||++|+||++++..|.+.|
T Consensus       142 f~EtSAKtg~NV~e~F~~Lar~i  164 (209)
T PTZ00132        142 YYDISAKSNYNFEKPFLWLARRL  164 (209)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH
T ss_conf             99972689939799999999998


No 106
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=99.58  E-value=7.9e-15  Score=104.38  Aligned_cols=156  Identities=16%  Similarity=0.177  Sum_probs=88.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+++++..+..  ..-.|+.. .    ..............+.++||+|.+......         
T Consensus         3 KivllGd~~VGKTsli~r~~~~~f~--~~y~~Ti~-~----~~~k~i~~~~~~~~l~iwDtaG~e~~~~~~---------   66 (163)
T cd04136           3 KVVVLGSGGVGKSALTVQFVQGIFV--EKYDPTIE-D----SYRKQIEVDGQQCMLEILDTAGTEQFTAMR---------   66 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCC-C----EEEEEEEECCEEEEEEECCCCCCHHHHHHH---------
T ss_conf             9999899998899999999719598--86699542-0----699999999999999864576544555678---------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHH-----HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             987777664200000112235788754-----545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQI-----DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                       ....   ......+.+.+......-.     .............|++++.||+|+.....+..  ++.......+   +
T Consensus        67 -~~y~---~~a~~~ilvydvt~~~Sf~~l~~~~~~i~~~~~~~~~piilVGnK~Dl~~~r~v~~--~~~~~~a~~~---~  137 (163)
T cd04136          67 -DLYI---KNGQGFVLVYSITSQSSFNDLQDLREQILRVKDTENVPMVLVGNKCDLEDERVVSR--EEGQALARQW---G  137 (163)
T ss_pred             -HHHH---CCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHCCCCH--HHHHHHHHHC---C
T ss_conf             -9883---46876999704898899999999999999861888886787623547264078999--9999999984---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             86899988888998999999998728
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      -+++.+||++|.||+++.+.|.+.||
T Consensus       138 ~~~~E~SAk~~~nV~e~F~~l~~~i~  163 (163)
T cd04136         138 CPFYETSAKSKINVDEVFADLVRQIN  163 (163)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHC
T ss_conf             98999744878058999999999639


No 107
>cd04116 Rab9 Rab9 subfamily.  Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47).  Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs.  Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=99.58  E-value=3.7e-15  Score=106.30  Aligned_cols=161  Identities=14%  Similarity=0.172  Sum_probs=88.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      +..+.+|+++|.++||||||++++++.+..  ....|+....    ..............+.++||+|.+......... 
T Consensus         2 ~~~~~KivvlGd~~VGKTsli~r~~~~~f~--~~~~~Tig~~----~~~k~i~~~~~~v~l~iwDtaG~e~~~~l~~~~-   74 (170)
T cd04116           2 KSSLLKVILLGDGGVGKSSLMNRYVTNKFD--TQLFHTIGVE----FLNKDLEVDGHFVTLQIWDTAGQERFRSLRTPF-   74 (170)
T ss_pred             CCEEEEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCEEE----EEEEEEEECCEEEEEEEEECCCCCCCCCCHHHH-
T ss_conf             960899999999997899999999739899--9888876079----899999999999999999899972435241766-


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCC--HH---HHHHHHH---HCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             888899877776642000001122357887--54---5455432---102575322122221111024689999999999
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVK--QI---DQDVFSF---LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYL  177 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~---~~~~~~~---~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~  177 (212)
                               .   ......+.+.+......  ..   ..++...   ......|++++.||+|+-...-.   .++.++.
T Consensus        75 ---------~---~~a~~~ilvydit~~~Sf~~~~~w~~~~~~~~~~~~~~~~piilvgnK~Dl~~r~v~---~~e~~~~  139 (170)
T cd04116          75 ---------Y---RGSDCCLLTFAVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVVLGNKNDIPERQVS---TEEAQAW  139 (170)
T ss_pred             ---------E---ECCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCHHHHCCCC---HHHHHHH
T ss_conf             ---------0---047733999978887999999999999999714457888409999611113037889---9999999


Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             753136898689998888899899999999872
Q gi|254780484|r  178 IRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       178 ~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ...  .+..+++.+||++|.||+++.+.+.+.+
T Consensus       140 a~~--~~~~~~~E~SAk~g~nV~~~F~~l~~~i  170 (170)
T cd04116         140 CRE--NGDYPYFETSAKDATNVAAAFEEAVRRV  170 (170)
T ss_pred             HHH--CCCCEEEEECCCCCCCHHHHHHHHHHCC
T ss_conf             998--5997899988888818899999999539


No 108
>cd04176 Rap2 Rap2 subgroup.  The Rap2 subgroup is part of the Rap subfamily of the Ras family.  It consists of Rap2a, Rap2b, and Rap2c.  Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton.  In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments.  In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway.  The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis.  Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation.  A number of additional effector proteins for Rap2 have been identified, incl
Probab=99.58  E-value=2e-14  Score=102.10  Aligned_cols=156  Identities=15%  Similarity=0.203  Sum_probs=88.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+++++......  .-.|+ ...  .  .............+.++||+|.........        
T Consensus         3 KivllGd~~VGKTsli~r~~~~~f~~--~y~pT-i~~--~--~~k~i~~~~~~~~l~iwDtaG~e~~~~~~~--------   67 (163)
T cd04176           3 KVVVLGSGGVGKSALTVQFVSGTFIE--KYDPT-IED--F--YRKEIEVDSSPSVLEILDTAGTEQFASMRD--------   67 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCCC--CCCCC-CCC--E--EEEEEEECCEEEEEEEEECCCCHHHHHHHH--------
T ss_conf             99998999978999999997098997--55885-233--1--679999888999999998988542567889--------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCH-----HHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             98777766420000011223578875-----4545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQ-----IDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                        ...   ......+.+.+......-     ....+.+.......|+++|.||+|+.....+..  ++.++.....   +
T Consensus        68 --~~~---~~a~~~ilvydit~~~Sf~~l~~~~~~i~~~~~~~~~piilVgNK~DL~~~r~V~~--~e~~~~a~~~---~  137 (163)
T cd04176          68 --LYI---KNGQGFIVVYSLVNQQTFQDIKPMRDQIVRVKGYEKVPIILVGNKVDLESEREVSS--AEGRALAEEW---G  137 (163)
T ss_pred             --HHH---CCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCH--HHHHHHHHHC---C
T ss_conf             --985---57865689712798899999999999999973899963999743134001276999--9999999985---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             86899988888998999999998728
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      -+++.+||++|.||+++.+.|.+.||
T Consensus       138 ~~~~E~SAk~~~nV~~~F~~l~~~i~  163 (163)
T cd04176         138 CPFMETSAKSKTMVNELFAEIVRQMN  163 (163)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHC
T ss_conf             98999856878177999999999539


No 109
>cd01868 Rab11_like Rab11-like.  Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=99.58  E-value=1.5e-14  Score=102.77  Aligned_cols=158  Identities=17%  Similarity=0.150  Sum_probs=85.8

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      +-+|+++|.++||||||++++++.+-..  ...|+.....    .............+.++||+|.+........     
T Consensus         3 ~~Kiv~iGd~~VGKTsli~r~~~~~f~~--~~~~Tig~~~----~~k~i~~~~~~~~l~iwDtaG~e~~~~~~~~-----   71 (165)
T cd01868           3 LFKIVLIGDSGVGKSNLLSRFTRNEFNL--DSKSTIGVEF----ATRSIQIDGKTIKAQIWDTAGQERYRAITSA-----   71 (165)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHCCCCC--CCCCCCCEEE----EEEEEEECCEEEEEEEEECCCCHHHHHHHHH-----
T ss_conf             5899999999978999999997298999--8898744787----8999999999999999989997212678998-----


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCC--CHHHH--HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             89987777664200000112235788--75454--554321025753221222211110246899999999997531368
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGV--KQIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~--~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                           ..   ......+.+.+.....  .....  ...........|++++.||+|+.....+.  .++..+.....   
T Consensus        72 -----~~---~~a~~~ilvydit~~~Sf~~i~~w~~~i~~~~~~~~~iilVgnK~DL~~~r~Vs--~~e~~~~a~~~---  138 (165)
T cd01868          72 -----YY---RGAVGALLVYDITKKQTFENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVP--TEEAKAFAEKN---  138 (165)
T ss_pred             -----HH---HHCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHCCCC--HHHHHHHHHHC---
T ss_conf             -----73---320514898626988999999999999998555773598702347868857888--99999999985---


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             98689998888899899999999872
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +.+++.+||++|.||+++.+.|.+.|
T Consensus       139 ~~~~~E~SAk~g~nV~e~F~~l~~~i  164 (165)
T cd01868         139 GLSFIETSALDGTNVEEAFKQLLTEI  164 (165)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             99799967888929899999999986


No 110
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=99.58  E-value=1.1e-14  Score=103.66  Aligned_cols=156  Identities=20%  Similarity=0.176  Sum_probs=85.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||++++++.+....  ..|+.....    .............+.++||+|............    
T Consensus         1 ~KivvvG~~~vGKTsli~r~~~~~f~~~--~~~ti~~~~----~~~~~~~~~~~~~l~iwDt~g~~~~~~~~~~~~----   70 (161)
T cd01863           1 LKILLIGDSGVGKSSLLLRFTDDTFDPD--LAATIGVDF----KVKTLTVDGKKVKLAIWDTAGQERFRTLTSSYY----   70 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCCCC--CCCCCCCCC----EEEEEEECCEEEEEEEEECCCCCCCCCCHHHHH----
T ss_conf             9899999799579999999963999998--487313342----389999999999999999999842353422441----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--C---HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             9987777664200000112235788--7---5454554321025753221222211110246899999999997531368
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--K---QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~---~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                               ...+..+++.+.....  .   .....+.........|.+++.||+|+....-..   +..++.....   
T Consensus        71 ---------~~a~~~ilvfd~~~~~Sf~~i~~~~~~i~~~~~~~~~~~ilVgnK~D~~~~~v~~---~~~~~~a~~~---  135 (161)
T cd01863          71 ---------RGAQGVILVYDVTRRDTFTNLETWLNELETYSTNNDIVKMLVGNKIDKENREVTR---EEGLKFARKH---  135 (161)
T ss_pred             ---------HHCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCH---HHHHHHHHHC---
T ss_conf             ---------3215348997678265699999999999985688887378873104400068999---9999999986---


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             98689998888899899999999872
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +-+++.+||++|.||+++.+.|.+.|
T Consensus       136 ~~~y~e~Sak~g~nV~~~F~~l~~~i  161 (161)
T cd01863         136 NMLFIETSAKTRDGVQQAFEELVEKI  161 (161)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHC
T ss_conf             99999971586815999999999709


No 111
>cd04168 TetM_like Tet(M)-like subfamily.  Tet(M), Tet(O), Tet(W), and OtrA are tetracycline resistance genes found in Gram-positive and Gram-negative bacteria.  Tetracyclines inhibit protein synthesis by preventing aminoacyl-tRNA from binding to the ribosomal acceptor site.  This subfamily contains tetracycline resistance proteins that function through ribosomal protection and are typically found on mobile genetic elements, such as transposons or plasmids, and are often conjugative.  Ribosomal protection proteins are homologous to the elongation factors EF-Tu and EF-G.  EF-G and Tet(M) compete for binding on the ribosomes.  Tet(M) has a higher affinity than EF-G, suggesting these two proteins may have overlapping binding sites and that Tet(M) must be released before EF-G can bind.  Tet(M) and Tet(O) have been shown to have ribosome-dependent GTPase activity.  These proteins are part of the GTP translation factor family, which includes EF-G, EF-Tu, EF2, LepA, and SelB.
Probab=99.58  E-value=6.5e-14  Score=99.12  Aligned_cols=165  Identities=22%  Similarity=0.280  Sum_probs=108.7

Q ss_pred             EEEECCCCCCHHHHHHHHH---CC-CCEEEECCCCCEE------EECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH
Q ss_conf             9997489988989999973---89-7379873888414------521202665556785089649999760010111224
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILV---NR-KNLARTSNAPGRT------QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~---g~-~~~a~~~~~p~tt------~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~  101 (212)
                      |||+|+.++|||||.-+|+   |. ++...+....+++      +..+.+.........+.+..+.++||||+..+..  
T Consensus         2 iai~gH~~~GKTtL~e~lL~~~g~i~r~G~v~~g~t~~D~~~eE~~r~isi~~~~~~~~~~~~~~n~iDtPG~~dF~~--   79 (237)
T cd04168           2 IGILAHVDAGKTTLTESLLYTSGAIRKLGSVDKGTTRTDTMELERQRGITIFSAVASFQWEDTKVNLIDTPGHMDFIA--   79 (237)
T ss_pred             EEEECCCCCCHHHHHHHHHHHCCHHHHCCCEECCCCCCCCHHHHHHHCCEEEEEEEEEEECCEEEEEEECCCCHHHHH--
T ss_conf             899938998999999999996571222663306830378549989848703105899998998799988988465666--


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH-----
Q ss_conf             478988889987777664200000112235788754545543210257532212222111102468999999999-----
Q gi|254780484|r  102 KNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKY-----  176 (212)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~-----  176 (212)
                                 .........+..+.+.+...+...+.....+.....+.|.++++||+|.-..+.. ..++.+++     
T Consensus        80 -----------e~~~al~~~D~av~Vv~a~~Gv~~~t~~~~~~~~~~~~P~iifiNKmDre~adf~-~~l~~i~~~l~~~  147 (237)
T cd04168          80 -----------EVERSLSVLDGAILVISAVEGVQAQTRILWRLLRKLNIPTIIFVNKIDRAGADLE-KVYQEIKEKLSSD  147 (237)
T ss_pred             -----------HHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCHH-HHHHHHHHHHCCC
T ss_conf             -----------8988976348169999658882234499999999859985998624457899999-9999999997897


Q ss_pred             ---------------------------------HHHHC--------------------CCCCCCEEEEECCCCCCHHHHH
Q ss_conf             ---------------------------------97531--------------------3689868999888889989999
Q gi|254780484|r  177 ---------------------------------LIRNY--------------------PTAHPEVIPTSSVKRKGIEVLR  203 (212)
Q Consensus       177 ---------------------------------~~~~~--------------------~~~~~~i~~vSA~~g~Gi~eL~  203 (212)
                                                       ++..|                    .....|+++-||.++.|+.+|.
T Consensus       148 ~~p~~~p~~~~~~~~~~~~~~~liE~vae~DD~LlEkyLe~~elt~eel~~~L~~~~~~g~i~PV~~GSA~~n~GV~~LL  227 (237)
T cd04168         148 IVPMQKVGLAPNICETNEIDDEFWETLAEGDDELLEKYLEGGPIEELELDNELSARIAKRKVFPVYHGSALKGIGIEELL  227 (237)
T ss_pred             EEEEECCCCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHH
T ss_conf             47677775556644454410889998764699999988578986788999999999974929889967899895999999


Q ss_pred             HHHHHHH
Q ss_conf             9999872
Q gi|254780484|r  204 KAILETI  210 (212)
Q Consensus       204 ~~I~~~l  210 (212)
                      +.|.+.+
T Consensus       228 d~i~~~~  234 (237)
T cd04168         228 EGITKLF  234 (237)
T ss_pred             HHHHHHC
T ss_conf             9999877


No 112
>cd04142 RRP22 RRP22 subfamily.  RRP22 (Ras-related protein on chromosome 22) subfamily consists of proteins that inhibit cell growth and promote caspase-independent cell death.  Unlike most Ras proteins, RRP22 is down-regulated in many human tumor cells due to promoter methylation.  RRP22 localizes to the nucleolus in a GTP-dependent manner, suggesting a novel function in modulating transport of nucleolar components.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Like most Ras family proteins, RRP22 is farnesylated.
Probab=99.58  E-value=1.3e-14  Score=103.17  Aligned_cols=166  Identities=16%  Similarity=0.126  Sum_probs=89.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||+++++..+..  ..-.||....    ..............+.++||||................
T Consensus         1 iKivvlG~~gVGKTsli~rf~~~~F~--~~y~pTig~~----~~~k~v~~dg~~~~l~IwDtag~~~~~~tagqe~~~~r   74 (198)
T cd04142           1 VRVAVLGAPGVGKTAIVRQFLAQEFP--EEYIPTEHRR----LYRPAVVLSGRVYDLHILDVPNMQRYPGTAGQEWMDPR   74 (198)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEE----EEEEEEEECCEEEEEEEEECCCCCCCCCCCCHHHHHHH
T ss_conf             98999997998999999999719888--8747846616----78999999999999999958773045556521235556


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCC--HHH---HHHHH--HHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             99877776642000001122357887--545---45543--210257532212222111102468999999999975313
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVK--QID---QDVFS--FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP  182 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~---~~~~~--~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~  182 (212)
                      ..  ..   ......+.+.+......  ...   .++.+  .......|+++|.||+|+.....+..  +........  
T Consensus        75 ~~--~i---r~a~~~ilVydvt~~~SF~~v~~~~~~i~~~~~~~~~~~piiLVGNK~DL~~~R~v~~--~~~~~~a~~--  145 (198)
T cd04142          75 FR--GL---RNSRAFILVYDICSPDSFHYVKLLRQQILETRPAGNKEPPIVVVGNKRDQQRHRFAPR--HVLSVLVRK--  145 (198)
T ss_pred             HH--HC---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCH--HHHHHHHHH--
T ss_conf             44--01---4688899999886778889999999999998514799982899834543100356889--999999985--


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             6898689998888899899999999872
Q gi|254780484|r  183 TAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       183 ~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .++-+++.+||++|.||+++++.|...+
T Consensus       146 ~~~~~f~EtSAK~~~nV~~~F~~lvr~i  173 (198)
T cd04142         146 SWKCGYLECSAKYNWHILLLFKELLISA  173 (198)
T ss_pred             CCCCEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             1997699887889969899999999999


No 113
>cd04113 Rab4 Rab4 subfamily.  Rab4 has been implicated in numerous functions within the cell.  It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A.  Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane.  It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p
Probab=99.57  E-value=8.8e-15  Score=104.12  Aligned_cols=156  Identities=14%  Similarity=0.104  Sum_probs=85.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||++++++.+..  ....|+....    ..............+.++||+|.+.......        
T Consensus         2 Kivl~Gd~~vGKTsli~r~~~~~f~--~~~~~Tig~~----~~~k~~~~~~~~~~l~iwDtaG~e~~~~~~~--------   67 (161)
T cd04113           2 KFIIIGSSGTGKSCLLHRFVENKFK--EDSQHTIGVE----FGSKIIRVGGKRVKLQIWDTAGQERFRSVTR--------   67 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEE----EEEEEEEECCEEEEEEEEECCCCHHHHHHHH--------
T ss_conf             8999994996799999999729899--9879976457----8999999999999999998999701226789--------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCC--CCHHHHH--HHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             98777766420000011223578--8754545--5432102575322122221111024689999999999753136898
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHG--VKQIDQD--VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP  186 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~--~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (212)
                        ...   .-....+.+.+....  +......  ..........|++++.||+|+..+..+..  ++..+....   .+-
T Consensus        68 --~~~---~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~~~iilVgNK~Dl~~~r~V~~--~e~~~~a~~---~~~  137 (161)
T cd04113          68 --SYY---RGAAGALLVYDITNRTSFEALPTWLSDARALASPNIVVILVGNKSDLADQREVTF--LEASRFAQE---NGL  137 (161)
T ss_pred             --HHH---HCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHCCCCCH--HHHHHHHHH---CCC
T ss_conf             --984---0577789953689889999999999999986799964986034344000378899--999999998---599


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             689998888899899999999872
Q gi|254780484|r  187 EVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       187 ~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +++.+||++|.||+++.+.|.+.|
T Consensus       138 ~~~E~SAk~~~nV~e~F~~la~~i  161 (161)
T cd04113         138 LFLETSALTGENVEEAFLKCARSI  161 (161)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHC
T ss_conf             799974156905899999999709


No 114
>cd04120 Rab12 Rab12 subfamily.  Rab12 was first identified in canine cells, where it was localized to the Golgi complex.  The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported.  More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic
Probab=99.57  E-value=1.7e-14  Score=102.45  Aligned_cols=158  Identities=11%  Similarity=0.126  Sum_probs=88.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|-++||||||++++++.....  .-.|+....    ..............+.++||+|.+.+.........   
T Consensus         1 lKIvllGd~gVGKTsLi~rf~~~~F~~--~y~~Tig~d----~~~k~i~~~~~~v~l~IWDTaGqe~f~sl~~~yyr---   71 (202)
T cd04120           1 LQVIIIGSRGVGKTSLMRRFTDDTFCE--ACKSGVGVD----FKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYR---   71 (202)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCCC--CCCCCCCEE----EEEEEEEECCEEEEEEEEECCCCCCCCCCHHHHHH---
T ss_conf             989999979972999999995499999--879976468----89999999999999999979886124523578876---


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--CHHH--HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9987777664200000112235788--7545--45543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--KQID--QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~--~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                                -....+++.|.....  ....  ............|+++|.||+|+....++.  .++..+....+  .+
T Consensus        72 ----------~a~~~ilVyDit~~~SF~~l~~W~~~i~~~~~~~~~iiLVGNK~DL~~~R~Vs--~~e~~~~A~~~--~~  137 (202)
T cd04120          72 ----------SAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREIS--RQQGEKFAQQI--TG  137 (202)
T ss_pred             ----------HHCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHCCCC--HHHHHHHHHHC--CC
T ss_conf             ----------41445899856888999999999999997466887189876536505317879--99999999827--99


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -.++.+||++|.||+++++.|.+.+
T Consensus       138 ~~f~EtSAkt~~nV~e~F~~l~~~i  162 (202)
T cd04120         138 MRFCEASAKDNFNVDEIFLKLVDDI  162 (202)
T ss_pred             CEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             8899925899969899999999999


No 115
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=99.57  E-value=3.8e-14  Score=100.47  Aligned_cols=160  Identities=13%  Similarity=0.110  Sum_probs=85.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEE-ECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             689997489988989999973897379873888414521202665556785-0896499997600101112244789888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK-NNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~-~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      .+|+++|-++||||||+++++.....-.....|+.-..    ......... .....+.++||+|.+........     
T Consensus         1 iKivllGd~gVGKTsli~r~~~~~~~f~~~y~~Tig~~----~~~k~~~~~~~~~i~l~iwDtaG~e~~~~l~~~-----   71 (164)
T cd04101           1 LRCAVVGDPAVGKTAFVQMFHSNGAVFPKNYLMTTGCD----FVVKEVPVDTDNTVELFIFDSAGQELYSDMVSN-----   71 (164)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCEE----EEEEEEEECCCCEEEEEEEECCCCCCHHHHHHH-----
T ss_conf             99999995995889999999978886688888864578----899999978997999999979998400678999-----


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCH-HHHHHHHHH--CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             8998777766420000011223578875-454554321--0257532212222111102468999999999975313689
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGVKQ-IDQDVFSFL--DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                           ..   ......+.+.+......- .........  .....|.+++.||+|+.+..++.  .++.++....+   +
T Consensus        72 -----~~---~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~p~ilVgNK~DL~~~r~V~--~~e~~~~a~~~---~  138 (164)
T cd04101          72 -----YW---ESPSVFILVYDVSNKASFENCSRWVNKVRTASKHMPGVLVGNKMDLADKAEVT--DAQAQAFAQAN---Q  138 (164)
T ss_pred             -----HH---HHCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCC--HHHHHHHHHHC---C
T ss_conf             -----97---64268999970774668999999999999766898689998722445245569--99999999988---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             86899988888998999999998728
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      -+++.+||++|.||+++.+.|.+.++
T Consensus       139 ~~~~E~SAk~g~nV~e~F~~lar~~~  164 (164)
T cd04101         139 LKFFKTSALRGVGYEEPFESLARAFH  164 (164)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHC
T ss_conf             98999866889098999999999869


No 116
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=99.57  E-value=5.7e-15  Score=105.18  Aligned_cols=58  Identities=33%  Similarity=0.561  Sum_probs=45.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHH
Q ss_conf             66868999748998898999997389737987388841452120266555678508964999976001
Q gi|254780484|r   27 AGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGY   94 (212)
Q Consensus        27 ~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~   94 (212)
                      ....+|++||+||||||||+|+|.|++ .+.+++.||+|+....         ..-...+.++||||.
T Consensus       100 ~~~i~v~ivG~PNVGKSSlIN~L~g~k-~~~vs~~PG~Tr~~q~---------i~~~~~i~liDTPGi  157 (157)
T cd01858         100 KKQISVGFIGYPNVGKSSIINTLRSKK-VCKVAPIPGETKVWQY---------ITLMKRIYLIDCPGV  157 (157)
T ss_pred             CCCEEEEEEECCCCCHHHHHHHHHCCC-EEEECCCCCEEEEEEE---------EEECCCEEEEECCCC
T ss_conf             564699998258853368898872673-5886598833777799---------996899999969099


No 117
>cd01885 EF2 EF2 (for archaea and eukarya).  Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes.  The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome.  The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins.  Two major mechanisms are known to regulate protein elongation and both involve eEF2.  First, eEF2 can be modulated by reversible phosphorylation.  Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes.  Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2.  In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation.  Seco
Probab=99.57  E-value=7.4e-14  Score=98.80  Aligned_cols=166  Identities=19%  Similarity=0.277  Sum_probs=102.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEE---------ECCEEEE----------EEEEEEEECCCEEEEEEC
Q ss_conf             899974899889899999738973798738884145---------2120266----------555678508964999976
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ---------HLNFFVP----------KDFSNLKNNLPAMALVDM   91 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~---------~~~~~~~----------~~~~~~~~~~~~~~~~Dt   91 (212)
                      .|||+|+..+|||||+.+|..+.... .....+.++         ..+.+..          ............+.++||
T Consensus         2 Ni~iigHvdhGKTTL~D~Ll~~~g~i-~~~~~g~~~~~D~~~~E~eRgiTIks~~isl~~~~~~~~~~~~~~~~inlIDT   80 (222)
T cd01885           2 NICIIAHVDHGKTTLSDSLLASAGII-SEKLAGKARYMDSREDEQERGITMKSSAISLYFEYEEEDKADGNEYLINLIDS   80 (222)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCC-CHHCCCCEEECCCHHHHHHCCCEEEEEEEEEEEEECCCCCCCCCCEEEEEEEC
T ss_conf             69998668877999999999985984-12106634651424334205415862268999860344345688638999728


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC------CHH
Q ss_conf             00101112244789888899877776642000001122357887545455432102575322122221111------024
Q gi|254780484|r   92 PGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL------SPT  165 (212)
Q Consensus        92 pG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~------~~~  165 (212)
                      ||+..+..             .........+.++.++++..+...+...........+.|.++++||+|.+      +++
T Consensus        81 PGH~dF~~-------------ev~~al~~~DgailVVDa~eGv~~qT~~vl~~a~~~~l~~il~iNKiDRli~el~l~p~  147 (222)
T cd01885          81 PGHVDFSS-------------EVTAALRLCDGALVVVDAVEGVCVQTETVLRQALKERVKPVLVINKIDRLILELKLSPE  147 (222)
T ss_pred             CCHHHHHH-------------HHHHHHHHCCEEEEEECCCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHCCCCHH
T ss_conf             85698999-------------99999985681799610457857789999999998599979999890365001179989


Q ss_pred             HH----HHHHHHHHHHHHHC---------------CCCCCCEEEEECCCCCCHH--------HHHHHHHHHH
Q ss_conf             68----99999999997531---------------3689868999888889989--------9999999872
Q gi|254780484|r  166 TA----QETLEKTKYLIRNY---------------PTAHPEVIPTSSVKRKGIE--------VLRKAILETI  210 (212)
Q Consensus       166 ~~----~~~~~~~~~~~~~~---------------~~~~~~i~~vSA~~g~Gi~--------eL~~~I~~~l  210 (212)
                      +.    ...++.+...+..+               .....++++.||+.|+++.        .|.+.|.+.+
T Consensus       148 day~~l~~iie~vN~~i~~~~~~~~~~~~~~~~~~~p~~gnV~f~Sa~~Gw~f~l~~fa~ly~ll~~iv~~i  219 (222)
T cd01885         148 EAYQRLARIIEQVNAIIGTYADEEFKEKDDEKWYFSPQKGNVAFGSALHGWGFTIIKFARIYAVLEMVVKHL  219 (222)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCHHHHCCCCCCCEEECCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             999999999999999998723043303553210207777838999832377126754121899999999628


No 118
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=99.57  E-value=1.5e-14  Score=102.86  Aligned_cols=154  Identities=18%  Similarity=0.210  Sum_probs=85.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+++++..+...  .-.|+...     ..............+.++||+|.+......         
T Consensus         3 KvvlvGd~~VGKTsli~r~~~~~F~~--~y~~Ti~~-----~~~k~~~i~~~~~~l~iwDtaG~e~~~~l~---------   66 (162)
T cd04138           3 KLVVVGAGGVGKSALTIQLIQNHFVD--EYDPTIED-----SYRKQVVIDGETCLLDILDTAGQEEYSAMR---------   66 (162)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCCC--CCCCCCCC-----EEEEEEEECCEEEEEEEEECCCCCCCCHHH---------
T ss_conf             99998999988999999998392887--56885552-----799999999999999999799860111478---------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCC--C---HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             987777664200000112235788--7---54545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGV--K---QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~--~---~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                       ....   ......+.+.+.....  .   .....+.........|++++.||+|+.... +  ..++.++....+   +
T Consensus        67 -~~~~---~~a~~~ilvydvt~~~Sf~~v~~w~~~i~~~~~~~~~piilVgNK~Dl~~r~-V--~~~e~~~~a~~~---~  136 (162)
T cd04138          67 -DQYM---RTGEGFLCVFAINSRKSFEDIHTYREQIKRVKDSDDVPMVLVGNKCDLAART-V--SSRQGQDLAKSY---G  136 (162)
T ss_pred             -HHHH---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCHHHCC-C--CHHHHHHHHHHC---C
T ss_conf             -9871---5787799996179889999899999999985488885499997653564555-8--899999999980---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++.+||++|.||+++.+.|.+.|
T Consensus       137 ~~f~E~SAk~~~nV~e~F~~l~~~I  161 (162)
T cd04138         137 IPYIETSAKTRQGVEEAFYTLVREI  161 (162)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHC
T ss_conf             9899973899859899999999963


No 119
>cd04167 Snu114p Snu114p subfamily.  Snu114p is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle.  U5 is a component of the spliceosome, which catalyzes the splicing of pre-mRNA to remove introns.  Snu114p is homologous to EF-2, but typically contains an additional N-terminal domain not found in Ef-2.  This protein is part of the GTP translation factor family and the Ras superfamily, characterized by five G-box motifs.
Probab=99.57  E-value=2.1e-13  Score=96.21  Aligned_cols=167  Identities=20%  Similarity=0.263  Sum_probs=105.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCC----CEEEECCCCCEE-------EECCEEEEEEEEEE-----EECCCEEEEEECCHH
Q ss_conf             89997489988989999973897----379873888414-------52120266555678-----508964999976001
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRK----NLARTSNAPGRT-------QHLNFFVPKDFSNL-----KNNLPAMALVDMPGY   94 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~----~~a~~~~~p~tt-------~~~~~~~~~~~~~~-----~~~~~~~~~~DtpG~   94 (212)
                      .|||+|+..+|||||+.+|...-    ........+++.       +..+.+........     ......+.++||||+
T Consensus         2 NvaiigHvdhGKTTL~d~Ll~~t~~~~~~~~~~~~~~~~~D~~~~E~eRgiTI~s~~~sl~~~~~~~k~~~inlIDTPGH   81 (213)
T cd04167           2 NVAIAGHLHHGKTSLLDMLIEQTHDLTPSGKDGWKPLRYTDIRKDEQERGISIKSSPISLVLPDSKGKSYLFNIIDTPGH   81 (213)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHCCCEECCEEEEEEECCCCCEEEEEEEECCCC
T ss_conf             59998278989899999999973445554044421135751646654203558614599998256675057877889872


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCC------CCHHH--
Q ss_conf             0111224478988889987777664200000112235788754545543210257532212222111------10246--
Q gi|254780484|r   95 GYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDK------LSPTT--  166 (212)
Q Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~------~~~~~--  166 (212)
                      ..+..             .........+.++.++++..+...+...........+.|.++++||+|.      +++++  
T Consensus        82 ~dF~~-------------ev~~al~~~DgailVVDa~eGv~~qT~~~l~~a~~~~l~~ilviNKiDRLi~el~l~p~day  148 (213)
T cd04167          82 VNFMD-------------EVAAALRLSDGVVLVVDVVEGVTSNTERLIRHAILEGLPIVLVINKIDRLILELKLPPNDAY  148 (213)
T ss_pred             HHHHH-------------HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHCCCCHHHHH
T ss_conf             41799-------------99988863776799998788875779999999998699989999882343144069989999


Q ss_pred             --HHHHHHHHHHHHHHCC--------CCCCCEEEEECCCCC--------CHHHHHHHHHHHH
Q ss_conf             --8999999999975313--------689868999888889--------9899999999872
Q gi|254780484|r  167 --AQETLEKTKYLIRNYP--------TAHPEVIPTSSVKRK--------GIEVLRKAILETI  210 (212)
Q Consensus       167 --~~~~~~~~~~~~~~~~--------~~~~~i~~vSA~~g~--------Gi~eL~~~I~~~l  210 (212)
                        ....++++...+..+.        ....++++.||+.|+        ++.+|.+.|.+++
T Consensus       149 ~~~~~ii~~vn~~i~~~~~~~~~~~~p~~~nV~f~Sa~~gw~ftl~~fa~~y~l~d~i~~~i  210 (213)
T cd04167         149 FKLRHIIDEVNNIIASFSTTLSFLFSPENGNVCFASSKFGFCFTLESFAKKYGLVDSIVSNI  210 (213)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEECCCCCCEEEEEECCCEEECCCCHHHHHHHHHHHHHHC
T ss_conf             98999999999999970787351656887969999700052123623211689999999638


No 120
>cd04177 RSR1 RSR1 subgroup.  RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi.  In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization.  The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site.  It is believed that cdc42 interacts directly with RSR1 in vivo.  In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha.  In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key featu
Probab=99.57  E-value=1.1e-14  Score=103.48  Aligned_cols=156  Identities=18%  Similarity=0.227  Sum_probs=87.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+++++..+..  ..-.|+.. .    ..............+.++||+|.+........       
T Consensus         3 KivlvGd~~VGKTsli~rf~~~~f~--~~y~pTi~-~----~~~k~i~i~~~~~~l~iwDtaG~e~~~~~~~~-------   68 (168)
T cd04177           3 KIVVLGAGGVGKSALTVQFVQNVFI--ESYDPTIE-D----SYRKQVEIDGRQCDLEILDTAGTEQFTAMREL-------   68 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCC-C----EEEEEEEECCEEEEEEEEECCCCCCCCCCHHH-------
T ss_conf             9999899997799999999619389--86588333-1----59999999999999999827886233345154-------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCC--HH---HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9877776642000001122357887--54---545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVK--QI---DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~---~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                         ..   ......+.+.+......  ..   .............|++++.||+|+.+...+..  ++..+....+  +.
T Consensus        69 ---~~---~~a~~~ilvydvt~~~Sf~~~~~~~~~i~~~~~~~~~piilvgNK~DL~~~r~v~~--~e~~~~a~~~--~~  138 (168)
T cd04177          69 ---YI---KSGQGFLLVYSVTSEASLNELGELREQVLRIKDSDNVPMVLVGNKADLEDDRQVSR--EDGVSLSQQW--GN  138 (168)
T ss_pred             ---HH---CCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHCCCCCH--HHHHHHHHHC--CC
T ss_conf             ---51---26866798536898889999999999999851788874898873146121376899--9999999974--99


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+++.+||++|.||+++.+.|.+.+
T Consensus       139 ~~~~E~SAk~~~nV~e~F~~l~~~i  163 (168)
T cd04177         139 VPFYETSARKRTNVDEVFIDLVRQI  163 (168)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             7799962487846899999999999


No 121
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division.  Among the Ras superfamily, Ran is a unique small G protein.  It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily.  Ran may therefore interact with a wide range of proteins in various intracellular locations.  Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors.  Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins.  The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is
Probab=99.57  E-value=2.6e-14  Score=101.41  Aligned_cols=152  Identities=11%  Similarity=0.102  Sum_probs=84.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+++++..+..  ....|+....    ..............+.++||+|.+........       
T Consensus         2 KivlvGd~~VGKTsli~r~~~~~f~--~~~~~Tig~~----~~~~~~~~~~~~v~l~iwDtaGqe~~~~l~~~-------   68 (166)
T cd00877           2 KLVLVGDGGTGKTTFVKRHLTGEFE--KKYVATLGVE----VHPLDFHTNRGKIRFNVWDTAGQEKFGGLRDG-------   68 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEE----EEEEEEEECCEEEEEEEEECCCCHHHHHHHHH-------
T ss_conf             8999999998889999999839999--9868732556----79999999997999999975787156668788-------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCC--C---HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             987777664200000112235788--7---54545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGV--K---QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~--~---~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                         ..   ......+.+.+.....  .   .+...+..  .....|+++|.||+|+.......+..    +...   ..+
T Consensus        69 ---y~---~~a~~~ilvyDvt~~~Sf~~v~~w~~~i~~--~~~~~piilVgNK~Dl~~~~~~~~~~----~~~~---~~~  133 (166)
T cd00877          69 ---YY---IGGQCAIIMFDVTSRVTYKNVPNWHRDLVR--VCGNIPIVLCGNKVDIKDRKVKAKQI----TFHR---KKN  133 (166)
T ss_pred             ---HH---CCCCEEEEECCCCCHHHHHHHHHHHHHHHH--HCCCCCEEEEEECCCCCCCCCCHHHH----HHHH---HCC
T ss_conf             ---74---006579984378988899999999999998--68999899999862175036679999----9999---789


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+++.+||++|.||+++.+.|.+.|
T Consensus       134 ~~~~EtSAk~~~nV~e~F~~la~~i  158 (166)
T cd00877         134 LQYYEISAKSNYNFEKPFLWLARKL  158 (166)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9899984589909899999999998


No 122
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=99.57  E-value=1.3e-14  Score=103.23  Aligned_cols=155  Identities=16%  Similarity=0.209  Sum_probs=86.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+++++......  .-.|+.. ..    .............+.++||+|.+........       
T Consensus         4 Kiv~lGd~~VGKTsli~r~~~~~f~~--~y~~Ti~-~~----~~k~~~~~~~~~~l~iwDtaG~e~~~~~~~~-------   69 (164)
T cd04145           4 KLVVVGGGGVGKSALTIQFIQSYFVT--DYDPTIE-DS----YTKQCEIDGQWAILDILDTAGQEEFSAMREQ-------   69 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCC--CCCCCEE-EE----EEEEEEECCEEEEEEEEECCCCCCCCHHHHH-------
T ss_conf             99999999978899999998098987--5678413-58----9999999999999999989886031256798-------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCC--H---HHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9877776642000001122357887--5---4545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVK--Q---IDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~--~---~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                         ..   ...+..+++.+......  .   ..............|++++.||+|+.....+.  .++..+....+   +
T Consensus        70 ---~~---~~a~~~ilvydi~~~~Sf~~~~~~~~~i~~~~~~~~~piilVgNK~DL~~~r~Vs--~~e~~~~a~~~---~  138 (164)
T cd04145          70 ---YM---RTGEGFLLVFSVTDRGSFEEVDKFHTQILRVKDRDEFPMILVGNKADLEHQRKVS--REEGQELARKL---K  138 (164)
T ss_pred             ---HH---CCCCCCEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHCCCC--HHHHHHHHHHC---C
T ss_conf             ---73---4678746898567354399999999999986188777526530345735408899--99999999981---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+++.+||++|.||+++.+.|.+.+
T Consensus       139 ~~~~E~SAk~~~nV~e~F~~l~~~I  163 (164)
T cd04145         139 IPYIETSAKDRLNVDKAFHDLVRVI  163 (164)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9899985486827799999999975


No 123
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=99.57  E-value=3.1e-14  Score=100.95  Aligned_cols=162  Identities=15%  Similarity=0.072  Sum_probs=84.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEE----EE--ECCCEEEEEECCHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567----85--0896499997600101112244
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSN----LK--NNLPAMALVDMPGYGYARAPKK  102 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~----~~--~~~~~~~~~DtpG~~~~~~~~~  102 (212)
                      +.+|+++|-++||||||++++++.+..  ..-.|+...............    ..  .....+.++||+|.+.......
T Consensus         4 ~~KivvvGd~~VGKTsli~r~~~~~f~--~~y~~Tig~~~~~k~i~~~~~~~~~~~~~~~~v~l~iwDtaGqe~~~~l~~   81 (180)
T cd04127           4 LIKFLALGDSGVGKTSFLYQYTDNKFN--PKFITTVGIDFREKRVVYNSSGPGGTLGRGQRIHLQLWDTAGQERFRSLTT   81 (180)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCCCEEEEEEEEEECCCCCCCCCCCCCEEEEEEEECCCCHHHHHHHH
T ss_conf             889999999998889999999619589--986884322688999998476554445788589999998988630478889


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC--CHH---HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             78988889987777664200000112235788--754---5455432102575322122221111024689999999999
Q gi|254780484|r  103 NVDSWGGLIVRYLSERSTLRCVYLLIDCRHGV--KQI---DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYL  177 (212)
Q Consensus       103 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~---~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~  177 (212)
                      .          ..   ......+.+.+.....  ...   ..++.........|++++.||+|+.....+.  .++..+.
T Consensus        82 ~----------~~---~~a~~~ilvydit~~~Sf~~l~~w~~~i~~~~~~~~~~iilVGNK~DL~~~r~V~--~~e~~~~  146 (180)
T cd04127          82 A----------FF---RDAMGFLLIFDLTNEQSFLNVRNWMSQLQTHAYCENPDIVLCGNKADLEDQRQVS--EEQAKAL  146 (180)
T ss_pred             H----------HH---HHHCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHCCCCC--HHHHHHH
T ss_conf             9----------98---7543658999689889999899999999985466898578750323667508889--9999999


Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             753136898689998888899899999999872
Q gi|254780484|r  178 IRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       178 ~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ...+   +-+++.+||++|.||+++.+.|.+.+
T Consensus       147 a~~~---~~~~~E~SAk~g~nV~e~F~~l~~~i  176 (180)
T cd04127         147 ADKY---GIPYFETSAATGTNVEKAVERLLDLV  176 (180)
T ss_pred             HHHC---CCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9984---99799980377919899999999999


No 124
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=99.57  E-value=1.9e-14  Score=102.17  Aligned_cols=158  Identities=13%  Similarity=0.096  Sum_probs=86.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      +.+|+++|-++||||||++++++.+-.  ....|+....    ..............+.++||+|.+..........   
T Consensus         7 ~~KivllGd~~VGKTsli~r~~~~~f~--~~~~~Tig~d----~~~k~i~~~~~~v~l~iwDtaG~e~~~~l~~~~~---   77 (169)
T cd04114           7 LFKIVLIGNAGVGKTCLVRRFTQGLFP--PGQGATIGVD----FMIKTVEIKGEKIKLQIWDTAGQERFRSITQSYY---   77 (169)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEE----EEEEEEEECCEEEEEEEEECCCCCCCCCCHHHHH---
T ss_conf             989999998997999999999859899--9867741247----8999999999999999998999844451557774---


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCC--CHHH--HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             89987777664200000112235788--7545--4554321025753221222211110246899999999997531368
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGV--KQID--QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~--~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                                ......+.+.+.....  ....  ............|.++|.||+|+..+.++..  +..++....   .
T Consensus        78 ----------~~a~~~ilvydvt~~~Sf~~l~~w~~~i~~~~~~~~~~ilVGNK~DL~~~r~v~~--~~~~~~a~~---~  142 (169)
T cd04114          78 ----------RSANALILTYDITCEESFRCLPEWLREIEQYANNKVITILVGNKIDLAERREVSQ--QRAEEFSDA---Q  142 (169)
T ss_pred             ----------HCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHCCCCCH--HHHHHHHHH---C
T ss_conf             ----------2366459981489888999999999999986898863897311343454178899--999999998---8


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             98689998888899899999999872
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +-+++.+||++|+||+++.+.|...|
T Consensus       143 ~~~~~E~SAktg~nV~e~F~~la~~l  168 (169)
T cd04114         143 DMYYLETSAKESDNVEKLFLDLACRL  168 (169)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             99999986898808899999999987


No 125
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily.  Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus.  Arl5 is developmentally regulated during embryogenesis in mice.  Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion.  Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library.  It is found in brain, heart, lung, cartilage, and kidney.  No function has been assigned for Arl8 to date.
Probab=99.57  E-value=1.6e-14  Score=102.64  Aligned_cols=158  Identities=15%  Similarity=0.194  Sum_probs=91.9

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHH
Q ss_conf             88766868999748998898999997389737987388841452120266555678508964999976001011122447
Q gi|254780484|r   24 LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKN  103 (212)
Q Consensus        24 ~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~  103 (212)
                      +|+-. -+|.++|.+|||||||+++|...+. ..+  .|+..  .+      ..........+.+.||+|.......-..
T Consensus        11 ~~~k~-~KililG~~~sGKTsil~~l~~~~~-~~~--~pT~G--~~------~~~i~~~~~~~~iwD~~G~e~~~~~~~~   78 (174)
T cd04153          11 FPRKE-YKVIIVGLDNAGKTTILYQFLLGEV-VHT--SPTIG--SN------VEEIVYKNIRFLMWDIGGQESLRSSWNT   78 (174)
T ss_pred             CCCCE-EEEEEECCCCCCHHHHHHHHHCCCC-CCC--CCCCC--CC------EEEEEECCEEEEEEECCCCCCCCCHHHH
T ss_conf             58977-9999998999988999999973992-771--67236--04------6999978889999989998656622677


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC--HHHHHH---HHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             89888899877776642000001122357887--545455---4321025753221222211110246899999999997
Q gi|254780484|r  104 VDSWGGLIVRYLSERSTLRCVYLLIDCRHGVK--QIDQDV---FSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLI  178 (212)
Q Consensus       104 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~---~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~  178 (212)
                                +   ......++++.|......  .....+   .........|++++.||+|+-+.....+..+...  +
T Consensus        79 ----------y---~~~a~~ii~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~pili~~NK~Dl~~~~~~~ei~~~l~--l  143 (174)
T cd04153          79 ----------Y---YTNTDAVILVIDSTDRERLPLTKEELYKMLAHEDLRKAVLLVLANKQDLKGAMTPAEISESLG--L  143 (174)
T ss_pred             ----------H---HCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHH--H
T ss_conf             ----------7---057753799997678889999999999997261016982899995555655789999999974--7


Q ss_pred             HHCCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             531368986899988888998999999998
Q gi|254780484|r  179 RNYPTAHPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       179 ~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      .........++++||++|+|+++..+.|.+
T Consensus       144 ~~~~~~~~~~~~~SAktG~Gv~e~f~wLa~  173 (174)
T cd04153         144 TSIRDHTWHIQGCCALTGEGLPEGLDWIAS  173 (174)
T ss_pred             HHHHCCCCEEEEEECCCCCCHHHHHHHHHC
T ss_conf             776359809999668589198999999866


No 126
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=99.56  E-value=1.6e-14  Score=102.62  Aligned_cols=155  Identities=18%  Similarity=0.221  Sum_probs=86.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+++++..+..  ..-.|+. ...    .............+.++||+|.+......         
T Consensus         2 Kiv~vGd~~vGKTsli~r~~~~~f~--~~y~~Ti-~~~----~~k~i~~~~~~~~l~iwDt~G~e~~~~~~---------   65 (164)
T smart00173        2 KLVVLGSGGVGKSALTIQFVQGHFV--DDYDPTI-EDS----YRKQIEIDGEVCLLDILDTAGQEEFSAMR---------   65 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCE-EEE----EEEEEEECCEEEEEEEEECCCCCCHHHHH---------
T ss_conf             8999999997899999999729799--8778813-678----99999999999999999899971035677---------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCC-----HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9877776642000001122357887-----54545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVK-----QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                       ....   ......+.+.+......     .....+.........|++++.||+|+.....+.  .++..+....+   +
T Consensus        66 -~~~~---~~a~~~ilvydi~~~~Sf~~~~~~~~~i~~~~~~~~~piilvgnK~DL~~~r~V~--~~e~~~~a~~~---~  136 (164)
T smart00173       66 -DQYM---RTGEGFLLVYSITDRQSFEEIKKFREQILRVKDRDDVPIVLVGNKCDLESERVVS--TEEGKELARQW---G  136 (164)
T ss_pred             -HHHC---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHCCCCC--HHHHHHHHHHC---C
T ss_conf             -7753---7987799983079889999999999999986188888668777534630117899--99999999983---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+++.+||++|.||+++.+.|.+.|
T Consensus       137 ~~~~E~SAk~g~nV~~~F~~l~~~i  161 (164)
T smart00173      137 CPFLETSAKERVNVDEAFYDLVREI  161 (164)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9899985898817899999999999


No 127
>cd04125 RabA_like RabA-like subfamily.  RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells.  The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression.  The function of RabA remains unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=99.56  E-value=2.6e-14  Score=101.43  Aligned_cols=156  Identities=16%  Similarity=0.168  Sum_probs=86.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||++++++....  ....|+.....    .............+.++||+|.+........       
T Consensus         2 KivvvGd~~VGKTsli~r~~~~~f~--~~~~~Tig~~~----~~k~i~~~~~~~~l~iwDtaG~e~~~~l~~~-------   68 (188)
T cd04125           2 KVVIIGDYGVGKSSLLKRFTEDEFS--ESTKSTIGVDF----KIKTVYIENKIIKLQIWDTNGQERFRSLNNS-------   68 (188)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEEE----EEEEEEECCEEEEEEEEECCCCHHHHHHHHH-------
T ss_conf             7999999997899999999519689--98688654035----7999999999999999989997104578999-------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCC--HHHH--HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             9877776642000001122357887--5454--55432102575322122221111024689999999999753136898
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVK--QIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP  186 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~--~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (212)
                         ..   ....+.+.+.+......  ....  ...........|++++.||+|+.+...+...  ..++....+   +-
T Consensus        69 ---~~---~~a~~~ilvydit~~~Sf~~l~~w~~~i~~~~~~~~~iilvgNK~DL~~~r~V~~~--e~~~~a~~~---~~  137 (188)
T cd04125          69 ---YY---RGAHGYLLVYDVTDQESFENLKFWINEINRYARENVIKVIVANKSDLVNNKVVDSN--IAKSFCDSL---NI  137 (188)
T ss_pred             ---HH---CCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCHHHHHHCCCCCHH--HHHHHHHHC---CC
T ss_conf             ---86---37867999803898789999999999999878986624510013447660679999--999999986---99


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             689998888899899999999872
Q gi|254780484|r  187 EVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       187 ~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +++.+||++|.||+++++.|.+.+
T Consensus       138 ~~~E~SAktg~nV~e~F~~l~~~i  161 (188)
T cd04125         138 PFFETSAKQSINVEEAFILLVKLI  161 (188)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             899974788909899999999999


No 128
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=99.56  E-value=3.1e-14  Score=100.93  Aligned_cols=157  Identities=19%  Similarity=0.167  Sum_probs=86.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||++++++.+..   .....|....   ..............+.++||+|...........     
T Consensus         1 ~Ki~vvG~~~vGKTsli~r~~~~~f~---~~~~~ti~~~---~~~k~i~~~~~~~~l~iwDt~G~~~~~~~~~~~-----   69 (162)
T cd04123           1 FKVVLLGEGRVGKTSLVLRYVENKFN---EKHESTTQAS---FFQKTVNIGGKRIDLAIWDTAGQERYHALGPIY-----   69 (162)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCC---CCCCCCCEEE---EEEEEEEECCEEEEEEEEECCCCCCCCCCCHHH-----
T ss_conf             98999999996799999999839899---8767752647---999999999999999999589973035563133-----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCC--HHHH--HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             99877776642000001122357887--5454--5543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVK--QIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~--~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                           .   ...+..+.+.+......  ....  ...........|++++.||+|+.....+.  .++.++.....   +
T Consensus        70 -----~---~~a~~~ilv~d~t~~~Sf~~i~~~~~~i~~~~~~~~~iilvgnK~Dl~~~r~v~--~~e~~~~a~~~---~  136 (162)
T cd04123          70 -----Y---RDADGAILVYDITDADSFQKVKKWIKELKQMRGNNISLVIVGNKIDLERQRVVS--KSEAEEYAKSV---G  136 (162)
T ss_pred             -----E---ECCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHCCCC--HHHHHHHHHHC---C
T ss_conf             -----0---114457999638998999999999999998769997468663321325408889--99999999982---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++.+||++|.||+++.+.|.+.|
T Consensus       137 ~~y~e~Sak~g~nV~e~F~~l~~~i  161 (162)
T cd04123         137 AKHFETSAKTGKGIEELFLSLAKRM  161 (162)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             9899981278819899999999986


No 129
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=99.56  E-value=4.7e-14  Score=99.92  Aligned_cols=157  Identities=12%  Similarity=0.081  Sum_probs=86.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      -+|+++|.++||||||++++++.+..  ..-.|+.....    .............+.++||+|.+..........    
T Consensus         2 ~KivllGd~~VGKTsli~r~~~~~f~--~~y~~Tig~~~----~~k~i~~~~~~i~l~iwDtaGqe~~~~l~~~y~----   71 (165)
T cd01865           2 FKLLIIGNSSVGKTSFLFRYADDSFT--SAFVSTVGIDF----KVKTVFRNDKRVKLQIWDTAGQERYRTITTAYY----   71 (165)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCCCEEE----EEEEEEECCEEEEEEEEECCCCCCCCCCHHHHH----
T ss_conf             89999999996889999999249889--97688763787----999999999999999996999834554415441----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCC--HHH--HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             99877776642000001122357887--545--45543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVK--QID--QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~--~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                               ......+.+.+......  ...  ............|++++.||+|+.+...+.  .++.++.....   +
T Consensus        72 ---------~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~~~iilvgNK~DL~~~r~v~--~~~~~~~a~~~---~  137 (165)
T cd01865          72 ---------RGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVVS--SERGRQLADQL---G  137 (165)
T ss_pred             ---------HCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCCCCC--HHHHHHHHHHC---C
T ss_conf             ---------135448998517887999999999999998689872599960242355518899--99999999986---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++.+||++|.||+++.+.|.+.+
T Consensus       138 ~~~~E~SAk~~~nV~e~F~~l~~~i  162 (165)
T cd01865         138 FEFFEASAKENINVKQVFERLVDII  162 (165)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9799976898908899999999999


No 130
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=99.55  E-value=2.2e-14  Score=101.77  Aligned_cols=157  Identities=16%  Similarity=0.135  Sum_probs=85.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||+++++..+..  ....|+.....    .............+.++||+|.+......        
T Consensus         1 ~Ki~vvG~~~vGKTsli~r~~~~~f~--~~~~~Ti~~~~----~~~~i~~~~~~~~l~iwDt~G~e~~~~l~--------   66 (164)
T smart00175        1 FKIILIGDSGVGKSSLLSRFTDGKFS--EQYKSTIGVDF----KTKTIEVDGKRVKLQIWDTAGQERFRSIT--------   66 (164)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEEE----EEEEEEECCEEEEEEEEECCCCHHHHHHH--------
T ss_conf             98999998997799999999419999--98688456666----77999999999999999679944664779--------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--CHHHH--HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9987777664200000112235788--75454--5543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--KQIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~--~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                        ....   ....+.+.+.+.....  .....  ...........|++++.||+|+..+..+..  ++..+....+   +
T Consensus        67 --~~~~---~~~~~~ilvfdi~~~~Sf~~i~~w~~~i~~~~~~~~piilvgnK~Dl~~~r~V~~--~e~~~~a~~~---~  136 (164)
T smart00175       67 --SSYY---RGAVGALLVYDITNRESFENLKNWLKELREYADPNVVIMLVGNKSDLEDQRQVSR--EEAEAFAEEH---G  136 (164)
T ss_pred             --HHHH---CCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCHHHHCCCCH--HHHHHHHHHC---C
T ss_conf             --9883---3665368843689989999999999999986799982551164568565187999--9999999984---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++.+||++|+||+++.+.|.+.+
T Consensus       137 ~~~~e~SAk~~~~v~e~F~~l~~~i  161 (164)
T smart00175      137 LPFFETSAKTNTNVEEAFEELAREI  161 (164)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9799983166908899999999999


No 131
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2.  Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhi
Probab=99.55  E-value=3e-14  Score=101.09  Aligned_cols=157  Identities=17%  Similarity=0.116  Sum_probs=86.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||++++++.+..  ..-.|+.....    .............+.++||+|.........       
T Consensus         4 ~KivlvGd~~vGKTsli~r~~~~~f~--~~~~~Tig~~~----~~k~v~~~~~~i~l~iwDt~G~e~~~~~~~-------   70 (167)
T cd01867           4 FKLLLIGDSGVGKSCLLLRFSEDSFN--PSFISTIGIDF----KIRTIELDGKKIKLQIWDTAGQERFRTITT-------   70 (167)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEEE----EEEEEEECCEEEEEEEEECCCCCCHHHHHH-------
T ss_conf             99999999997889999999609999--98689864688----999999999999999998999700116679-------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--CHHHH--HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9987777664200000112235788--75454--5543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--KQIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~--~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                         ...   ......+.+.+.....  .....  ...........|.+++.||+|+.....+.  .++..+....+   +
T Consensus        71 ---~y~---~~a~~~ilvfdit~~~Sf~~~~~w~~~i~~~~~~~~~~ilVgNK~Dl~~~r~v~--~~e~~~~a~~~---~  139 (167)
T cd01867          71 ---AYY---RGAMGIILVYDITDEKSFENIRNWMRNIEEHASEDVERMLVGNKCDMEEKRVVS--KEEGEALADEY---G  139 (167)
T ss_pred             ---HHH---HHCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHCCCCC--HHHHHHHHHHH---C
T ss_conf             ---985---650588995568987999999999999998669997057642124502307799--99999999980---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++.+||++|.||+++.+.|.+.|
T Consensus       140 ~~~~e~SAktg~nI~e~F~~l~~~i  164 (167)
T cd01867         140 IKFLETSAKANINVEEAFFTLAKDI  164 (167)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9699982257907899999999999


No 132
>cd04147 Ras_dva Ras-dva subfamily.  Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date.  In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm.  Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1.  Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9.  Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=99.55  E-value=1.4e-14  Score=102.89  Aligned_cols=158  Identities=15%  Similarity=0.147  Sum_probs=86.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+++++..... .  .+..|...  .  .............+.++||+|.+.+...          
T Consensus         1 KIvvlGd~~VGKTSLi~rf~~~~F~-~--~y~~Ti~~--~--~~k~~~v~~~~v~l~i~DtaG~e~~~~l----------   63 (198)
T cd04147           1 RLVFMGAAGVGKTALIQRFLYDTFE-P--KYRRTVEE--M--HRKEYEVGGVSLTLDILDTSGSYSFPAM----------   63 (198)
T ss_pred             CEEEECCCCCCHHHHHHHHHHCCCC-C--CCCCCHHH--E--EEEEEEECCEEEEEEEEECCCCCCCHHH----------
T ss_conf             9899998997799999999859899-8--88887254--1--8899998997999999978775130145----------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCC--C---HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             987777664200000112235788--7---54545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGV--K---QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~--~---~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                      .....   ......+.+.+.....  .   .+...+.........|++++.||+|++.... ....++.......  ..+
T Consensus        64 ~~~~~---r~a~~~ilVyDit~~~Sf~~l~~w~~~i~~~~~~~~ipiilVGNK~Dll~~~R-~V~~~e~~~~a~~--~~~  137 (198)
T cd04147          64 RKLSI---QNSDAFALVYAVDDPESFEEVERLREEILEVKEDKFVPIVVVGNKADSLEEER-QVPAKDALSTVEL--DWN  137 (198)
T ss_pred             HHHHC---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCC-CCCHHHHHHHHHH--CCC
T ss_conf             55541---58866899961697799999999999999962888982899987876501047-8489999999985--599


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             86899988888998999999998728
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      -.++.+||++|.||+++++.|...++
T Consensus       138 ~~f~EtSAktg~nV~e~F~~l~r~i~  163 (198)
T cd04147         138 CGFVETSAKDNENVLEVFKELLRQAN  163 (198)
T ss_pred             CEEEECCCCCCCCHHHHHHHHHHHHC
T ss_conf             78998779999498999999999977


No 133
>cd01866 Rab2 Rab2 subfamily.  Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur
Probab=99.55  E-value=6.3e-14  Score=99.19  Aligned_cols=157  Identities=12%  Similarity=0.091  Sum_probs=86.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      -+|+++|.++||||||++++++.+-..  ...|+....    ..............+.++||+|.+.........     
T Consensus         5 ~KivlvGd~~VGKTsli~r~~~~~f~~--~~~~Tig~~----~~~k~i~~~~~~~~l~iwDt~G~e~~~~l~~~~-----   73 (168)
T cd01866           5 FKYIIIGDTGVGKSCLLLQFTDKRFQP--VHDLTIGVE----FGARMITIDGKQIKLQIWDTAGQESFRSITRSY-----   73 (168)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCCC--CCCCCCEEE----EEEEEEEECCEEEEEEEEECCCCCCCCCCHHHH-----
T ss_conf             899999989978899999991098999--878985078----899999999999999999799973346255888-----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--CHHHH--HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9987777664200000112235788--75454--5543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--KQIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~--~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                           .   ......+.+.+.....  .....  ...........|+++|.||+|+.....+.  .++.++....+   +
T Consensus        74 -----~---~~a~~~ilvydit~~~Sf~~l~~w~~~i~~~~~~~~~iiLVGNK~DL~~~r~V~--~~e~~~~a~~~---~  140 (168)
T cd01866          74 -----Y---RGAAGALLVYDITRRETFNHLTSWLEDARQHSNSNMTIMLIGNKCDLESRREVS--YEEGEAFAKEH---G  140 (168)
T ss_pred             -----H---HHHCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHCCCCC--HHHHHHHHHHC---C
T ss_conf             -----6---643689993445877999999999999998679996599843423545407789--99999999986---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+.+.+||++|.||+++.+.|.+.+
T Consensus       141 ~~~~E~SAk~~~nV~~~F~~l~~~i  165 (168)
T cd01866         141 LIFMETSAKTASNVEEAFINTAKEI  165 (168)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9999976788808899999999999


No 134
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=99.55  E-value=2.7e-14  Score=101.27  Aligned_cols=160  Identities=13%  Similarity=0.163  Sum_probs=93.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      ...-.+|.++|.+|||||||++.+...+..   ...||..    +    ...........+.++||+|....+..-..  
T Consensus        10 ~kk~~kililG~~~~GKTsil~~l~~~~~~---~~~pTvg----~----~~~~~~~~~~~l~iwD~~Gqe~~r~l~~~--   76 (175)
T smart00177       10 GNKEMRILMVGLDAAGKTTILYKLKLGESV---TTIPTIG----F----NVETVTYKNISFTVWDVGGQDKIRPLWRH--   76 (175)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHCCCCC---CCCCCCC----C----EEEEEEECCEEEEEEECCCCCCCCHHHHH--
T ss_conf             788899999988999989999999659977---7579788----1----07999989899999989998545536777--


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCC--HHHHHHHH---HHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             888899877776642000001122357887--54545543---2102575322122221111024689999999999753
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVK--QIDQDVFS---FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN  180 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~---~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~  180 (212)
                              +   -..+..++++.|......  .....+.+   .......|++++.||+|+.+.....+..+.+..  ..
T Consensus        77 --------Y---y~~a~~iIfVvD~sd~~~~~~~~~~l~~~l~~~~~~~~piLil~NK~Dl~~~~~~~ei~~~l~l--~~  143 (175)
T smart00177       77 --------Y---YTNTQGLIFVVDSNDRDRIDEAREELHRMLNEDELRDAVILVFANKQDLPDAMKAAEITEKLGL--HS  143 (175)
T ss_pred             --------H---CCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEECCCCCCCCCHHHHHHHHCH--HH
T ss_conf             --------5---5776189999866877899999999999963153169869999845667678899999999686--65


Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             1368986899988888998999999998728
Q gi|254780484|r  181 YPTAHPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       181 ~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      .......++++||++|+||+|..++|.+.|.
T Consensus       144 ~~~~~~~i~~~SA~tG~GI~e~f~wL~~~ik  174 (175)
T smart00177      144 IRDRNWYIQPTCATSGDGLYEGLTWLSNNLK  174 (175)
T ss_pred             HCCCCEEEEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             4079759998268789698999999999844


No 135
>cd04122 Rab14 Rab14 subfamily.  Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles.  Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments.  Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation.  In addition, Rab14 is believed to play a role in the regulation of phagocytosis.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GT
Probab=99.55  E-value=1.7e-14  Score=102.54  Aligned_cols=157  Identities=14%  Similarity=0.108  Sum_probs=87.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      -+|+++|-++||||||+++++..+-..   ..+.|..   ................+.++||+|.+..........    
T Consensus         3 ~KivlvGd~~VGKTsli~r~~~~~f~~---~~~~Tig---~~~~~k~i~~~~~~~~l~iwDtaG~e~~~~~~~~~~----   72 (166)
T cd04122           3 FKYIIIGDMGVGKSCLLHQFTEKKFMA---DCPHTIG---VEFGTRIIEVNGQKIKLQIWDTAGQERFRAVTRSYY----   72 (166)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCCC---CCCCCCC---EEEEEEEEEECCEEEEEEEEECCCCCCCCCCCHHHE----
T ss_conf             999999999957999999991298899---9999744---688999999999999999998999854442521114----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--CHHHHH--HHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9987777664200000112235788--754545--543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--KQIDQD--VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~--~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                               ......+.+.+.....  ......  ..........|+++|.||+|+....++.  .++..+....   .+
T Consensus        73 ---------~~a~~~ilvydvt~~~Sf~~l~~w~~~~~~~~~~~~~iilVGNK~DL~~~r~V~--~~e~~~~a~~---~~  138 (166)
T cd04122          73 ---------RGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLIGNKADLEAQRDVT--YEEAKQFADE---NG  138 (166)
T ss_pred             ---------ECCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHCCCCC--HHHHHHHHHH---CC
T ss_conf             ---------315465997258747679999999999998569997587034015744438999--9999999998---69


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+++.+||++|.||+++.+.|.+.|
T Consensus       139 ~~~~E~SAk~g~nV~e~F~~l~~~i  163 (166)
T cd04122         139 LLFLECSAKTGENVEDAFLETAKKI  163 (166)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9899986587808899999999999


No 136
>cd04104 p47_IIGP_like p47 (47-kDa) family.  The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1.  They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens.  p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma).  ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis.  TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro.  IRG-47 is involved in resistance to T. gondii infection.  LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections.  IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues.  In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=99.55  E-value=9.1e-14  Score=98.27  Aligned_cols=163  Identities=20%  Similarity=0.249  Sum_probs=103.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCC----CCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389----73798738884145212026655567850896499997600101112244789
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNR----KNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~----~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      .+||++|-+|+|||||||||.|-    +..|.+.-..+|. .+..       -.......+.++|+||............
T Consensus         2 l~iaVtGesGaGKSSfINAlRGl~~~d~~aA~tGv~eTT~-~~~~-------Y~~p~~pnv~lwDlPG~Gt~~f~~~~Yl   73 (197)
T cd04104           2 LNIAVTGESGAGKSSFINALRGVGHEEEGAAPTGVVETTM-KRTP-------YPHPKFPNVTLWDLPGIGSTAFPPDDYL   73 (197)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCC-CCEE-------CCCCCCCCCEEECCCCCCCCCCCHHHHH
T ss_conf             1799955899868999999868898877758888874677-8620-------4799999876972899998765989999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHH---------HHHHHHHHHH-
Q ss_conf             888899877776642000001122357887545455432102575322122221111024---------6899999999-
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPT---------TAQETLEKTK-  175 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~---------~~~~~~~~~~-  175 (212)
                      ...          .....+.+++-....+...+..+...+...++++.+|.+|+|.--..         ..++.++.++ 
T Consensus        74 ~~~----------~~~~yD~fiiiss~rf~~nd~~la~~i~~~gK~fyfVRsK~D~dl~n~~~~~p~~f~~e~~L~~IR~  143 (197)
T cd04104          74 EEM----------KFSEYDFFIIISSTRFSSNDVKLAKAIQCMGKKFYFVRTKVDRDLSNEQRSKPRSFNREQVLQEIRD  143 (197)
T ss_pred             HHC----------CCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHCCCCCCCHHHHHHHHHH
T ss_conf             865----------8554578999838864142699999999809928999861214000566378766599999999999


Q ss_pred             ---HHHHHCCCCCCCEEEEECCC--CCCHHHHHHHHHHHH
Q ss_conf             ---99753136898689998888--899899999999872
Q gi|254780484|r  176 ---YLIRNYPTAHPEVIPTSSVK--RKGIEVLRKAILETI  210 (212)
Q Consensus       176 ---~~~~~~~~~~~~i~~vSA~~--g~Gi~eL~~~I~~~l  210 (212)
                         +.+.......++++.||...  .+-+..|.+.|.+-|
T Consensus       144 ~c~~~L~~~gv~~p~VFLvS~~~~~~yDFp~L~~tl~~~L  183 (197)
T cd04104         144 NCLENLQEAGVSEPPVFLVSNFDPSDYDFPKLRETLLKDL  183 (197)
T ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             9999999869999998999379822077689999999980


No 137
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=99.55  E-value=2.1e-14  Score=101.96  Aligned_cols=156  Identities=16%  Similarity=0.197  Sum_probs=88.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+++++..+..  ..-.|+.. .    ..............+.++||+|..........       
T Consensus         3 KIvllGd~~VGKTsli~r~~~~~f~--~~y~pTi~-~----~~~k~i~~~~~~~~l~iwDtaG~e~~~~l~~~-------   68 (164)
T cd04175           3 KLVVLGSGGVGKSALTVQFVQGIFV--EKYDPTIE-D----SYRKQVEVDGQQCMLEILDTAGTEQFTAMRDL-------   68 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCEE-E----EEEEEEEECCEEEEEEECCCCCCHHHHHHHHH-------
T ss_conf             9999899997599999999709288--65688404-6----89999999999999985147754324567888-------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCC--HH---HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9877776642000001122357887--54---545543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVK--QI---DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~---~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                         ..   ......+.+.+......  ..   .............|++++.||+|+.+...+.  .+..+.....+   +
T Consensus        69 ---y~---~~a~~~ilvydvt~~~Sf~~~~~~~~~i~~~~~~~~~piilvgNK~DL~~~r~V~--~~~~~~~a~~~---~  137 (164)
T cd04175          69 ---YM---KNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVG--KEQGQNLARQW---G  137 (164)
T ss_pred             ---HH---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHCCCCC--HHHHHHHHHHC---C
T ss_conf             ---73---5786899996078777899999999999986289996399852145722206899--99999999985---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             86899988888998999999998728
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      -+++.+||++|.||+++.+.|.+.|+
T Consensus       138 ~~~~E~SAk~~~nV~~~F~~l~~~i~  163 (164)
T cd04175         138 CAFLETSAKAKINVNEIFYDLVRQIN  163 (164)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHHC
T ss_conf             99999668988178999999999866


No 138
>PTZ00141 elongation factor 1 alpha; Provisional
Probab=99.55  E-value=1.7e-13  Score=96.67  Aligned_cols=159  Identities=11%  Similarity=0.115  Sum_probs=101.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHC---------------------CCC--EEEECCCCCEEEECCEEEEEEEEEEEECCCEE
Q ss_conf             6899974899889899999738---------------------973--79873888414521202665556785089649
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVN---------------------RKN--LARTSNAPGRTQHLNFFVPKDFSNLKNNLPAM   86 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g---------------------~~~--~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~   86 (212)
                      .+|+++|+.++|||||+=+|+-                     +..  .|-..+.--..+..+.+.......+......+
T Consensus         8 l~i~~~GhVD~GKSTL~G~Ll~~~g~v~~~~~~~~~~~~~~~g~~~~~~a~~~D~~~~Er~rGiTidv~~~~f~t~~~~~   87 (443)
T PTZ00141          8 INLVVIGHVDSGKSTTTGHLIYKLGGIDKRTIEKFEKESAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYY   87 (443)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCEEHHHHCCCHHHHHCCCEEEEEEEEEECCCEEE
T ss_conf             59999947798288889999987388468899999888887178720004453077667636710734799994398899


Q ss_pred             EEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCH-------HHHHHHHHHCCCCCCC-CCCCCC
Q ss_conf             99976001011122447898888998777766420000011223578875-------4545543210257532-212222
Q gi|254780484|r   87 ALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQ-------IDQDVFSFLDKKAVSY-QIVLTK  158 (212)
Q Consensus        87 ~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~-~~v~nK  158 (212)
                      .++|+||+..+..             .+.......+..++++++..+..+       |..+........+.+. ++++||
T Consensus        88 ~iiD~PGH~~fi~-------------nmi~Gas~aD~ailvVdA~~G~~e~gf~~~gQTreH~~i~~~lgv~~iIVaVNK  154 (443)
T PTZ00141         88 TVIDAPGHRDFIK-------------NMITGTSQADVALLVVPAEVGGFEGAFSKEGQTREHALLAFTLGVKQIIVGINK  154 (443)
T ss_pred             EEEECCCHHHHHH-------------HHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEE
T ss_conf             9998997288899-------------999634107758999986778521346667863999999997399759999996


Q ss_pred             CCCCC--HHHHHHHHHHHHHHHHHCC--CCCCCEEEEECCCCCCHHH
Q ss_conf             11110--2468999999999975313--6898689998888899899
Q gi|254780484|r  159 IDKLS--PTTAQETLEKTKYLIRNYP--TAHPEVIPTSSVKRKGIEV  201 (212)
Q Consensus       159 ~D~~~--~~~~~~~~~~~~~~~~~~~--~~~~~i~~vSA~~g~Gi~e  201 (212)
                      +|+++  .+..++..+++...++...  ....+++|+||..|.|+-+
T Consensus       155 mD~v~~~e~~f~~i~~~~~~~l~~~g~~~~~i~~iPiSa~~Gdni~~  201 (443)
T PTZ00141        155 MDTCDYKEDRYEEIQKEVCGYLKKVGYNAEKVPFVPISGFEGDNMIE  201 (443)
T ss_pred             ECCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCC
T ss_conf             21566609999999999999999739995666189634124665324


No 139
>cd04118 Rab24 Rab24 subfamily.  Rab24 is distinct from other Rabs in several ways.  It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments.  It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=99.55  E-value=4.7e-14  Score=99.93  Aligned_cols=158  Identities=15%  Similarity=0.153  Sum_probs=86.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||+++++.....  ...+..|....   ..............+.++||+|.+........      
T Consensus         1 vKivlvGd~~VGKTsLi~r~~~~~f~--~~~y~~tig~~---~~~k~i~v~~~~v~l~iwDtaG~e~~~~l~~~------   69 (193)
T cd04118           1 VKVVMLGKESVGKTSLVERYVHHRFL--VGPYQNTIGAA---FVAKRMVVGERVVTLGIWDTAGSERYEAMSRI------   69 (193)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEEE---EEEEEEEECCEEEEEEEEECCCCHHHHHHHHH------
T ss_conf             98999996998799999999859799--89978763058---89999999999999999919997312355798------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCC-----CCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHH--HHHHHHHHHHHHHHHCC
Q ss_conf             998777766420000011223578-----87545455432102575322122221111024--68999999999975313
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHG-----VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPT--TAQETLEKTKYLIRNYP  182 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~--~~~~~~~~~~~~~~~~~  182 (212)
                          +.   ......+.+.+....     ...+...+. . .....|+++|.||+|+....  ......++..+....+ 
T Consensus        70 ----y~---~~a~~~ilvydit~~~Sf~~i~~W~~~i~-~-~~~~~~iilVGnK~DL~~~~~~~r~V~~~e~~~~a~~~-  139 (193)
T cd04118          70 ----YY---RGAKAAIVCYDLTDSSSFERAKFWVKELQ-N-LEEHCKIYLCGTKSDLIEQDRSLRQVDFHDVQDFADEI-  139 (193)
T ss_pred             ----HH---CCCCEEEEEECCCCHHHHHHHHHHHHHHH-H-HCCCCCEEEEEECHHHHHCCCCCCCCCHHHHHHHHHHC-
T ss_conf             ----83---47744578830698799998999999999-7-48999979997746632201666446899999999980-


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             6898689998888899899999999872
Q gi|254780484|r  183 TAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       183 ~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                        +-.++.+||++|.||+++++.|.+.+
T Consensus       140 --~~~~~E~SAktg~nV~e~F~~la~~i  165 (193)
T cd04118         140 --KAQHFETSSKTGQNVDELFQKVAEDF  165 (193)
T ss_pred             --CCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             --99699983898939899999999999


No 140
>cd04149 Arf6 Arf6 subfamily.  Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions.  In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis.  Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling.  Arf6 is required for and enhances Rac formation of ruffles.  Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection.  In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells.  Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis.  Arf6 is believed t
Probab=99.55  E-value=7.4e-14  Score=98.79  Aligned_cols=154  Identities=13%  Similarity=0.146  Sum_probs=89.4

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      -.+|.++|..|||||||+++|...+.. .  ..||..  .      ...........+.++|++|....+..-..     
T Consensus         9 ~~kililG~~~sGKTsil~~l~~~~~~-~--~~pTvg--~------~~~~~~~~~~~l~iwD~~Gqe~~r~l~~~-----   72 (168)
T cd04149           9 EMRILMLGLDAAGKTTILYKLKLGQSV-T--TIPTVG--F------NVETVTYKNVKFNVWDVGGQDKIRPLWRH-----   72 (168)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCCCC-C--CCCCCC--C------EEEEEEECCEEEEEEECCCCCCCCCHHHH-----
T ss_conf             889999999999989999999669987-6--026267--0------07999989889999989999746606576-----


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCC--HHHH---HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             899877776642000001122357887--5454---55432102575322122221111024689999999999753136
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGVK--QIDQ---DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT  183 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~---~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~  183 (212)
                           +   ......++++.|......  +...   ...........|++++.||+|+-+.....+..+.+.  +.....
T Consensus        73 -----y---~~~~~~iifVvDstd~~~~~~~~~~l~~~l~~~~~~~~pilI~~NK~Dl~~~~~~~ei~~~l~--l~~~~~  142 (168)
T cd04149          73 -----Y---YTGTQGLIFVVDSADRDRIDEARQELHRIINDREMRDALLLVFANKQDLPDAMKPHEIQEKLG--LTRIRD  142 (168)
T ss_pred             -----H---CCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCHHHCCCEEEEEEECCCCCCCCCHHHHHHHHC--HHHHHC
T ss_conf             -----4---378866899983776789999999999997145227986999997566777889999999978--765517


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             8986899988888998999999998
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      ....++++||++|+|++|..++|.+
T Consensus       143 ~~~~i~~~SA~tG~Gv~e~f~WL~~  167 (168)
T cd04149         143 RNWYVQPSCATSGDGLYEGLTWLSS  167 (168)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHC
T ss_conf             9809998068789697999999865


No 141
>cd04110 Rab35 Rab35 subfamily.  Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells.  Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is 
Probab=99.55  E-value=3.6e-14  Score=100.60  Aligned_cols=157  Identities=15%  Similarity=0.121  Sum_probs=86.7

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      ..+|+++|.++||||||+++++..+....  ..|+.....    .............+.++||+|.............  
T Consensus         6 ~~KIvlvGd~~VGKTSli~r~~~~~F~~~--~~~Tig~d~----~~k~v~i~~~~v~l~iwDtaGqe~~~~l~~~~~~--   77 (199)
T cd04110           6 LFKLLIIGDSGVGKSSLLLRFADNTFSGS--YITTIGVDF----KIRTVEINGERVKLQIWDTAGQERFRTITSTYYR--   77 (199)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCCCCCC--CCCCCCEEE----EEEEEEECCEEEEEEEEECCCCCCCCCCHHHHHH--
T ss_conf             77999999799888999999950999998--689755587----8999999999999999989998123535266642--


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCC--CHHHHHHHHHH--CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             89987777664200000112235788--75454554321--025753221222211110246899999999997531368
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGV--KQIDQDVFSFL--DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                                 .....+++.+.....  .... .....+  .....|.++|.||+|+.....+..  ++..+.....   
T Consensus        78 -----------~a~~~ilvyDit~~~Sf~~l~-~w~~~i~~~~~~~~~ilVGNK~Dl~~~r~v~~--~e~~~~a~~~---  140 (199)
T cd04110          78 -----------GTHGVIVVYDVTNGESFVNVK-RWLQEIEQNCDDVCKVLVGNKNDDPERKVVET--EDAYKFAGQM---  140 (199)
T ss_pred             -----------CCCCCEEEEECCCHHHHHHHH-HHHHHHHHHCCCCCEEEEEECCCHHHHCCCCH--HHHHHHHHHC---
T ss_conf             -----------465423897179889999999-99999997599875799988554475469999--9999999986---


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             98689998888899899999999872
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +.+++.+||++|.||+++++.|.+.+
T Consensus       141 ~~~f~E~SAktg~nV~e~F~~i~~~i  166 (199)
T cd04110         141 GISLFETSAKENINVEEMFNCITELV  166 (199)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             99799986899929899999999999


No 142
>cd04121 Rab40 Rab40 subfamily.  This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous.  In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle.  Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components.  Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide d
Probab=99.55  E-value=4.6e-14  Score=99.99  Aligned_cols=158  Identities=13%  Similarity=0.076  Sum_probs=87.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      +.+|.++|-++||||||+.+++......  .-.|+....    ..............+.++||+|.+..........   
T Consensus         6 ~~KivllGd~~VGKTsl~~r~~~~~f~~--~y~~Tig~~----~~~k~~~~~~~~v~l~iwDtaGqe~f~~l~~~y~---   76 (189)
T cd04121           6 LLKFLLVGDSDVGKGEILASLQDGSTES--PYGYNMGID----YKTTTILLDGRRVKLQLWDTSGQGRFCTIFRSYS---   76 (189)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCCCCC--CCCCCCCEE----EEEEEEEECCEEEEEEEECCCCCCCHHHHHHHHH---
T ss_conf             9999999989978999999997499789--868765379----8999999999999999981788622116789886---


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHHHH-CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             8998777766420000011223578--875454554321-0257532212222111102468999999999975313689
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHG--VKQIDQDVFSFL-DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~-~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                                .-...++.+.|....  +......+.+.. .....|.++|.||+|+....++.  .++.++....   .+
T Consensus        77 ----------r~a~~~ilvyDvt~~~Sf~~l~~w~~~i~~~~~~~p~iLVGNK~DL~~~r~V~--~ee~~~~A~~---~~  141 (189)
T cd04121          77 ----------RGAQGIILVYDITNRWSFDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKRQVA--TEQAQAYAER---NG  141 (189)
T ss_pred             ----------HHCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHCCCCC--HHHHHHHHHH---CC
T ss_conf             ----------63370489822798899999999999999976898789961325503308899--9999999998---89


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+++.+||++|.|++++.+.|.+.+
T Consensus       142 ~~f~EtSAk~g~nV~e~F~~l~~~i  166 (189)
T cd04121         142 MTFFEVSPLCNFNITESFTELARIV  166 (189)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9999960067939899999999999


No 143
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=99.55  E-value=9.5e-14  Score=98.18  Aligned_cols=153  Identities=17%  Similarity=0.249  Sum_probs=88.2

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99974899889899999738973798738884145212026655567850896499997600101112244789888899
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLI  111 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~  111 (212)
                      |.++|.+|||||||+++|....... ....||..  .+      .......+..+.++|++|....+..-..        
T Consensus         2 Il~lGl~~sGKTtil~~l~~~~~~~-~~~~pT~G--~~------~~~~~~~~~~~~iwD~~G~~~~r~lw~~--------   64 (162)
T cd04157           2 ILVVGLDNSGKTTIINQLKPENAQS-QIIVPTVG--FN------VESFEKGNLSFTAFDMSGQGKYRGLWEH--------   64 (162)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCCCC-CCCCCCCC--EE------EEEEEECCEEEEEEECCCCCCCCHHHHH--------
T ss_conf             9999999998899999997289875-64168507--57------8999839988999985887442055898--------


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCHH--HHHHHHHH-----CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             87777664200000112235788754--54554321-----025753221222211110246899999999997531368
Q gi|254780484|r  112 VRYLSERSTLRCVYLLIDCRHGVKQI--DQDVFSFL-----DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       112 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~-----~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                        +   ......++++.|......-.  ...+...+     .....|++++.||.|+.......+..+.+.-  ......
T Consensus        65 --y---~~~~~~iI~VvDssd~~~~~~~~~~l~~ll~~~~~~~~~~PiLI~~NK~D~~~~~~~~ei~~~l~l--~~~~~~  137 (162)
T cd04157          65 --Y---YKNIQGIIFVIDSSDRLRLVVVKDELELLLNHPDIKHRRVPILFFANKMDLPDALTAVKITQLLGL--ENIKDK  137 (162)
T ss_pred             --H---HCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHHCH--HHHCCC
T ss_conf             --7---056744899970763888999999999997176551798459999814778899999999988586--652489


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             986899988888998999999998
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      ...++++||++|+|++|-.++|.+
T Consensus       138 ~~~i~~~SA~tG~Gi~e~f~WL~~  161 (162)
T cd04157         138 PWHIFASNALTGEGLDEGVQWLQA  161 (162)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHC
T ss_conf             649999789789798999999865


No 144
>cd01849 YlqF_related_GTPase YlqF-related GTPases.  These proteins are found in bacteria, eukaryotes, and archaea.  They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.
Probab=99.54  E-value=1.4e-14  Score=102.91  Aligned_cols=57  Identities=33%  Similarity=0.456  Sum_probs=45.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHH
Q ss_conf             6868999748998898999997389737987388841452120266555678508964999976001
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGY   94 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~   94 (212)
                      ...+|+|||+||||||||+|+|.|+++ +.+++.||+|+......        . ...+.++||||+
T Consensus        99 ~~~~i~ivG~PNVGKSsliN~L~~~~~-~~v~~~pGtTrd~~~i~--------~-~~~~~liDTpGi  155 (155)
T cd01849          99 KSITVGVIGYPNVGKSSVINALLNKLK-LKVGNVPGTTTSQQEVK--------L-DNKIKLLDTPGI  155 (155)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHCCCE-EEECCCCCCEECEEEEE--------E-CCCEEEEECCCC
T ss_conf             660899987777447789999847850-62669998383559999--------6-899899979299


No 145
>cd01859 MJ1464 MJ1464.  This family represents archaeal GTPase typified by the protein MJ1464 from Methanococcus jannaschii. The members of this family show a circular permutation of the GTPase signature motifs so that C-terminal strands 5, 6, and 7 (strands 6 contain the NKxD motif) are relocated to the N terminus.
Probab=99.54  E-value=1.3e-14  Score=103.05  Aligned_cols=57  Identities=37%  Similarity=0.516  Sum_probs=45.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHH
Q ss_conf             6868999748998898999997389737987388841452120266555678508964999976001
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGY   94 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~   94 (212)
                      ...+|+++|+||||||||+|+|.|+++ +.+++.||+|+.....         ..+..+.++||||+
T Consensus       100 ~~~~v~ivG~PNVGKSTLIN~L~~~~~-~~v~~~pGtTr~~~~i---------~~~~~~~liDTpGi  156 (156)
T cd01859         100 KEGKVGVVGYPNVGKSSIINALKGRHS-ASTSPSPGYTKGEQLV---------KITSKIYLLDTPGV  156 (156)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHCCCE-EEECCCCCEECCEEEE---------EECCCEEEEECCCC
T ss_conf             662899981478459899999748813-7775999807055999---------97998899989099


No 146
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=99.54  E-value=4e-14  Score=100.33  Aligned_cols=157  Identities=14%  Similarity=0.110  Sum_probs=87.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      -+|+++|.++||||||++++++.+..  ..-.|+.....    .............+.++||+|.+..........    
T Consensus         3 ~Kiv~vGd~~vGKTsli~r~~~~~f~--~~y~~Tig~~~----~~~~i~~~~~~~~l~iwDtaG~e~~~~~~~~~~----   72 (166)
T cd01869           3 FKLLLIGDSGVGKSCLLLRFADDTYT--ESYISTIGVDF----KIRTIELDGKTIKLQIWDTAGQERFRTITSSYY----   72 (166)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCCCEEE----EEEEEEECCEEEEEEEEECCCCCCCCCCHHHHH----
T ss_conf             99999999997899999999439999--87478544048----999999999999999998999823462678885----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--CHHHH--HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9987777664200000112235788--75454--5543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--KQIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~--~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                               ....+.+.+.+.....  .....  ...........|.+++.||+|+.....+..  +..++.....   +
T Consensus        73 ---------~~a~~~ilvfdit~~~Sf~~i~~w~~~i~~~~~~~~~~ilvgNK~DL~~~r~v~~--~~~~~~a~~~---~  138 (166)
T cd01869          73 ---------RGAHGIIIVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTDKRVVDY--SEAQEFADEL---G  138 (166)
T ss_pred             ---------HHCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCH--HHHHHHHHHC---C
T ss_conf             ---------6326779971179989999999999999986787774488613201131466799--9999999983---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++.+||++|+||+++.+.|.+.|
T Consensus       139 ~~~~E~SAk~g~nI~e~F~~l~~~i  163 (166)
T cd01869         139 IPFLETSAKNATNVEQAFMTMAREI  163 (166)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9699987687806899999999999


No 147
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily.  Rab32 and Rab38 are members of the Rab family of small GTPases.  Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=99.54  E-value=8.7e-14  Score=98.40  Aligned_cols=155  Identities=14%  Similarity=0.135  Sum_probs=85.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEE---CCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             899974899889899999738973798738884145212026655567850---89649999760010111224478988
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN---NLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~---~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      +|+++|.++||||||+++++..+..  ..-.|+-....     .. .....   ....+.++||+|.+.+......    
T Consensus         2 KvvllGd~gVGKTsLi~rf~~~~F~--~~y~~Tig~df-----~~-k~i~~~~~~~v~l~iwDtaGqe~~~~l~~~----   69 (201)
T cd04107           2 KVLVIGDLGVGKTSIIKRYVHGIFS--QHYKATIGVDF-----AL-KVIEWDPNTVVRLQLWDIAGQERFGGMTRV----   69 (201)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEEE-----EE-EEEEECCCEEEEEEEEECCCCCCCCCCHHH----
T ss_conf             7999999997899999999829999--98888756778-----99-899967981999999868998322200375----


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCC--CHHHH---HHH---HHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             889987777664200000112235788--75454---554---3210257532212222111102468999999999975
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGV--KQIDQ---DVF---SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR  179 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~---~~~---~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~  179 (212)
                            +.   ......+++.+.....  .....   .+.   ........|+++|.||+|+..+..+..  ++..+...
T Consensus        70 ------y~---~~a~~~ilvydvt~~~Sf~~l~~w~~~i~~~~~~~~~~~ipiilVgNK~DL~~~~~v~~--ee~~~~a~  138 (201)
T cd04107          70 ------YY---RGAVGAIIVFDVTRPSTFEAVLKWKADLDSKVTLPNGEPIPCLLLANKCDLKKRLAKDG--EQMDQFCK  138 (201)
T ss_pred             ------HC---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCH--HHHHHHHH
T ss_conf             ------55---57764799982798899998999999999986213789871899866556411256899--99999999


Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             3136898689998888899899999999872
Q gi|254780484|r  180 NYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       180 ~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ..  +...++.+||++|.||+++++.|.+.+
T Consensus       139 ~~--~~~~~~EtSAktg~nV~e~F~~l~~~i  167 (201)
T cd04107         139 EN--GFIGWFETSAKEGINIEEAMRFLVKNI  167 (201)
T ss_pred             HC--CCCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             77--998099977999949899999999999


No 148
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=99.54  E-value=3.7e-14  Score=100.55  Aligned_cols=157  Identities=13%  Similarity=0.137  Sum_probs=93.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      .-.+|.++|..|||||||++++...+. .  ...|+..  .+      ..........+.+.|++|....+..-..    
T Consensus        16 k~~kililGl~~sGKTsil~~l~~~~~-~--~~~pTvg--~~------~~~~~~~~~~l~iwD~~Gqe~~r~lw~~----   80 (182)
T PTZ00133         16 KEVRILMVGLDAAGKTTILYKLKLGEV-V--TTIPTIG--FN------VETVEYKNLKFTMWDVGGQDKLRPLWRH----   80 (182)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHCCCC-C--CCCCCCC--CC------EEEEEECCEEEEEEECCCCCCCCHHHHH----
T ss_conf             747999996799889999999962997-7--7378688--45------6999978889999989998454747876----


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHH--HH---HHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             8899877776642000001122357887545--45---543210257532212222111102468999999999975313
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVKQID--QD---VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP  182 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~---~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~  182 (212)
                            +   ....+.++++.|......-..  ..   ........+.|++++.||.|+.+.....+..+.+..  ....
T Consensus        81 ------y---y~~~~giI~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~piLi~~NK~Dl~~a~~~~ei~~~l~l--~~~~  149 (182)
T PTZ00133         81 ------Y---YQNTNGIIFVVDSNDRERIGDARQELEKMLAEDELRNAVLLVFANKQDLPNAMSTTEVTEKLGL--HSVR  149 (182)
T ss_pred             ------C---CCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEECCCCCCCCCCHHHHHHHHCH--HHHH
T ss_conf             ------0---5676449999966787899999999999971442248859999706687788899999999695--5561


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             6898689998888899899999999872
Q gi|254780484|r  183 TAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       183 ~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .....++++||++|+||+|..+.|.+.|
T Consensus       150 ~~~~~i~~~SA~tG~Gi~e~f~wL~~~i  177 (182)
T PTZ00133        150 QRNWYIQGCCATTAQGLYEGLDWLSANI  177 (182)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             5995899825758949899999999999


No 149
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=99.54  E-value=7.5e-14  Score=98.75  Aligned_cols=157  Identities=16%  Similarity=0.127  Sum_probs=85.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||+++++..+..  ....|+....    ..............+.++||+|.+.......       
T Consensus         2 ~KivviGd~~vGKTsli~r~~~~~f~--~~~~~Tig~~----~~~k~i~~~~~~v~l~iwDtaG~e~~~~~~~-------   68 (163)
T cd01860           2 FKLVLLGDSSVGKSSLVLRFVKNEFS--ENQESTIGAA----FLTQTVNLDDTTVKFEIWDTAGQERYRSLAP-------   68 (163)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEE----EEEEEEEECCEEEEEEEEECCCCHHHHHHHH-------
T ss_conf             79999995996899999999439899--9868866678----8999999999999999997999710027889-------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--CHHHH--HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9987777664200000112235788--75454--5543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--KQIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~--~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                         ...   ......+.+.+.....  .....  ...........|++++.||+|+.....+.  .++..+.....   +
T Consensus        69 ---~~~---~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~~~iilVgnK~DL~~~r~V~--~~e~~~~a~~~---~  137 (163)
T cd01860          69 ---MYY---RGAAAAIVVYDITSEESFEKAKSWVKELQRNASPNIIIALVGNKADLESKRQVS--TEEAQEYADEN---G  137 (163)
T ss_pred             ---HHH---CCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHCCCCC--HHHHHHHHHHC---C
T ss_conf             ---885---167714999818997999999999999998559872367755335756508999--99999999982---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++.+||++|.||+++.+.|.+.|
T Consensus       138 ~~~~E~SAk~~~nV~e~F~~l~~~i  162 (163)
T cd01860         138 LLFFETSAKTGENVNELFTEIAKKL  162 (163)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHC
T ss_conf             9799986265907899999999858


No 150
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily.  Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics.   These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains.  Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42.  Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells.  Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42.  This ternary complex is proposed to have physiological function in processes such as tumorigenesis.  Activated Ric is likely to sign
Probab=99.54  E-value=2.7e-14  Score=101.34  Aligned_cols=156  Identities=15%  Similarity=0.154  Sum_probs=87.8

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      -+|+++|-++||||||+.++++....  ..-.|+.. .    ..............+.++||+|.+..........    
T Consensus         3 ~Kiv~lGd~~VGKTsli~r~~~~~f~--~~~~pTi~-~----~~~~~i~i~~~~~~l~iwDtaGqe~~~~l~~~~~----   71 (172)
T cd04141           3 YKIVMLGAGGVGKSAVTMQFISHSFP--DYHDPTIE-D----AYKQQARIDNEPALLDILDTAGQAEFTAMRDQYM----   71 (172)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCC-C----CEEEEEEECCEEEEEEEEECCCCCCCCCCHHHHH----
T ss_conf             69999999997799999999709899--87588422-2----0369999999999999997888513574515564----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCC--HHH---HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99877776642000001122357887--545---4554321025753221222211110246899999999997531368
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVK--QID---QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~---~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                               ......+.+.+......  ...   ............|++++.||+|+.....+.  .++..+....+   
T Consensus        72 ---------r~a~~~ilvydvt~~~Sf~~~~~w~~~i~~~~~~~~~piilvGNK~DL~~~r~Vs--~~e~~~~a~~~---  137 (172)
T cd04141          72 ---------RCGEGFIICYSVTDRHSFQEASEFKKLITRVRLTEDIPLVLVGNKVDLESQRQVT--TEEGRNLAREF---  137 (172)
T ss_pred             ---------CCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHCCCC--HHHHHHHHHHC---
T ss_conf             ---------2786568873168888999999999999997288998689985045667618889--99999999985---


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             98689998888899899999999872
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +-+++.+||++|.||+++.+.|.+.+
T Consensus       138 ~~~f~EtSAk~~~nV~e~F~~l~~~i  163 (172)
T cd04141         138 NCPFFETSAALRHYIDDAFHGLVREI  163 (172)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             99799974788828899999999999


No 151
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=99.54  E-value=1.8e-14  Score=102.30  Aligned_cols=152  Identities=17%  Similarity=0.143  Sum_probs=86.9

Q ss_pred             EECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97489988989999973897379873888414521202665556785089649999760010111224478988889987
Q gi|254780484|r   34 FSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVR  113 (212)
Q Consensus        34 ivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~  113 (212)
                      ++|.+|||||||+|++.+.+..  ....+++.....    ............+.++|+||........          ..
T Consensus         1 vvG~~~~GKSsl~~~~~~~~~~--~~~~~~~~~~~~----~~~~~~~~~~~~~~i~D~~g~~~~~~~~----------~~   64 (157)
T cd00882           1 VVGDSGVGKTSLLNRLLGGEFV--PEEYETTIIDFY----SKTIEVDGKKVKLQIWDTAGQERFRSLR----------RL   64 (157)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCC--CCCCCCCEEEEE----EEEEEECCEEEEEEEEECCCCHHHHHHH----------HH
T ss_conf             9294996889999999719888--764687157899----9999999999999999858951156789----------99


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCHHHH-----HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             77766420000011223578875454-----5543210257532212222111102468999999999975313689868
Q gi|254780484|r  114 YLSERSTLRCVYLLIDCRHGVKQIDQ-----DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEV  188 (212)
Q Consensus       114 ~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i  188 (212)
                      .   .......+.+.+..........     ...........|++++.||+|+.......... .....   ......++
T Consensus        65 ~---~~~~~~~i~v~d~~~~~s~~~~~~~~~~~~~~~~~~~~~iiiv~nK~Dl~~~~~~~~~~-~~~~~---~~~~~~~~  137 (157)
T cd00882          65 Y---YRGADGIILVYDVTDRESFENVKEWLLLILINKEGENIPIILVGNKIDLPEERVVSEEE-LAEQL---AKELGVPY  137 (157)
T ss_pred             H---HHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHCCCCCHHH-HHHHH---HHHCCCEE
T ss_conf             9---75357999998658888899999999999997525898499998535615406688999-99999---98789869


Q ss_pred             EEEECCCCCCHHHHHHHHHH
Q ss_conf             99988888998999999998
Q gi|254780484|r  189 IPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       189 ~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      +++||++|.|++++.+.|.+
T Consensus       138 ~~~Sa~~~~~i~~l~~~i~~  157 (157)
T cd00882         138 FETSAKTGENVEELFEELAE  157 (157)
T ss_pred             EEECCCCCCCHHHHHHHHHC
T ss_conf             99847888399999999859


No 152
>cd01856 YlqF YlqF.  Proteins of the YlqF family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. The YlqF subfamily is represented in a phylogenetically diverse array of bacteria (including gram-positive bacteria, proteobacteria, Synechocystis, Borrelia, and Thermotoga) and in all eukaryotes.
Probab=99.54  E-value=1.5e-14  Score=102.84  Aligned_cols=57  Identities=37%  Similarity=0.527  Sum_probs=45.9

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHH
Q ss_conf             6868999748998898999997389737987388841452120266555678508964999976001
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGY   94 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~   94 (212)
                      ...+|+|||+||||||||+|+|.|+++ +.+++.||+|+....         ...+..+.++||||+
T Consensus       114 ~~~~v~ivG~PNVGKSSlIN~L~~~~~-~~v~~~pGtTr~~~~---------i~~~~~~~liDTPGI  170 (171)
T cd01856         114 RGIRAMVVGIPNVGKSTLINRLRGKKV-AKVGNKPGVTKGIQW---------IKISPGIYLLDTPGI  170 (171)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCE-EEECCCCCCCCCEEE---------EEECCCEEEEECCCC
T ss_conf             771799973798761799999748863-887698985326679---------996899999979988


No 153
>cd01864 Rab19 Rab19 subfamily.  Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=99.54  E-value=7.7e-14  Score=98.69  Aligned_cols=158  Identities=13%  Similarity=0.097  Sum_probs=85.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      -+|+++|.++||||||++++++.+-..  ...|+....    ..............+.++||+|............    
T Consensus         4 ~Kiv~lGd~~vGKTsli~r~~~~~f~~--~~~~Ti~~~----~~~k~i~~~~~~~~l~iwDtaG~e~~~~l~~~~~----   73 (165)
T cd01864           4 FKIILIGDSNVGKTCVVQRFKSGTFSE--RQGNTIGVD----FTMKTLEIEGKRVKLQIWDTAGQERFRTITQSYY----   73 (165)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCCC--CCCCCCCEE----EEEEEEEECCEEEEEEEEECCCCCCCCCCCHHHE----
T ss_conf             999999999958999999996499999--879975437----8999999999999999998999834453507552----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--CHHH--HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9987777664200000112235788--7545--45543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--KQID--QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~--~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                               ......+.+.+.....  ....  ............|+++|.||+|+.....+.  .+...+.....  +.
T Consensus        74 ---------~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~~~iilVGNK~DL~~~r~V~--~~~~~~~a~~~--~~  140 (165)
T cd01864          74 ---------RSANGAIIAYDITRRSSFESVPHWIEEVEKYGASNVVLLLIGNKCDLEEQREVL--FEEACTLAEKN--GM  140 (165)
T ss_pred             ---------ECCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHCCCC--HHHHHHHHHHC--CC
T ss_conf             ---------215666997138998999999999999998769998438887723768628999--99999999983--99


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ..++.+||++|.||+++.+.|.+.|
T Consensus       141 ~~~~E~SAk~~~nV~e~F~~la~~i  165 (165)
T cd01864         141 LAVLETSAKESQNVEEAFLLMATEL  165 (165)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHC
T ss_conf             7699978885819899999999849


No 154
>CHL00071 tufA elongation factor Tu
Probab=99.54  E-value=2.1e-13  Score=96.23  Aligned_cols=153  Identities=14%  Similarity=0.203  Sum_probs=100.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCE-----EE---ECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHH
Q ss_conf             8999748998898999997389737-----98---738884145212026655567850896499997600101112244
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNL-----AR---TSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKK  102 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~-----a~---~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~  102 (212)
                      .|+++|+.++|||||+-+|++....     +.   ..+.....+..+.+..............+.++|+||+..+...  
T Consensus        14 ni~~~GHVD~GKSTL~g~L~~~~~~~~~~~~~~~~~~D~~~eEr~rGiTid~~~~~~et~~~~~~~iD~PGH~~fv~n--   91 (409)
T CHL00071         14 NIGTIGHVDHGKTTLTAAITMTLAANGGAKGKKYDEIDSAPEEKARGITINTAHVEYETENRHYAHVDCPGHADYVKN--   91 (409)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHCCCCHHHHHCCCEEEECEEEEECCCEEEEEEECCCHHHHHHH--
T ss_conf             999995458839999999864530045133431553237976873694488024899628759999867967899999--


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCC-CCCCCCCCHHHHHHHHH-HHHHHHHH
Q ss_conf             78988889987777664200000112235788754545543210257532212-22211110246899999-99999753
Q gi|254780484|r  103 NVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIV-LTKIDKLSPTTAQETLE-KTKYLIRN  180 (212)
Q Consensus       103 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v-~nK~D~~~~~~~~~~~~-~~~~~~~~  180 (212)
                                 +.......+..++++++..+...|..+....+...+.+.++| +||+|++++++..+.++ ++.+.+..
T Consensus        92 -----------mi~Gas~aD~alLVV~A~~G~~~QTkEHl~l~~~lgV~~~IVavnKmD~v~~~~~~e~i~~~i~~~l~~  160 (409)
T CHL00071         92 -----------MITGAAQMDGAILVVSAADGPMPQTKEHILLAKQVGVPNIVVFLNKEDQVDDEELLELVELEVRELLDK  160 (409)
T ss_pred             -----------HHHHHCCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             -----------875230158128999868788500499999999739993655555679854899999999999999997


Q ss_pred             CCC--CCCCEEEEECCCC
Q ss_conf             136--8986899988888
Q gi|254780484|r  181 YPT--AHPEVIPTSSVKR  196 (212)
Q Consensus       181 ~~~--~~~~i~~vSA~~g  196 (212)
                      ...  ...+++|+||..|
T Consensus       161 ~g~~~~~i~~vp~sa~~~  178 (409)
T CHL00071        161 YDFPGDEIPIVAGSALLA  178 (409)
T ss_pred             CCCCCCCCEEEECCHHHH
T ss_conf             399845560896521332


No 155
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=99.54  E-value=9.2e-14  Score=98.25  Aligned_cols=160  Identities=11%  Similarity=0.082  Sum_probs=85.3

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      +-+|+++|.++||||||+.++++... . ..-.|+.. ..    .............+.++||+|.+........     
T Consensus         1 r~Ki~liGd~~VGKTsli~r~~~~~F-~-~~y~pTi~-~~----~~~~i~~~~~~v~l~iwDtaG~e~~~~~~~~-----   68 (175)
T cd01870           1 RKKLVIVGDGACGKTCLLIVFSKDQF-P-EVYVPTVF-EN----YVADIEVDGKQVELALWDTAGQEDYDRLRPL-----   68 (175)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCC-C-CCCCCCEE-EE----EEEEEEECCEEEEEEEEECCCCCCCCCCHHH-----
T ss_conf             90999999899669999999970989-9-98478436-89----9999999999999999977766132324044-----


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHHHH--CCCCCCCCCCCCCCCCCCHHHHHHHH----------HHH
Q ss_conf             8998777766420000011223578--875454554321--02575322122221111024689999----------999
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHG--VKQIDQDVFSFL--DKKAVSYQIVLTKIDKLSPTTAQETL----------EKT  174 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~~~~~----------~~~  174 (212)
                           ..   ......+.+.+....  +...........  .....|++++.||+|+.+........          ++-
T Consensus        69 -----~~---~~a~~~ilvydi~~~~Sf~~~~~~w~~~i~~~~~~~piilVgnK~DL~~~~~~~~~~~~~~~~~V~~~eg  140 (175)
T cd01870          69 -----SY---PDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEG  140 (175)
T ss_pred             -----HH---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCCCHHHH
T ss_conf             -----31---4887899998659879999999999999997298998999987243343323456665402556689999


Q ss_pred             HHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             999753136898689998888899899999999872
Q gi|254780484|r  175 KYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       175 ~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+....  .+...++.+||++|.||+++.+.+.+.+
T Consensus       141 ~~~a~~--~~~~~f~EtSAk~~~nV~e~Fe~~~k~~  174 (175)
T cd01870         141 RDMANK--IGAFGYMECSAKTKEGVREVFEMATRAA  174 (175)
T ss_pred             HHHHHH--CCCCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             999997--4997899976899979899999999986


No 156
>cd04134 Rho3 Rho3 subfamily.  Rho3 is a member of the Rho family found only in fungi.  Rho3 is believed to regulate cell polarity by interacting with the diaphanous/formin family protein For3 to control both the actin cytoskeleton and microtubules.  Rho3 is also believed to have a direct role in exocytosis that is independent of its role in regulating actin polarity.  The function in exocytosis may be two-pronged: first, in the transport of post-Golgi vesicles from the mother cell to the bud, mediated by myosin (Myo2); second, in the docking and fusion of vesicles to the plasma membrane, mediated by an exocyst (Exo70) protein.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=99.54  E-value=8.8e-14  Score=98.37  Aligned_cols=160  Identities=12%  Similarity=0.114  Sum_probs=86.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+++++..+. .. ...|+.  ....   ............+.++||+|.+........       
T Consensus         2 KivlvGd~~VGKTsli~r~~~~~F-~~-~y~~Ti--~~~~---~~~~~v~~~~v~l~iwDTaGqe~~~~i~~~-------   67 (189)
T cd04134           2 KVVVLGDGACGKTSLLNVFTRGYF-PQ-VYEPTV--FENY---VHDIFVDGLHIELSLWDTAGQEEFDRLRSL-------   67 (189)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCC-CC-CCCCCE--EEEE---EEEEEECCEEEEEEEEECCCCCCCCHHHHH-------
T ss_conf             899999799769999999970999-99-868837--8999---999999999999999847785000035567-------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHHHH--CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH-------HH
Q ss_conf             98777766420000011223578--875454554321--02575322122221111024689999999999-------75
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHG--VKQIDQDVFSFL--DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYL-------IR  179 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~-------~~  179 (212)
                         ..   .....++.+.+....  +...........  .....|++++.||+|+.+..+...........       ..
T Consensus        68 ---~y---~~a~~~ilvydi~~~~Sf~~v~~~w~~~i~~~~~~~piiLVgnK~DL~~~~~~~~~~~~~~~~~is~~eg~~  141 (189)
T cd04134          68 ---SY---ADTDVIMLCFSVDSPDSLENVESKWLGEIREHCPGVKLVLVALKCDLREARNERDDLQRYGKHTISYEEGLA  141 (189)
T ss_pred             ---HH---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHCCCCHHHHHHHHHHCCCCCCHHHHHH
T ss_conf             ---64---378645999978987899999999999999749799789999880046532356777663046658999999


Q ss_pred             H-CCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             3-136898689998888899899999999872
Q gi|254780484|r  180 N-YPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       180 ~-~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      . ...+...++.+||++|+||+++++.+.+.+
T Consensus       142 ~Ak~~~~~~y~EtSAkt~~nV~e~F~~lar~~  173 (189)
T cd04134         142 VAKRINALRYLECSAKLNRGVNEAFTEAARVA  173 (189)
T ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             99982997899968067949899999999999


No 157
>cd04126 Rab20 Rab20 subfamily.  Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells.  It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells.  Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron.  It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo
Probab=99.53  E-value=1.4e-13  Score=97.29  Aligned_cols=157  Identities=17%  Similarity=0.170  Sum_probs=86.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|.++|.++||||||+++++..+. .  ...++....  +      .........+.++||+|.+.+........    
T Consensus         1 lKivllGd~~VGKTsl~~rf~~~~F-~--~~~~Tig~~--~------~~k~~~~~~l~IwDTaGqE~f~sl~~~y~----   65 (220)
T cd04126           1 LKVVLLGDMNVGKTSLLHRYMERRF-K--DTVSTVGGA--F------YLKQWGPYNISIWDTAGREQFHGLGSMYC----   65 (220)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCC-C--CCCCCCCEE--E------EEEECCEEEEEEEECCCCCCCCCCHHHHH----
T ss_conf             9899999999889999999972989-9--988871368--9------99876478899994798622433268885----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCC--HHHH--HHHHHHCCCCCCCCCCCCCCCCCCHH-----------------HHH
Q ss_conf             99877776642000001122357887--5454--55432102575322122221111024-----------------689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVK--QIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPT-----------------TAQ  168 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~--~~~~~~~~~~~~~~~v~nK~D~~~~~-----------------~~~  168 (212)
                               ......+.+.+......  ....  ...........++++|.||+|+.++.                 .+.
T Consensus        66 ---------r~a~~~ilvyDit~~~Sf~~l~~~~~~~~~~~~~~~~~ilVGNK~DL~~~~~~~~~~~~~~~~~~~~~~r~  136 (220)
T cd04126          66 ---------RGAAAVILTYDVSNVQSLEELEDRFLGLTDTANEDCLFAVVGNKLDLTEEGALAGQEKDAGDRVSPEDQRQ  136 (220)
T ss_pred             ---------CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECHHCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             ---------67988999997989899999999999999847999808999887121364344333333322344100354


Q ss_pred             HHHHHHHHHHHHC-----------CCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9999999997531-----------36898689998888899899999999872
Q gi|254780484|r  169 ETLEKTKYLIRNY-----------PTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       169 ~~~~~~~~~~~~~-----------~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ...++..+.....           .....+++.+||++|.||+++++.|.+.+
T Consensus       137 Vs~ee~~~~a~~~~~~~~~~~~~~~~~~~~~fEtSAKtg~nV~e~F~~i~~~i  189 (220)
T cd04126         137 VTLEDAKAFYKRINKYKMLDEDLSPAAEKMCFETSAKTGYNVDELFEYLFNLV  189 (220)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             48999999999850220222111124577699914789979899999999999


No 158
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily.  This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins.  Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation.  Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state.  GDP/GTP exchange exposes the helix, which anchors to the membrane.  Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein.  A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site.  Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned.  Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI.  It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins.  Humans, but not rodents
Probab=99.53  E-value=3.6e-14  Score=100.59  Aligned_cols=153  Identities=12%  Similarity=0.100  Sum_probs=90.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|.++|..|||||||++++...+. .  ...|+...  +      ..........+.++|++|....+..-        
T Consensus         1 ~KililG~~~sGKTsll~~l~~~~~-~--~~~pT~g~--~------~~~~~~~~~~l~iwD~~G~~~~r~l~--------   61 (159)
T cd04150           1 MRILMVGLDAAGKTTILYKLKLGEI-V--TTIPTIGF--N------VETVEYKNISFTVWDVGGQDKIRPLW--------   61 (159)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC-C--CCCCCCCC--C------EEEEEECCEEEEEEECCCCCCCCHHH--------
T ss_conf             9999999999998999999972996-7--75896870--1------79999898999999789972146567--------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHH--HHHHH---HHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             9987777664200000112235788754--54554---321025753221222211110246899999999997531368
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQI--DQDVF---SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~---~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                        ..+   ......++++.|......-.  ...+.   ........|++++.||+|+.+.....+..+.+..  ......
T Consensus        62 --~~Y---~~~a~~iI~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~pili~~NK~Dl~~~~~~~ei~~~l~l--~~~~~~  134 (159)
T cd04150          62 --RHY---FQNTQGLIFVVDSNDRERIGEAREELQRMLNEDELRDAVLLVFANKQDLPNAMSAAEVTDKLGL--HSLRNR  134 (159)
T ss_pred             --HHH---CCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEECCCCCCCCCHHHHHHHHCH--HHHHCC
T ss_conf             --864---7687389999977777899999999999962353369829999975667789899999999686--666379


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             986899988888998999999998
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      ...++++||++|+|++|..++|.+
T Consensus       135 ~~~i~~~SA~tG~Gv~e~f~WL~~  158 (159)
T cd04150         135 NWYIQATCATSGDGLYEGLDWLSN  158 (159)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHC
T ss_conf             859998268679398999999855


No 159
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=99.53  E-value=3.3e-14  Score=100.79  Aligned_cols=158  Identities=16%  Similarity=0.196  Sum_probs=85.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||++++++.+...  .-.|+....    ..............+.++||+|.+.......       
T Consensus         1 ~KivlvGd~~VGKTsli~r~~~~~f~~--~y~~Tig~d----~~~k~i~~~~~~~~l~iwDtaG~e~~~~l~~-------   67 (172)
T cd01862           1 LKVIILGDSGVGKTSLMNQYVNKKFSN--QYKATIGAD----FLTKEVTVDDKLVTLQIWDTAGQERFQSLGV-------   67 (172)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCCC--CCCCCCCEE----EEEEEEEECCEEEEEEEEECCCCHHHHHHHH-------
T ss_conf             989999989978999999995298898--757755516----9999999999999999996999831106889-------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCC--HH---HHHHHH---HHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             99877776642000001122357887--54---545543---21025753221222211110246899999999997531
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVK--QI---DQDVFS---FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY  181 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~---~~~~~~---~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~  181 (212)
                         ...   ...++.+.+.+......  ..   ..++..   .......|++++.||+|+.....+..  ++..+.... 
T Consensus        68 ---~~~---~~a~~~ilvydvt~~~Sf~~l~~w~~~~~~~~~~~~~~~~piilvgNK~Dl~~~r~V~~--~e~~~~a~~-  138 (172)
T cd01862          68 ---AFY---RGADCCVLVYDVTNPKSFESLDSWRDEFLIQASPSDPENFPFVVLGNKIDLEEKRQVST--KKAQQWCQS-  138 (172)
T ss_pred             ---HHH---HHCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHCCCCCH--HHHHHHHHH-
T ss_conf             ---986---52757999933899899999999999999972767765763899963368364189999--999999997-


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             36898689998888899899999999872
Q gi|254780484|r  182 PTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       182 ~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                       .+..+++.+||++|.||+++.+.|.+.+
T Consensus       139 -~~~~~~~E~SAk~~~nV~e~F~~l~~~~  166 (172)
T cd01862         139 -NGNIPYFETSAKEAINVEQAFETIARKA  166 (172)
T ss_pred             -CCCCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             -6997899975267919899999999999


No 160
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=99.53  E-value=1e-13  Score=98.03  Aligned_cols=157  Identities=14%  Similarity=0.179  Sum_probs=86.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|-++||||||+.+++..+....  -.|+.....    .............+.++||+|.........       
T Consensus         1 lKivvvG~~~vGKTSLi~r~~~~~f~~~--y~pTig~~~----~~k~~~~~~~~~~l~iwDt~G~~~~~~~~~-------   67 (168)
T cd04119           1 IKVISMGNSGVGKSCIIKRYCEGRFVSK--YLPTIGIDY----GVKKVSVRNKEVRVNFFDLSGHPEYLEVRN-------   67 (168)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCCCC--CCCCCCEEE----EEEEEEECCEEEEEEEEECCCCHHHHHHHH-------
T ss_conf             9899999599568999999963999998--589765577----799999999999999998999764789999-------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHH-----HHHHHHH----CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99877776642000001122357887545-----4554321----02575322122221111024689999999999753
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQID-----QDVFSFL----DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN  180 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~----~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~  180 (212)
                         ...   ...+..+++.+......-..     .++....    .....|++++.||+|+.....+..  +...+....
T Consensus        68 ---~~~---~~ad~~ilvydit~~~Sf~~l~~w~~~~~~~~~~~~~~~~~~~ilvgnK~Dl~~~r~v~~--~~~~~~a~~  139 (168)
T cd04119          68 ---EFY---KDTQGVLLVYDVTDRQSFEALDSWLKEMKQEGGPHGNMENIVVVVCANKIDLTKHRAVSE--DEGRLWAES  139 (168)
T ss_pred             ---HHH---HHCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCCCCCCCH--HHHHHHHHH
T ss_conf             ---998---747788999508974448999999999999824534566862999854034442578899--999999998


Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             136898689998888899899999999872
Q gi|254780484|r  181 YPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       181 ~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                         .+-+++.+||++|+|++++.+.|.+.|
T Consensus       140 ---~~~~~~E~Sak~g~~V~e~F~~l~~~i  166 (168)
T cd04119         140 ---KGFKYFETSACTGEGVNEMFQTLFSSI  166 (168)
T ss_pred             ---CCCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             ---699899988577908899999999997


No 161
>cd04169 RF3 RF3 subfamily.  Peptide chain release factor 3 (RF3) is a protein involved in the termination step of translation in bacteria.  Termination occurs when class I release factors (RF1 or RF2) recognize the stop codon at the A-site of the ribosome and activate the release of the nascent polypeptide.  The class II release factor RF3 then initiates the release of the class I RF from the ribosome.  RF3 binds to the RF/ribosome complex in the inactive (GDP-bound) state.  GDP/GTP exchange occurs, followed by the release of the class I RF.  Subsequent hydrolysis of GTP to GDP triggers the release of RF3 from the ribosome.  RF3 also enhances the efficiency of class I RFs at less preferred stop codons and at stop codons in weak contexts.
Probab=99.53  E-value=4.5e-13  Score=94.28  Aligned_cols=120  Identities=15%  Similarity=0.258  Sum_probs=84.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHH---CC-CCEEEE----CCCCCEE------EECCEEEEEEEEEEEECCCEEEEEECCHHH
Q ss_conf             689997489988989999973---89-737987----3888414------521202665556785089649999760010
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILV---NR-KNLART----SNAPGRT------QHLNFFVPKDFSNLKNNLPAMALVDMPGYG   95 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~---g~-~~~a~~----~~~p~tt------~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~   95 (212)
                      ..|||+|+.++|||||.-+|+   |. ++...+    ....+.+      ...+...........+.+..+.++||||+.
T Consensus         3 Rniai~gH~gaGKTtL~EalL~~~G~i~r~G~V~~~~~~g~t~~D~~~eE~~R~iSi~~~~~~~~w~~~kinliDTPG~~   82 (267)
T cd04169           3 RTFAIISHPDAGKTTLTEKLLLFGGAIREAGAVKARKSRKHATSDWMEIEKQRGISVTSSVMQFEYRDCVINLLDTPGHE   82 (267)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCHHHHHHCCCEEECCEEEEEECCEEEEEEECCCCH
T ss_conf             17999847999989999999986686333854630368886046887999865944863637887899899999796977


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             1112244789888899877776642000001122357887545455432102575322122221111
Q gi|254780484|r   96 YARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL  162 (212)
Q Consensus        96 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~  162 (212)
                      .+..             .........+..+.+.++..+...+.....+.....++|.++++||+|..
T Consensus        83 DF~~-------------e~~~al~v~D~AviVv~a~~GVe~~T~~~w~~a~~~~iP~iifINKmDr~  136 (267)
T cd04169          83 DFSE-------------DTYRTLTAVDSAVMVIDAAKGVEPQTRKLFEVCRLRGIPIITFINKLDRE  136 (267)
T ss_pred             HHHH-------------HHHHHHHHHHCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             8999-------------99999988645479952566653558999999997299979998534567


No 162
>cd04112 Rab26 Rab26 subfamily.  First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation.  Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=99.53  E-value=4.3e-14  Score=100.18  Aligned_cols=157  Identities=15%  Similarity=0.158  Sum_probs=86.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+.+++..+... ..-.|+....    ..............+.++||+|.+..........     
T Consensus         2 KIv~vGd~~VGKTsli~r~~~~~f~~-~~~~~Ti~~~----~~~k~~~~~~~~v~l~iwDtaG~e~~~~l~~~~~-----   71 (191)
T cd04112           2 KVMLLGDSGVGKTCLLVRFKDGAFLN-GNFIATVGID----FRNKVVTVDGVKVKLQIWDTAGQERFRSVTHAYY-----   71 (191)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCCC-CCCCCCCCEE----EEEEEEEECCEEEEEEEEECCCCCCCCCCHHHHH-----
T ss_conf             89999949987999999999597899-9867765247----7999999999999999997998633464647771-----


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCC--CHHHH--HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             987777664200000112235788--75454--55432102575322122221111024689999999999753136898
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGV--KQIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP  186 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~--~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (212)
                              ...+..+.+.+.....  .....  ...........|+++|.||+|+.....+.  .++.++....+   +-
T Consensus        72 --------~~a~~~ilvydit~~~Sf~~l~~w~~~i~~~~~~~~~iilVGNK~DL~~~r~V~--~~e~~~~a~~~---~~  138 (191)
T cd04112          72 --------RDAHALLLLYDITNKASFDNIRAWLTEIKEYAQEDVVIMLLGNKADMSGERVVK--REDGERLAKEY---GV  138 (191)
T ss_pred             --------HCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCC--HHHHHHHHHHC---CC
T ss_conf             --------177778999727988999999999999998666785389861246553026799--99999999982---99


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             689998888899899999999872
Q gi|254780484|r  187 EVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       187 ~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +++.+||++|.||+++++.|.+.|
T Consensus       139 ~f~EtSAkt~~nI~e~F~~i~~~i  162 (191)
T cd04112         139 PFMETSAKTGLNVELAFTAVAKEL  162 (191)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             799985489809799999999999


No 163
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=99.53  E-value=9.7e-14  Score=98.12  Aligned_cols=155  Identities=19%  Similarity=0.175  Sum_probs=83.8

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEE--CCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             6899974899889899999738973798738884145212026655567850--89649999760010111224478988
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN--NLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~--~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      .+|+++|-++||||||+.++++.....  ...|+....  +  .........  ....+.++||+|.+..........  
T Consensus         1 iKivvlGd~~VGKTsLi~r~~~~~f~~--~y~~Tig~~--~--~~k~i~~~~~~~~v~l~iwDtaG~e~~~~l~~~~~--   72 (162)
T cd04106           1 IKVIVVGNGNVGKSSMIQRFVKGIFTK--DYKKTIGVD--F--LEKQIFLRQSDEDVRLMLWDTAGQEEFDAITKAYY--   72 (162)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCCC--CCCCCCCCE--E--EEEEEEECCCCEEEEEEEEECCCCCCCCCCHHHHH--
T ss_conf             989999999988999999998496898--768855625--7--88789986799799999997899701341524561--


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCC--CHHH--HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             889987777664200000112235788--7545--455432102575322122221111024689999999999753136
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGV--KQID--QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT  183 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~--~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~  183 (212)
                                 ......+.+.+.....  ....  ...... .....|.+++.||+|+.....+..  ++.++....+  
T Consensus        73 -----------~~a~~~ilvydvt~~~Sf~~l~~w~~~~~~-~~~~~piilVgNK~DL~~~r~V~~--~e~~~~a~~~--  136 (162)
T cd04106          73 -----------RGAQACILVFSTTDRESFEAIESWKEKVEA-ECGDIPMVLVQTKIDLLDQAVITN--EEAEALAKRL--  136 (162)
T ss_pred             -----------HHHCCEEEEEECCCHHHHHHHHHHHHHHHH-HCCCCCEEEEECCHHHHHCCCCCH--HHHHHHHHHC--
T ss_conf             -----------230312688406988999999999999997-669962999840544410177899--9999999986--


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             89868999888889989999999987
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                       +-+++.+||++|.||+++.+.|.+.
T Consensus       137 -~~~~~E~SAk~~~nV~e~F~~la~k  161 (162)
T cd04106         137 -QLPLFRTSVKDDFNVTELFEYLAEK  161 (162)
T ss_pred             -CCEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             -9879998688882989999999960


No 164
>cd04111 Rab39 Rab39 subfamily.  Found in eukaryotes, Rab39 is mainly found in epithelial cell lines, but is distributed widely in various human tissues and cell lines.  It is believed to be a novel Rab protein involved in regulating Golgi-associated vesicular transport during cellular endocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.   Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=99.53  E-value=5.7e-14  Score=99.44  Aligned_cols=157  Identities=18%  Similarity=0.182  Sum_probs=87.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEE-ECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             689997489988989999973897379873888414521202665556785-0896499997600101112244789888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK-NNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~-~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      -+|+++|-++||||||+++++..+.. . ...|+....    ......... .....+.++||+|.+..........+  
T Consensus         3 fKivllGd~~VGKTsL~~rf~~~~F~-~-~~~~Tig~d----f~~k~i~i~dg~~v~l~IwDTaGqe~~~si~~~yyr--   74 (211)
T cd04111           3 FRLIVIGDSTVGKSSLLKRFTEGRFA-E-VSDPTVGVD----FFSRLIEIEPGVRIKLQLWDTAGQERFRSITRSYYR--   74 (211)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCC-C-CCCCCCCEE----EEEEEEEECCCCEEEEEEEECCCCCCCCCCHHHHHH--
T ss_conf             99999999996199999999819999-9-868720168----899899977995999999979886345644287742--


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCC--CCHHH---HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             8998777766420000011223578--87545---455432102575322122221111024689999999999753136
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHG--VKQID---QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT  183 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~---~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~  183 (212)
                                 -....+++.+....  +....   .+..........++++|.||+|+....++.  .++.++....+  
T Consensus        75 -----------~a~g~ilVyDvt~~~SF~~l~~W~~ei~~~~~~~~~~iiLVGNK~DL~~~R~Vs--~ee~~~~A~~~--  139 (211)
T cd04111          75 -----------NSVGVLLVFDITNRESFEHVHDWLEEARSHIQPHRPVFILVGHKCDLESQRQVT--REEAEKLAKDL--  139 (211)
T ss_pred             -----------HCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHCCCC--HHHHHHHHHHH--
T ss_conf             -----------124468971477779999999999999997498885389887423128567889--99999999983--


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             898689998888899899999999872
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                       +-+++.+||++|.||+++++.|.+.+
T Consensus       140 -~~~f~EtSAK~g~nV~e~F~~la~~i  165 (211)
T cd04111         140 -GMKYIETSARTGDNVEEAFELLTQEI  165 (211)
T ss_pred             -CCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             -99799975999819899999999999


No 165
>cd04133 Rop_like Rop subfamily.  The Rop (Rho-related protein from plants) subfamily plays a role in diverse cellular processes, including cytoskeletal organization, pollen and vegetative cell growth, hormone responses, stress responses, and pathogen resistance.  Rops are able to regulate several downstream pathways to amplify a specific signal by acting as master switches early in the signaling cascade.  They transmit a variety of extracellular and intracellular signals.  Rops are involved in establishing cell polarity in root-hair development, root-hair elongation, pollen-tube growth, cell-shape formation, responses to hormones such as abscisic acid (ABA) and auxin, responses to abiotic stresses such as oxygen deprivation, and disease resistance and disease susceptibility.  An individual Rop can have a unique function or an overlapping function shared with other Rop proteins; in addition, a given Rop-regulated function can be controlled by one or multiple Rop proteins.  For example, 
Probab=99.53  E-value=1.1e-13  Score=97.76  Aligned_cols=159  Identities=15%  Similarity=0.100  Sum_probs=85.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||+.++++.+..  ....|+....     .............+.++||+|.+........      
T Consensus         2 iKivllGd~~VGKTsL~~rf~~~~F~--~~~~pTi~~~-----~~~~i~v~~~~~~l~iwDTaG~e~~~~l~~~------   68 (176)
T cd04133           2 IKCVTVGDGAVGKTCMLICYTSNKFP--TDYIPTVFDN-----FSANVSVDGNTVNLGLWDTAGQEDYNRLRPL------   68 (176)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCEEEE-----EEEEEEECCEEEEEEEEECCCCCCCCHHHHH------
T ss_conf             79999899997799999999659899--9867853589-----9999999998999999979997654246898------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCC--CCCHH-HHHHHHH-HCCCCCCCCCCCCCCCCCCHHHHHH--------HHHHHHHH
Q ss_conf             99877776642000001122357--88754-5455432-1025753221222211110246899--------99999999
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRH--GVKQI-DQDVFSF-LDKKAVSYQIVLTKIDKLSPTTAQE--------TLEKTKYL  177 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~-~~~~~~~-~~~~~~~~~~v~nK~D~~~~~~~~~--------~~~~~~~~  177 (212)
                          ...   .....+.+.+...  .+... .....+. ......|++++.||+|+.+......        ...+-.+.
T Consensus        69 ----~y~---~a~~~ilvydi~~~~Sf~~~~~~w~~~~~~~~~~~piilvGnK~DL~~~r~~~~~~~~~~~Vs~~e~~~~  141 (176)
T cd04133          69 ----SYR---GADVFVLAFSLISRASYENVLKKWVPELRHYAPNVPIVLVGTKLDLRDDKQYLADHPGASPITTAQGEEL  141 (176)
T ss_pred             ----HHC---CCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHCHHHHHHCCCCCCCCHHHHHHH
T ss_conf             ----726---7875799997898789999999999999986849988999986320212223333024677779999999


Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             753136898689998888899899999999872
Q gi|254780484|r  178 IRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       178 ~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ...  .+...++.+||++|.|++++++.+.+.+
T Consensus       142 a~~--~~~~~y~EtSAk~~~nV~e~F~~~~~~i  172 (176)
T cd04133         142 RKQ--IGAAAYIECSSKTQQNVKAVFDAAIKVV  172 (176)
T ss_pred             HHH--CCCCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             997--7997899947898809899999999998


No 166
>cd01857 HSR1_MMR1 HSR1/MMR1.  Human HSR1, is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N terminus.
Probab=99.52  E-value=2.5e-14  Score=101.47  Aligned_cols=57  Identities=42%  Similarity=0.627  Sum_probs=46.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHH
Q ss_conf             8689997489988989999973897379873888414521202665556785089649999760010
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYG   95 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~   95 (212)
                      ...|+++|+||||||||+|+|.|+++ +.+++.||+|+....         ...+..+.++||||+.
T Consensus        83 ~~~i~ivG~PNVGKSSlIN~L~g~k~-~~v~~~PG~Tr~~~~---------i~~~~~i~liDTPGi~  139 (141)
T cd01857          83 NATIGLVGYPNVGKSSLINALVGKKK-VSVSATPGKTKHFQT---------IFLTPTITLCDCPGLV  139 (141)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCE-EEECCCCCCCCCEEE---------EEECCCEEEEECCCCC
T ss_conf             62689977888669999999858866-876599941576689---------9968999999898868


No 167
>cd00157 Rho Rho (Ras homology) family.  Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop.  There are 22 human Rho family members identified currently.  These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli.  They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase.  These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors).  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho protein
Probab=99.52  E-value=9.2e-14  Score=98.25  Aligned_cols=158  Identities=14%  Similarity=0.107  Sum_probs=83.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||++++++.+..  ..-.|+. ..    ..............+.++||+|..........      
T Consensus         1 iKi~llGd~~VGKTsli~r~~~~~f~--~~y~~Ti-~~----~~~~~~~~~~~~~~l~iwDt~G~e~~~~~~~~------   67 (171)
T cd00157           1 IKIVVVGDGAVGKTCLLISYTTGKFP--TEYVPTV-FD----NYSATVTVDGKQVNLGLWDTAGQEEYDRLRPL------   67 (171)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCC--CCCCCEE-EE----EEEEEEEECCEEEEEEEEECCCCCCCCCCHHH------
T ss_conf             98999999996699999999629999--8758803-46----66899999999999999989987102413223------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHHH--HCCCCCCCCCCCCCCCCCCHHHHHHH---------HHHHHH
Q ss_conf             998777766420000011223578--87545455432--10257532212222111102468999---------999999
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHG--VKQIDQDVFSF--LDKKAVSYQIVLTKIDKLSPTTAQET---------LEKTKY  176 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~--~~~~~~~~~~v~nK~D~~~~~~~~~~---------~~~~~~  176 (212)
                          ..   ......+.+.+....  +..........  ......|++++.||+|+.+.......         .++..+
T Consensus        68 ----~~---~~a~~~ilvydit~~~Sf~~i~~~w~~~i~~~~~~~piilvgNK~DL~~~~~~~~~~~~~~r~V~~~e~~~  140 (171)
T cd00157          68 ----SY---PNTDVFLICFSVDSPSSFENVKTKWIPEIRHYCPNVPIILVGTKIDLRDDENTLKKLEKGKEPITPEEGEK  140 (171)
T ss_pred             ----HH---HHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHCCCCCCCHHHHHH
T ss_conf             ----44---42658999996897788999999999999985999868999987100123000223311475158999999


Q ss_pred             HHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             975313689868999888889989999999987
Q gi|254780484|r  177 LIRNYPTAHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       177 ~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      ....  .+..+++.+||++|.|++++.+.|.++
T Consensus       141 ~a~~--~~~~~f~E~SAk~g~nV~e~F~~l~ra  171 (171)
T cd00157         141 LAKE--IGAIGYMECSALTQEGVKEVFEEAIRA  171 (171)
T ss_pred             HHHH--CCCCEEEEECCCCCCCHHHHHHHHHCC
T ss_conf             9998--499889997878995989999999668


No 168
>cd04148 RGK RGK subfamily.  The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues.   RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function.  Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells.  RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton.  Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ra
Probab=99.52  E-value=5.3e-14  Score=99.62  Aligned_cols=156  Identities=11%  Similarity=0.077  Sum_probs=85.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|-++||||||++.++..+.....  ++++...   ...............+.++||+|......   ..      
T Consensus         2 KVvllGd~gVGKTSLi~rf~~~~f~~~~--y~~t~~~---d~~~k~v~vd~~~~~l~i~Dt~g~e~~~~---~~------   67 (221)
T cd04148           2 RVVMLGSPGVGKSSLASQFTSGEYDDHA--YDASGDD---DTYERTVSVDGEESTLVVIDHWEQEMWTE---DS------   67 (221)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCCCC--CCCCCCE---EEEEEEEEECCEEEEEEEEECCCCHHHHH---HH------
T ss_conf             7999998997099999999819869866--7874424---88999999999998999998987312666---65------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCC--CCCHHH---HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9877776642000001122357--887545---45543210257532212222111102468999999999975313689
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRH--GVKQID---QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~--~~~~~~---~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                       . ..   ...+..+.+.+...  .+....   ..+.........|+++|.||+|+....++.  .++-++....+   +
T Consensus        68 -~-~~---~~ada~ilVYdvtdr~SF~~~~~~~~~l~~~~~~~~~piILVGNK~DL~~~R~Vs--~eEg~~~A~~~---~  137 (221)
T cd04148          68 -C-MQ---YQGDAFVVVYSVTDRSSFERASELRIQLRRNRQLEDRPIILVGNKSDLARSREVS--VQEGRACAVVF---D  137 (221)
T ss_pred             -H-HH---HCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHCCCC--HHHHHHHHHHC---C
T ss_conf             -6-53---0686899999646677888899999999986489995199985356668638999--99999999985---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++.+||++|.||+++++.|+..+
T Consensus       138 ~~F~EtSAk~~~NV~elF~~lvrqI  162 (221)
T cd04148         138 CKFIETSAGLQHNVDELLEGIVRQI  162 (221)
T ss_pred             CEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             9899945799949899999999999


No 169
>TIGR01394 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298   This bacterial (and Arabidopsis) protein, termed TypA or BipA, is a GTP-binding protein. It is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways, but the precise function is unknown.; GO: 0005525 GTP binding, 0005622 intracellular.
Probab=99.51  E-value=2.4e-14  Score=101.56  Aligned_cols=166  Identities=19%  Similarity=0.226  Sum_probs=122.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCC-EEEE-C--------CCCCEEEECCEEEEEEEEEEEECC----CEEEEEECCHHHH
Q ss_conf             899974899889899999738973-7987-3--------888414521202665556785089----6499997600101
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKN-LART-S--------NAPGRTQHLNFFVPKDFSNLKNNL----PAMALVDMPGYGY   96 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~-~a~~-~--------~~p~tt~~~~~~~~~~~~~~~~~~----~~~~~~DtpG~~~   96 (212)
                      -|||+-|..+||+||+-+|+.|-- .-.- .        +..---+..+.|-.....-+.+.+    ..+.++||||+-+
T Consensus         3 NIAIIAHVDHGKTTLVD~LL~Qsgf~f~~~~~~~~ER~MDSNDLErERGITILaKNTav~y~g~dG~~~INIvDTPGHAD   82 (609)
T TIGR01394         3 NIAIIAHVDHGKTTLVDALLKQSGFTFRADNEAVAERVMDSNDLERERGITILAKNTAVRYNGKDGVTKINIVDTPGHAD   82 (609)
T ss_pred             CEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHCCCCCCCEEEEEEECCCCCEEEEEEEECCCCCC
T ss_conf             18999880699436898888876588641588321354067652100155201300366252889718997781689887


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             11224478988889987777664200000112235788754545543210257532212222111102468999999999
Q gi|254780484|r   97 ARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKY  176 (212)
Q Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~  176 (212)
                      +-..-+...             -..+.+++++|+..+..+|..-........+.+.++|+||+|+-+ ...++..+.+-+
T Consensus        83 FGGEVERvL-------------~MVDGvlLlVDA~EGPMPQTrFVL~KAL~~gLkPIVViNKiDrp~-ARP~eV~d~vFD  148 (609)
T TIGR01394        83 FGGEVERVL-------------GMVDGVLLLVDASEGPMPQTRFVLKKALELGLKPIVVINKIDRPS-ARPDEVVDEVFD  148 (609)
T ss_pred             CCCEEEEEC-------------EEEEEEEEEEECCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCC-CCHHHHHHHHHH
T ss_conf             886588733-------------024058999857888988534789999956893699971347887-883788757878


Q ss_pred             HHHHCCCC----CCCEEEEECCCCC---------------CHHHHHHHHHHHH
Q ss_conf             97531368----9868999888889---------------9899999999872
Q gi|254780484|r  177 LIRNYPTA----HPEVIPTSSVKRK---------------GIEVLRKAILETI  210 (212)
Q Consensus       177 ~~~~~~~~----~~~i~~vSA~~g~---------------Gi~eL~~~I~~~l  210 (212)
                      ++......    +-|+++-||+.|+               +++.|++.|.+++
T Consensus       149 LF~~LgA~deQLDFP~vYASa~~G~A~l~~~~dg~~~~~~~m~PLFd~I~~hv  201 (609)
T TIGR01394       149 LFIELGADDEQLDFPIVYASARAGWASLDKDKDGLDDDSEDMAPLFDAILRHV  201 (609)
T ss_pred             HHHHCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             88853888001012567665236720144665778872201789998986406


No 170
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases. Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Probab=99.51  E-value=3.2e-13  Score=95.13  Aligned_cols=157  Identities=11%  Similarity=0.104  Sum_probs=83.5

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99974899889899999738973798738884145212026655567850896499997600101112244789888899
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLI  111 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~  111 (212)
                      |+++|.++||||||++++++.+..  ..-.|+.  ..   ..............+.++||+|.+........        
T Consensus         1 ivllGd~~VGKTsli~r~~~~~f~--~~y~~Ti--~~---~~~~~~~~~~~~~~l~i~DtaG~e~~~~l~~~--------   65 (174)
T smart00174        1 LVVVGDGAVGKTCLLISYTTNAFP--EDYVPTV--FE---NYSADVEVDGKPVELGLWDTAGQEDYDRLRPL--------   65 (174)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCC--CCCCCCE--EE---EEEEEEEECCEEEEEEEEECCCCCCCCCCCHH--------
T ss_conf             599897897599999999539899--9857850--57---89999999999999999948987034545001--------


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCC--CHHHHHHHHHH--CCCCCCCCCCCCCCCCCCHHHHHHH----------HHHHHHH
Q ss_conf             87777664200000112235788--75454554321--0257532212222111102468999----------9999999
Q gi|254780484|r  112 VRYLSERSTLRCVYLLIDCRHGV--KQIDQDVFSFL--DKKAVSYQIVLTKIDKLSPTTAQET----------LEKTKYL  177 (212)
Q Consensus       112 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~~~~----------~~~~~~~  177 (212)
                        ..   ......+++.+.....  ...........  .....|+++|.||+|+.+.......          .++.++.
T Consensus        66 --~~---~~a~~~ilvydvt~~~Sf~~~~~~w~~~i~~~~~~~piilVgnK~DL~~~~~~~~~~~~~~~~~Vs~~~~~~~  140 (174)
T smart00174       66 --SY---PDTDVFLICFSVDSPASFENVKEKWYPEVKHFCPNTPIILVGTKLDLREDKSTLRELSKQKQEPVTYEQGEAL  140 (174)
T ss_pred             --HC---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             --10---4886899997589878999999989999998688986999987542501233354553314650029999999


Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             753136898689998888899899999999872
Q gi|254780484|r  178 IRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       178 ~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ...  .+..+++.+||++|.|++++++.+.+.+
T Consensus       141 a~~--~~~~~y~EtSAk~g~nV~e~F~~l~r~~  171 (174)
T smart00174      141 AKR--IGAVKYLECSALTQEGVREVFEEAIRAA  171 (174)
T ss_pred             HHH--CCCCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             998--3997899964588949899999999997


No 171
>cd01871 Rac1_like Rac1-like subfamily.  The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1.  While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively.  Rac1 stimulates the formation of actin lamellipodia and membrane ruffles.  It also plays a role in cell-matrix adhesion and cell anoikis.  In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis.  Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation.  In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis.  Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti
Probab=99.51  E-value=2.1e-13  Score=96.18  Aligned_cols=160  Identities=11%  Similarity=0.097  Sum_probs=85.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|-++||||||+.+++..+..  ..-.| |....    .............+.++||+|..........      
T Consensus         2 iKivlvGd~~VGKTsli~r~~~~~f~--~~~~~-Ti~~~----~~~~i~~~~~~v~l~iwDtaGqe~~~~~~~~------   68 (174)
T cd01871           2 IKCVVVGDGAVGKTCLLISYTTNAFP--GEYIP-TVFDN----YSANVMVDGKPVNLGLWDTAGQEDYDRLRPL------   68 (174)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCC--CCCCC-EEEEE----EEEEEEECCEEEEEEEECCCCCCCCHHHHHH------
T ss_conf             69999899998699999999739999--98688-37887----6799999999999999869997240678899------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHHH--HCCCCCCCCCCCCCCCCCCHHHHHHHHHH-----H----HH
Q ss_conf             998777766420000011223578--87545455432--10257532212222111102468999999-----9----99
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHG--VKQIDQDVFSF--LDKKAVSYQIVLTKIDKLSPTTAQETLEK-----T----KY  176 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~--~~~~~~~~~~v~nK~D~~~~~~~~~~~~~-----~----~~  176 (212)
                          .....   ...+.+.+....  +..........  ......|+++|.||+|+.+..+..+....     +    ..
T Consensus        69 ----~~~~a---~~~ilvydi~~~~SF~~i~~~w~~~i~~~~~~~piiLVGnK~DL~~~~~~~~~~~~~~~~~vs~~eg~  141 (174)
T cd01871          69 ----SYPQT---DVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGL  141 (174)
T ss_pred             ----HHHHC---CEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHH
T ss_conf             ----87406---68999986798788999999999999985889997987473013100456778865146775899999


Q ss_pred             HHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9753136898689998888899899999999872
Q gi|254780484|r  177 LIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       177 ~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+.. ..+..+++.+||++|.||+++.+.+.+.+
T Consensus       142 ~~a~-~~~~~~f~EtSAk~~~nV~e~F~~lir~i  174 (174)
T cd01871         142 AMAK-EIGAVKYLECSALTQKGLKTVFDEAIRAV  174 (174)
T ss_pred             HHHH-HCCCCEEEECCCCCCCCHHHHHHHHHHHC
T ss_conf             9998-75997899918788959799999999519


No 172
>PTZ00336 elongation factor 1-alpha; Provisional
Probab=99.50  E-value=4.6e-13  Score=94.23  Aligned_cols=158  Identities=14%  Similarity=0.189  Sum_probs=96.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHC---------------------CCC--EEEECCCCCEEEECCEEEEEEEEEEEECCCEEE
Q ss_conf             899974899889899999738---------------------973--798738884145212026655567850896499
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVN---------------------RKN--LARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMA   87 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g---------------------~~~--~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~   87 (212)
                      .|+++|+.++|||||+-+|+-                     +..  .+-..+..-..+..+.+.......+......+.
T Consensus         9 ni~~~GhVD~GKSTL~G~Ll~~~~~v~~~~l~~~~~~~~~~g~~s~~~a~~~D~~~~Er~rGiTid~~~~~f~t~~~~~~   88 (449)
T PTZ00336          9 NLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVFT   88 (449)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHCCCHHHHCCCEEEEEEEEEEECCCEEEE
T ss_conf             99999277896888899999874884789999999999871875143254512772232287589867999974984899


Q ss_pred             EEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCH-------HHHHHHHHHCCCCCCC-CCCCCCC
Q ss_conf             9976001011122447898888998777766420000011223578875-------4545543210257532-2122221
Q gi|254780484|r   88 LVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQ-------IDQDVFSFLDKKAVSY-QIVLTKI  159 (212)
Q Consensus        88 ~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~-~~v~nK~  159 (212)
                      ++|+||+..+..             .+.......+..+.++++..+..+       |..+........+.+. ++++||+
T Consensus        89 iiD~PGH~~fi~-------------nmi~Gas~aD~aiLVVdA~~G~~e~g~~~~gQTreHl~i~~~Lgv~~iiV~vNKm  155 (449)
T PTZ00336         89 IIDAPGHRDFIK-------------NMITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKM  155 (449)
T ss_pred             EEECCCHHHHHH-------------HHHHHHCCCCEEEEEEECCCCCEECCCCCCCCCHHHHHHHHHCCCCEEEEEEECC
T ss_conf             986894688899-------------9997650067679999878774103556677539999999866997799998620


Q ss_pred             CC--CC--HHHHHHHHHHHHHHHHHCC--CCCCCEEEEECCCCCCHHH
Q ss_conf             11--10--2468999999999975313--6898689998888899899
Q gi|254780484|r  160 DK--LS--PTTAQETLEKTKYLIRNYP--TAHPEVIPTSSVKRKGIEV  201 (212)
Q Consensus       160 D~--~~--~~~~~~~~~~~~~~~~~~~--~~~~~i~~vSA~~g~Gi~e  201 (212)
                      |.  ++  .+..++...++...+....  ....+++|+||.+|.|+-+
T Consensus       156 D~~~v~~~~~r~~~i~~e~~~~l~~~g~~~~~v~~IPiSa~~Gdni~~  203 (449)
T PTZ00336        156 DDKTVTYAQSRYDEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIE  203 (449)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             156621137899999999999998749990005435420104777532


No 173
>PRK09601 translation-associated GTPase; Reviewed
Probab=99.50  E-value=2.9e-13  Score=95.38  Aligned_cols=68  Identities=25%  Similarity=0.193  Sum_probs=49.8

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEE-----------ECCCEEEEEECCHHHHHH
Q ss_conf             689997489988989999973897379873888414521202665556785-----------089649999760010111
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK-----------NNLPAMALVDMPGYGYAR   98 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~-----------~~~~~~~~~DtpG~~~~~   98 (212)
                      .+++|||.||||||||||+||+.+  +...++|++|..++...........           .-..++.++|.||+....
T Consensus         3 mkiGivGlPnvGKSTlFnalT~~~--~~~~nyPf~Ti~pn~g~v~VpD~r~~~l~~~~~p~k~i~a~v~~vDiaGLv~gA   80 (364)
T PRK09601          3 LKCGIVGLPNVGKSTLFNALTKAG--AEAANYPFCTIEPNVGIVPVPDPRLDKLAEIVKPKKIVPTTIEFVDIAGLVKGA   80 (364)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCC--CCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCC
T ss_conf             248887799998899999996799--864589988878800688578545899987628765011258999657767875


Q ss_pred             H
Q ss_conf             2
Q gi|254780484|r   99 A   99 (212)
Q Consensus        99 ~   99 (212)
                      .
T Consensus        81 s   81 (364)
T PRK09601         81 S   81 (364)
T ss_pred             C
T ss_conf             3


No 174
>cd01892 Miro2 Miro2 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the putative GTPase domain in the C terminus of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=99.50  E-value=2e-13  Score=96.36  Aligned_cols=161  Identities=12%  Similarity=0.031  Sum_probs=90.1

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      ++-++.++|.++||||||++++++.+.. ...-.|+.....    .............+.++||+|.+.........   
T Consensus         3 ~vfk~~VlG~~~VGKTsLi~rf~~~~f~-~~~y~~Ti~~~~----~~k~v~v~g~~~~L~i~Dt~g~e~~~~l~~~~---   74 (169)
T cd01892           3 NVFLCFVLGAKGSGKSALLRAFLGRSFS-LNAYSPTIKPRY----AVNTVEVYGQEKYLILREVGEDEVAILLNDAE---   74 (169)
T ss_pred             EEEEEEEECCCCCCHHHHHHHHHCCCCC-CCCCCCCCCCEE----EEEEEEECCEEEEEEEEECCCCHHHHHHHHHH---
T ss_conf             0899999999998899999999649998-666567546618----99999989999999998556532355665887---


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCC--HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             8899877776642000001122357887--54545543210257532212222111102468999999999975313689
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVK--QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                                ....+..+++.|......  ..............+|+++|.||+|+....++.  ..+..+.....  +.
T Consensus        75 ----------~~~ad~~ilVyDit~~~SF~~i~~~~~~~~~~~~iP~vlVgNK~DL~~~rqV~--~~e~~~~a~~~--~~  140 (169)
T cd01892          75 ----------LAACDVACLVYDSSDPKSFSYCAEVYKKYFMLGEIPCLFVAAKADLDEQQQRY--EVQPDEFCRKL--GL  140 (169)
T ss_pred             ----------HCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCC--HHHHHHHHHHC--CC
T ss_conf             ----------54698899999799878999999999970056898189998865542037546--77699999983--99


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ..++.+||++|.|++++...|.+..
T Consensus       141 ~~~~e~SAktg~nv~~~F~~la~~a  165 (169)
T cd01892         141 PPPLHFSSKLGDSSNELFTKLATAA  165 (169)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             9666998327989899999999997


No 175
>cd04178 Nucleostemin_like Nucleostemin-like.  Nucleostemin (NS) is a nucleolar protein that functions as a regulator of cell growth and proliferation in stem cells and in several types of cancer cells, but is not expressed in the differentiated cells of most mammalian adult tissues.  NS shuttles between the nucleolus and nucleoplasm bidirectionally at a rate that is fast and independent of cell type.  Lowering GTP levels decreases the nucleolar retention of NS, and expression of NS is abruptly down-regulated during differentiation prior to terminal cell division.  Found only in eukaryotes, NS consists of an N-terminal basic domain, a coiled-coil domain, a GTP-binding domain, an intermediate domain, and a C-terminal acidic domain.  Experimental evidence indicates that NS uses its GTP-binding property as a molecular switch to control the transition between the nucleolus and nucleoplasm, and this process involves interaction between the basic, GTP-binding, and intermediate domains of the 
Probab=99.50  E-value=5.5e-14  Score=99.56  Aligned_cols=57  Identities=32%  Similarity=0.422  Sum_probs=45.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHH
Q ss_conf             6868999748998898999997389737987388841452120266555678508964999976001
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGY   94 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~   94 (212)
                      ...+|++||.||||||||+|+|.|++ .+.++..||.|+.....        .. ...+.++||||+
T Consensus       116 ~~i~v~vvG~PNVGKSSlIN~L~~~k-~~~v~~~PG~Tk~~q~i--------~l-~~~i~L~DtPGv  172 (172)
T cd04178         116 TSITVGVVGFPNVGKSSLINSLKRSR-ACNVGATPGVTKSMQEV--------HL-DKKVKLLDSPGI  172 (172)
T ss_pred             CCEEEEEEECCCCCHHHHHHHHHCCC-EEEECCCCCEEEEEEEE--------EE-CCCEEEEECCCC
T ss_conf             65599998347742578998873474-47765999547667999--------95-899899969199


No 176
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF. Members of this protein family are GTP-binding proteins involved in ribosome biogenesis, including the essential YlqF protein of Bacillus subtilis, which is an essential protein. They are related to Era, EngA, and other GTPases of ribosome biogenesis, but are circularly permuted. This family is not universal, and is not present in Escherichia coli, and so is not as well studied as some other GTPases. This model is built for bacterial members.
Probab=99.50  E-value=4.1e-14  Score=100.27  Aligned_cols=61  Identities=34%  Similarity=0.534  Sum_probs=48.1

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARA   99 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~   99 (212)
                      ..+|++||+||||||||+|+|.|++ .+.|+..||+|+......        . +..+.++||||......
T Consensus       118 ~i~v~vVG~PNVGKSSlIN~L~~~k-~~~v~~~PG~Tr~~q~i~--------l-~~~i~llDtPGvl~P~~  178 (276)
T TIGR03596       118 PIRAMIVGIPNVGKSTLINRLAGKK-VAKVGNRPGVTKGQQWIK--------L-SDGLELLDTPGILWPKF  178 (276)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHCCC-EEEECCCCCCCCEEEEEE--------E-CCCEEEECCCCCCCCCC
T ss_conf             6389997279875899999873672-587779654210258999--------5-79779966887457887


No 177
>pfam01926 MMR_HSR1 GTPase of unknown function.
Probab=99.50  E-value=9.8e-14  Score=98.09  Aligned_cols=106  Identities=27%  Similarity=0.340  Sum_probs=80.7

Q ss_pred             CHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89899999738973798738884145212026655567850896499997600101112244789888899877776642
Q gi|254780484|r   41 GKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST  120 (212)
Q Consensus        41 GKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~  120 (212)
                      |||||+|+|+|++ .+.+++.|++|+.+.      ......++..+.++||||+..........     ...........
T Consensus         1 GKSsLiN~L~~~~-~~~v~~~~gtT~~~~------~~~~~~~~~~i~liDTPGi~~~~~~~~~~-----~~~~~~~~~~~   68 (106)
T pfam01926         1 GKSTLINALTGKK-RAIVSDYPGTTRDPN------EGRVELDGKQIILVDTPGIIEGASKGEGE-----LGNRTLEAIEE   68 (106)
T ss_pred             CHHHHHHHHHCCC-CEEECCCCCCCCCCE------EEEEEECCEEEEEEECCCCCCCCCHHHHH-----HHHHHHHHCCC
T ss_conf             9127999997888-555528899884635------58998899889998378732265046788-----89999972345


Q ss_pred             HCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             00000112235788754545543210257532212222
Q gi|254780484|r  121 LRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTK  158 (212)
Q Consensus       121 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK  158 (212)
                      .+.++++.|...+....+....+++....+|.++++||
T Consensus        69 ~d~il~viD~~~~~~~~d~~~~~~l~~~~~p~iiv~NK  106 (106)
T pfam01926        69 ADLILHVVDASEGLTEEDLEILDLLLELGKPVILVLNK  106 (106)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             73799999999999989999999999869988999939


No 178
>PRK00741 prfC peptide chain release factor 3; Provisional
Probab=99.50  E-value=9.4e-13  Score=92.44  Aligned_cols=122  Identities=14%  Similarity=0.210  Sum_probs=83.6

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHH---CC-CCEEEE----CCCCCEE------EECCEEEEEEEEEEEECCCEEEEEECCH
Q ss_conf             68689997489988989999973---89-737987----3888414------5212026655567850896499997600
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILV---NR-KNLART----SNAPGRT------QHLNFFVPKDFSNLKNNLPAMALVDMPG   93 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~---g~-~~~a~~----~~~p~tt------~~~~~~~~~~~~~~~~~~~~~~~~DtpG   93 (212)
                      .+..|||+|++.+|||||.-+|+   |. ++...|    .....++      ...+...........+.+..+.++||||
T Consensus         9 ~~RniaIi~H~dAGKTTLtE~lL~~~GaI~~~G~V~~~~~~~~~~sD~~~~E~~RgiSI~ssv~~~e~~~~~iNliDTPG   88 (526)
T PRK00741          9 KRRTFAIISHPDAGKTTLTEKLLLFGGAIQEAGTVKGRKSGRHATSDWMEMEKQRGISVTSSVMQFPYRDCLINLLDTPG   88 (526)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCHHHHHCCCEEECCEEEEEECCEEEEEEECCC
T ss_conf             11779999378989899999999746752448466314678864678858899759648615177867898999990989


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             101112244789888899877776642000001122357887545455432102575322122221111
Q gi|254780484|r   94 YGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL  162 (212)
Q Consensus        94 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~  162 (212)
                      +..+..             .........+..+.+.++..+...+.....+.+...++|.+..+||+|..
T Consensus        89 h~DF~~-------------e~~raL~a~D~Av~Vida~~GVe~qTe~~w~~~~~~~iP~i~FINKmDR~  144 (526)
T PRK00741         89 HEDFSE-------------DTYRTLTAVDSALMVIDAAKGVEPQTRKLMEVCRLRDTPIFTFINKLDRD  144 (526)
T ss_pred             CHHHHH-------------HHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             467789-------------99999987375999997775523336899999886399889999656767


No 179
>PRK09563 rbgA ribosomal biogenesis GTPase; Reviewed
Probab=99.50  E-value=5.5e-14  Score=99.53  Aligned_cols=61  Identities=34%  Similarity=0.510  Sum_probs=47.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARA   99 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~   99 (212)
                      ..+|++||.||||||||+|+|.|++ .+.|++.||+|+......         -+..+.++||||......
T Consensus       121 ~i~v~vvG~PNVGKSSlIN~L~~~k-~~~v~~~PG~Tk~~q~v~---------l~~~i~L~DtPGvl~P~~  181 (282)
T PRK09563        121 AIRAMIIGIPNVGKSTLINRLAGKK-IAKTGNRPGVTKSQQWIK---------LGKGLELLDTPGILWPKL  181 (282)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHCCC-EEEECCCCCCEEEEEEEE---------ECCCEEEECCCCCCCCCC
T ss_conf             6389997069776799999874770-587679654100258999---------579889966887457887


No 180
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=99.49  E-value=1.5e-13  Score=97.02  Aligned_cols=156  Identities=16%  Similarity=0.141  Sum_probs=84.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||++++.+..-.  ..-.|+....    ..............+.++||+|........         
T Consensus         2 Ki~vvG~~~vGKTsli~r~~~~~f~--~~~~~tig~d----~~~k~v~~~~~~~~l~i~D~~g~e~~~~~~---------   66 (161)
T cd01861           2 KLVFLGDQSVGKTSIITRFMYDTFD--NQYQATIGID----FLSKTMYLEDKTVRLQLWDTAGQERFRSLI---------   66 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEE----EEEEEEEECCEEEEEEEEECCCCHHHHHHH---------
T ss_conf             7999997997899999999319999--9848975678----899999999999999999799853157888---------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCC--CHHHHHH--HHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             987777664200000112235788--7545455--432102575322122221111024689999999999753136898
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGV--KQIDQDV--FSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP  186 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~--~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (212)
                       ....   ......+++.+.....  ......+  .........|++++.||+|+..+..+.  .++.......   .+-
T Consensus        67 -~~~~---~~~~~~ilvfd~t~~~Sf~~~~~w~~~i~~~~~~~~~ivlvGnK~Dl~~~r~v~--~~e~~~~a~~---~~~  137 (161)
T cd01861          67 -PSYI---RDSSVAVVVYDITNRQSFDNTDKWIDDVRDERGNDVIIVLVGNKTDLSDKRQVS--TEEGEKKAKE---LNA  137 (161)
T ss_pred             -HHHH---HHHCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHCCCCC--HHHHHHHHHH---CCC
T ss_conf             -9886---652589999847998999999999999998657898499961021102217789--9999999998---499


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             689998888899899999999872
Q gi|254780484|r  187 EVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       187 ~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +++.+||++|.|++++.+.|.+.|
T Consensus       138 ~y~E~Sak~~~nV~e~F~~la~~l  161 (161)
T cd01861         138 MFIETSAKAGHNVKELFRKIASAL  161 (161)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHC
T ss_conf             899983477808899999999709


No 181
>cd01886 EF-G Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group conta
Probab=99.49  E-value=1.4e-12  Score=91.38  Aligned_cols=118  Identities=13%  Similarity=0.154  Sum_probs=83.9

Q ss_pred             EEEECCCCCCHHHHHHHHHCC----CCEEEECCCCCEE------EECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH
Q ss_conf             999748998898999997389----7379873888414------521202665556785089649999760010111224
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNR----KNLARTSNAPGRT------QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~----~~~a~~~~~p~tt------~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~  101 (212)
                      |||+|+.++|||||.-+|+=.    .+...+.+..+.+      ...+...........+.+..+.++||||+..+..  
T Consensus         2 iai~gH~gaGKTtL~EalL~~ag~i~r~G~v~~g~tv~D~~~eE~~R~isi~~~~~~~~w~~~~inliDTPG~~DF~~--   79 (270)
T cd01886           2 IGIIAHIDAGKTTTTERILYYTGRIHKIGEVHGGGATMDFMEQERERGITIQSAATTCFWKDHRINIIDTPGHVDFTI--   79 (270)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCHHHHHCCCEEECCEEEEEECCEEEEEEECCCCHHHHH--
T ss_conf             899968999988999999986687355815538975566848898768707336689998998999986969678899--


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             4789888899877776642000001122357887545455432102575322122221111
Q gi|254780484|r  102 KNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL  162 (212)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~  162 (212)
                                 .........+..+.+.++..+...+.....+.+....+|.++++||+|.-
T Consensus        80 -----------e~~~aL~~~D~AviVv~a~~GVe~~T~~~w~~~~~~~lP~i~fINKmDre  129 (270)
T cd01886          80 -----------EVERSLRVLDGAVAVFDAVAGVEPQTETVWRQADRYNVPRIAFVNKMDRT  129 (270)
T ss_pred             -----------HHHHHHHHHCEEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             -----------99999877555999984676442636999988998499989999887877


No 182
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional
Probab=99.49  E-value=7.4e-13  Score=93.04  Aligned_cols=161  Identities=16%  Similarity=0.171  Sum_probs=112.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCC-CC------------------------EEEECCCCCEEEECCEEEEEEEEEEEEC
Q ss_conf             6868999748998898999997389-73------------------------7987388841452120266555678508
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNR-KN------------------------LARTSNAPGRTQHLNFFVPKDFSNLKNN   82 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~-~~------------------------~a~~~~~p~tt~~~~~~~~~~~~~~~~~   82 (212)
                      ++.++..+|+...|||||+-+|+-. +.                        .|-..+.--..+..+.+.+.-+..+...
T Consensus         6 ~~l~~~~~G~VD~GKSTliGrlL~dt~~i~~d~~~~~~~~s~~~g~~~~~~~~a~l~D~l~~EreqGiTIDva~~~F~t~   85 (613)
T PRK05506          6 TLLRFITCGSVDDGKSTLIGRLLYDSKMIFEDQLAALERDSKKVGTQGDEIDLALLVDGLAAEREQGITIDVAYRYFSTP   85 (613)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHCCCEEEEEEEEEECC
T ss_conf             62589999366797888988999981996789999999999981898886035442148888985597168567788438


Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-CCCCCCCCCC
Q ss_conf             964999976001011122447898888998777766420000011223578875454554321025753-2212222111
Q gi|254780484|r   83 LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS-YQIVLTKIDK  161 (212)
Q Consensus        83 ~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~  161 (212)
                      ...+.++|+||+..+..             .+...+...+..+.++|+..+..+|.....-.+...+++ +++++||+|+
T Consensus        86 ~r~~~i~DaPGH~~y~r-------------NMitgAs~ad~AilliDa~~G~~~QTrrH~~i~~llGI~~iivaVNKMDl  152 (613)
T PRK05506         86 KRKFIVADTPGHEQYTR-------------NMATGASTADLAIILVDARKGVLTQTRRHSFIASLLGIRHIVLAVNKMDL  152 (613)
T ss_pred             CEEEEEECCCCHHHHHH-------------HHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCC
T ss_conf             70599942896798998-------------99987865387999998887951551899999987298759999852012


Q ss_pred             CCH--HHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHH
Q ss_conf             102--4689999999999753136898689998888899899
Q gi|254780484|r  162 LSP--TTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEV  201 (212)
Q Consensus       162 ~~~--~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~e  201 (212)
                      ++-  ..-....+++...+.........++||||.+|+||-.
T Consensus       153 V~y~~~~f~~I~~~~~~~~~~l~~~~~~~IPISAl~GDNVv~  194 (613)
T PRK05506        153 VDYDQEVFDRIVADYLAFAAKLGLTDVTFIPISALKGDNVVT  194 (613)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCEEEE
T ss_conf             478199999999999999965799887599673574874767


No 183
>PRK12739 elongation factor G; Reviewed
Probab=99.49  E-value=1.8e-12  Score=90.86  Aligned_cols=128  Identities=14%  Similarity=0.199  Sum_probs=92.7

Q ss_pred             HHCCCCCCCEEEEECCCCCCHHHHHHHHHC---C-CCEEEECCCCCEE------EECCEEEEEEEEEEEECCCEEEEEEC
Q ss_conf             758876686899974899889899999738---9-7379873888414------52120266555678508964999976
Q gi|254780484|r   22 GLLPKAGPPEIAFSGRSNVGKSSLINILVN---R-KNLARTSNAPGRT------QHLNFFVPKDFSNLKNNLPAMALVDM   91 (212)
Q Consensus        22 ~~~P~~~~p~VaivG~~NvGKSSLiNaL~g---~-~~~a~~~~~p~tt------~~~~~~~~~~~~~~~~~~~~~~~~Dt   91 (212)
                      +..|.+++..|+|+|+..+|||||.-+|.-   . .....+....+.+      +..+.+.........+.+..+.++||
T Consensus         3 ~~~~~e~IRNi~IvaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~s~~~~~~~iNLIDT   82 (693)
T PRK12739          3 REFPLEKTRNIGIMAHIDAGKTTTTERILFYTGKIHKIGEVHDGAATMDWMEQEQERGITITSAATTAFWKDHRINIIDT   82 (693)
T ss_pred             CCCCHHHCEEEEEEECCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCHHHHHCCCCEEECEEEEEECCEEEEEEEC
T ss_conf             87857881399999079989899999999976985657334389756878099987598674552778459989999949


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             00101112244789888899877776642000001122357887545455432102575322122221111
Q gi|254780484|r   92 PGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL  162 (212)
Q Consensus        92 pG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~  162 (212)
                      ||+..+..             .......+.+.++.+.|+..+...+.....+.....++|.++++||+|.+
T Consensus        83 PGHvDF~~-------------EV~~alrv~DgalvvVDaveGV~~qT~~v~rqa~~~~lp~il~iNKiDR~  140 (693)
T PRK12739         83 PGHVDFTI-------------EVERSLRVLDGAVAVFDAVSGVEPQSETVWRQADKYGVPRIVFVNKMDRI  140 (693)
T ss_pred             CCCCHHHH-------------HHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             69740589-------------99999998487999997898876779999999998698969999797889


No 184
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=99.49  E-value=1.3e-13  Score=97.37  Aligned_cols=154  Identities=12%  Similarity=0.109  Sum_probs=91.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|.++|..|||||||+++|.+.+.. .  ..||..  .+      .......+..+.++|++|....+..-...      
T Consensus         1 KIlilGl~~sGKTtil~~l~~~~~~-~--~~pT~G--~~------~~~i~~~~~~l~iwD~gG~~~~r~~w~~Y------   63 (169)
T cd04158           1 RVVTLGLDGAGKTTILFKLKQDEFM-Q--PIPTIG--FN------VETVEYKNLKFTIWDVGGKHKLRPLWKHY------   63 (169)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCCC-C--CCCCCC--CC------EEEEEECCEEEEEEECCCCCCCCHHHHHH------
T ss_conf             9999998999889999999579968-9--778688--16------69999898899999899972446367875------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHH-----HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC-CCC
Q ss_conf             98777766420000011223578875454-----554321025753221222211110246899999999997531-368
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQIDQ-----DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY-PTA  184 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~-~~~  184 (212)
                             ......++++.|......-...     .........+.|++++.||.|+-.....++..+.+.  +... ...
T Consensus        64 -------y~~~~~iIfVvDssd~~~~~ea~~~l~~ll~~~~~~~~piLIlaNK~Dl~~~~~~~ei~~~l~--l~~~~~~~  134 (169)
T cd04158          64 -------YLNTQAVVFVVDSSHRDRVSEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEMTELLS--LHKLCCGR  134 (169)
T ss_pred             -------CCCCCEEEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHC--CHHHCCCC
T ss_conf             -------557627999998630677999999999997127537984999973556777989999999857--05452699


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             98689998888899899999999872
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ...+.++||++|+|++|..++|.+.|
T Consensus       135 ~~~i~~~SA~tG~Gi~e~~~WL~~~i  160 (169)
T cd04158         135 SWYIQGCDARSGMGLYEGLDWLSRQL  160 (169)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             62999555727959899999999999


No 185
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily.  Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II.  Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells.  In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine 
Probab=99.49  E-value=2.1e-13  Score=96.22  Aligned_cols=159  Identities=14%  Similarity=0.134  Sum_probs=87.3

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      +.+|+++|.++||||||+.++++.+..  ....|+....    ..............+.++||+|.+.....        
T Consensus         2 ~~Kiv~lGd~~VGKTsli~r~~~~~F~--~~~~~Tig~d----~~~k~i~v~~~~v~l~iwDtaG~e~~~~s--------   67 (170)
T cd04115           2 IFKIIVIGDSNVGKTCLTYRFCAGRFP--ERTEATIGVD----FRERTVEIDGERIKVQLWDTAGQERFRKS--------   67 (170)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCEEEE----EEEEEEEECCEEEEEEEEECCCCHHHHHH--------
T ss_conf             699999997997799999999539889--9878863078----78999999999999999977885305677--------


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCC--CHHH---HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             89987777664200000112235788--7545---455432102575322122221111024689999999999753136
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGV--KQID---QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT  183 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~---~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~  183 (212)
                       +.....   ....+.+.+.+.....  ....   ............|.+++.||+|+.....+.  .++.++.....  
T Consensus        68 -~~~~~~---~~a~~~ilvydvt~~~Sf~~~~~w~~~i~~~~~~~~~p~vlVGNK~DL~~~r~Vs--~~e~~~~a~~~--  139 (170)
T cd04115          68 -MVQHYY---RNVHAVVFVYDVTNMASFHSLPSWIEECEQHSLPNEVPRILVGNKCDLREQIQVP--TDLAQRFADAH--  139 (170)
T ss_pred             -HHHHHH---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHCCCC--HHHHHHHHHHC--
T ss_conf             -789984---5773579995047476799999999999986588899799999982134117879--99999999977--


Q ss_pred             CCCCEEEEECC---CCCCHHHHHHHHHHHH
Q ss_conf             89868999888---8899899999999872
Q gi|254780484|r  184 AHPEVIPTSSV---KRKGIEVLRKAILETI  210 (212)
Q Consensus       184 ~~~~i~~vSA~---~g~Gi~eL~~~I~~~l  210 (212)
                       +-+++.+||+   +|+||+++...|.+.|
T Consensus       140 -~~~~~E~SAK~~~~~~nV~~~F~~la~~i  168 (170)
T cd04115         140 -SMPLFETSAKDPSENDHVEAIFMTLAHKL  168 (170)
T ss_pred             -CCEEEEECCCCCCCCCCHHHHHHHHHHHH
T ss_conf             -99999988899851708899999999996


No 186
>cd01875 RhoG RhoG subfamily.  RhoG is a GTPase with high sequence similarity to members of the Rac subfamily, including the regions involved in effector recognition and binding.  However, RhoG does not bind to known Rac1 and Cdc42 effectors, including proteins containing a Cdc42/Rac interacting binding (CRIB) motif.  Instead, RhoG interacts directly with Elmo, an upstream regulator of Rac1, in a GTP-dependent manner and forms a ternary complex with Dock180 to induce activation of Rac1.  The RhoG-Elmo-Dock180 pathway is required for activation of Rac1 and cell spreading mediated by integrin, as well as for neurite outgrowth induced by nerve growth factor.  Thus RhoG activates Rac1 through Elmo and Dock180 to control cell morphology.  RhoG has also been shown to play a role in caveolar trafficking and has a novel role in signaling the neutrophil respiratory burst stimulated by G protein-coupled receptor (GPCR) agonists.  Most Rho proteins contain a lipid modification site at the C-termin
Probab=99.49  E-value=4.9e-13  Score=94.06  Aligned_cols=161  Identities=11%  Similarity=0.089  Sum_probs=86.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      ..+|.++|-++||||||+.+++..+...  .-.|+....     .............+.++||+|...+......     
T Consensus         3 ~~KivlvGd~~VGKTsli~r~~~~~F~~--~y~pti~~~-----~~~~~~i~~~~v~l~iwDtaG~e~~~~~~~~-----   70 (191)
T cd01875           3 SIKCVVVGDGAVGKTCLLICYTTNAFPK--EYIPTVFDN-----YSAQTAVDGRTVSLNLWDTAGQEEYDRLRTL-----   70 (191)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHCCCCC--CCCCCCCEE-----EEEEEEECCEEEEEEEEECCCCCCHHHHHHH-----
T ss_conf             1899999999989999999997299998--646621000-----4678999999999999858887003567787-----


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCC--CHHHHHHHHHH--CCCCCCCCCCCCCCCCCCHHHHHHHHHH---------HH
Q ss_conf             89987777664200000112235788--75454554321--0257532212222111102468999999---------99
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGV--KQIDQDVFSFL--DKKAVSYQIVLTKIDKLSPTTAQETLEK---------TK  175 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~~~~~~~---------~~  175 (212)
                           ..   ......+.+.+.....  ...........  .....|++++.||+|+.++.+....+.+         ..
T Consensus        71 -----~~---~~a~~~ilvfdvt~~~Sf~~v~~~w~~ei~~~~~~~piiLvGnK~DL~~~~~~~~~~~e~~~~~vs~eeg  142 (191)
T cd01875          71 -----SY---PQTNVFIICFSIASPSSYENVRHKWHPEVCHHCPNVPILLVGTKKDLRNDADTLKKLKEQGQAPITPQQG  142 (191)
T ss_pred             -----HH---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCCHHHH
T ss_conf             -----74---4786899998579778899999999999997096997899988801023457788877641375569999


Q ss_pred             HHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             99753136898689998888899899999999872
Q gi|254780484|r  176 YLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       176 ~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ..+.. ..+..+++.+||++|.||+++++.+.+.+
T Consensus       143 ~~~a~-~~~~~~y~EtSAkt~~nV~e~F~~l~k~i  176 (191)
T cd01875         143 GALAK-QIHAVKYLECSALNQDGVKEVFAEAVRAV  176 (191)
T ss_pred             HHHHH-HHCCCEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             99999-80998899906898969899999999998


No 187
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G.  On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group
Probab=99.49  E-value=1e-12  Score=92.27  Aligned_cols=118  Identities=19%  Similarity=0.326  Sum_probs=85.9

Q ss_pred             EEEECCCCCCHHHHHHHHHC---C-CCEEEECCCCCEE------EECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH
Q ss_conf             99974899889899999738---9-7379873888414------521202665556785089649999760010111224
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVN---R-KNLARTSNAPGRT------QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g---~-~~~a~~~~~p~tt------~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~  101 (212)
                      |||+|+..+||+||.-+|+=   . ++...+....+++      +..+...........+.+..+.++||||+..+..  
T Consensus         2 i~iigH~~aGKTtL~E~lL~~~g~i~~~G~V~~g~t~~D~~~~E~~RgiSi~s~~~~~~w~~~~inliDTPG~~DF~~--   79 (268)
T cd04170           2 IALVGHSGSGKTTLAEALLYATGAIDRLGSVEDGTTVSDYDPEEIKRKMSISTSVAPLEWKGHKINLIDTPGYADFVG--   79 (268)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEECCEEEEEECCEEEEEEECCCCHHHHH--
T ss_conf             899908999989999999996699665765458973577878898679675135578888997999986989757999--


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             4789888899877776642000001122357887545455432102575322122221111
Q gi|254780484|r  102 KNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL  162 (212)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~  162 (212)
                                 .........+..+.+.++..+...+.....+.+...++|.++++||+|..
T Consensus        80 -----------e~~~aL~v~D~Av~Vida~~GVe~~T~~~w~~~~~~~iP~i~fINKmDr~  129 (268)
T cd04170          80 -----------ETRAALRAADAALVVVSAQSGVEVGTEKLWEFADEAGIPRIIFINKMDRE  129 (268)
T ss_pred             -----------HHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             -----------99998404783999941875476879999999998599989999787878


No 188
>PRK10218 GTP-binding protein; Provisional
Probab=99.48  E-value=2.4e-13  Score=95.83  Aligned_cols=170  Identities=16%  Similarity=0.184  Sum_probs=114.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCE--------EEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHH
Q ss_conf             66868999748998898999997389737--------9873888414521202665556785089649999760010111
Q gi|254780484|r   27 AGPPEIAFSGRSNVGKSSLINILVNRKNL--------ARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYAR   98 (212)
Q Consensus        27 ~~~p~VaivG~~NvGKSSLiNaL~g~~~~--------a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~   98 (212)
                      +++..|||++|..+|||||..+|+-+--.        ..+.+.--.-+..+.+.......+.+.+..+.++||||+-.+.
T Consensus         3 e~IRNiaIIAHvDhGKTTL~d~lL~~tG~~~~~~~~~~~~mD~~~~ErERGITI~a~~~~~~~~~~~iNiIDTPGH~DF~   82 (607)
T PRK10218          3 EKLRNIAIIAHVDHGKTTLVDKLLQQSGTFDSRAETQERVMDSNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFG   82 (607)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCHHHCCCCCHHHHHCCCEEEEEEEEEEECCEEEEEECCCCCCCCH
T ss_conf             54424899975688988999999997289864454112014786889875972623048996087899786599854301


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             22447898888998777766420000011223578875454554321025753221222211110246899999999997
Q gi|254780484|r   99 APKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLI  178 (212)
Q Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~  178 (212)
                      ..-+             .....++.++.+.++..+...|...........+.|.++++||+|.... .....++++.+.+
T Consensus        83 gEVe-------------R~L~~~DGalLvVDA~eGv~pQT~~V~~~Al~~~l~~IvvINKiDr~~A-~~~~V~~ei~dlf  148 (607)
T PRK10218         83 GEVE-------------RVMSMVDSVLLVVDAFDGPMPQTRFVTKKAFAYGLKPIVVINKVDRPGA-RPDWVVDQVFDLF  148 (607)
T ss_pred             HHHH-------------HHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCC-CHHHHHHHHHHHH
T ss_conf             4889-------------7897668489999788786245899999999879975997216676655-3578999999887


Q ss_pred             HHCCC----CCCCEEEEECCCCCC----------HHHHHHHHHHHH
Q ss_conf             53136----898689998888899----------899999999872
Q gi|254780484|r  179 RNYPT----AHPEVIPTSSVKRKG----------IEVLRKAILETI  210 (212)
Q Consensus       179 ~~~~~----~~~~i~~vSA~~g~G----------i~eL~~~I~~~l  210 (212)
                      .....    ...|++..||+.|+.          +..|.+.|.+++
T Consensus       149 i~L~a~deqld~Pi~~asa~~G~a~~~~~~~~~dl~pLldaIv~~I  194 (607)
T PRK10218        149 VNLDATDEQLDFPIVYASALNGIAGLDHEDMAEDMTPLYQAIVDHV  194 (607)
T ss_pred             HCCCCCHHHHCCHHHHHHHHCCEECCCHHHHHHHCCHHHHHHHHHC
T ss_conf             4049856774443556554065012682343331360889998548


No 189
>PRK13351 elongation factor G; Reviewed
Probab=99.48  E-value=1.2e-12  Score=91.78  Aligned_cols=128  Identities=16%  Similarity=0.210  Sum_probs=91.9

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHCCC----CEEEECCCCCE-E-----EECCEEEEEEEEEEEECCCEEEEEECC
Q ss_conf             5887668689997489988989999973897----37987388841-4-----521202665556785089649999760
Q gi|254780484|r   23 LLPKAGPPEIAFSGRSNVGKSSLINILVNRK----NLARTSNAPGR-T-----QHLNFFVPKDFSNLKNNLPAMALVDMP   92 (212)
Q Consensus        23 ~~P~~~~p~VaivG~~NvGKSSLiNaL~g~~----~~a~~~~~p~t-t-----~~~~~~~~~~~~~~~~~~~~~~~~Dtp   92 (212)
                      .-|.+++..|||+|+..+|||||.-+|.-..    +...+....+. +     +..+.+.........+.+..+.++|||
T Consensus         2 ~~~~e~IRNi~IiaHvd~GKTTL~d~Ll~~~g~i~~~g~v~~g~t~~D~~~~E~eRgITikss~~sl~~~~~~iNlIDTP   81 (687)
T PRK13351          2 EMPLMQIRNIGIMAHIDAGKTTLTERILFYTGKIHKMGSVEDGNTVSDWMPQEQERGISIESAAATCDWKNHRINLIDTP   81 (687)
T ss_pred             CCCHHHCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEEEEEEEEEECCEEEEEEECC
T ss_conf             99868930899991799898999999999749987587154787447882999974987762159998899899998097


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             01011122447898888998777766420000011223578875454554321025753221222211110
Q gi|254780484|r   93 GYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS  163 (212)
Q Consensus        93 G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~  163 (212)
                      |+..+...             ........+.++.++|+..+...+...........++|.++++||+|...
T Consensus        82 GHvDF~~E-------------v~~aLr~~DgallVVDaveGv~~qT~~v~r~a~~~~lp~il~iNK~DR~~  139 (687)
T PRK13351         82 GHIDFTGE-------------VERSLRVLDGAVVVIDAVTGVQPQTETVWEQADKYKIPRLIFINKMDRVG  139 (687)
T ss_pred             CCCCHHHH-------------HHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             97430999-------------99999987868999978999868899999999987998599997977899


No 190
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis]
Probab=99.48  E-value=2.1e-13  Score=96.24  Aligned_cols=68  Identities=29%  Similarity=0.234  Sum_probs=50.8

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEE------------EEECCCEEEEEECCHHHHH
Q ss_conf             6899974899889899999738973798738884145212026655567------------8508964999976001011
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSN------------LKNNLPAMALVDMPGYGYA   97 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~------------~~~~~~~~~~~DtpG~~~~   97 (212)
                      ++++|||.|||||||||||+|...  +...++|++|-.+|.........            ...-..++.++|.+|+-.-
T Consensus         3 l~~GIVGlPNVGKSTlFnAlT~~~--a~~aNYPF~TIePN~Giv~v~d~rl~~L~~~~~c~~k~~~~~ve~vDIAGLV~G   80 (372)
T COG0012           3 LKIGIVGLPNVGKSTLFNALTKAG--AEIANYPFCTIEPNVGVVYVPDCRLDELAEIVKCPPKIRPAPVEFVDIAGLVKG   80 (372)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCC--CCCCCCCCCCCCCCEEEEECCCHHHHHHHHHCCCCCCEEEEEEEEEEECCCCCC
T ss_conf             426774189885888999997489--642489854265773279647367899987538997477610489982453788


Q ss_pred             HH
Q ss_conf             12
Q gi|254780484|r   98 RA   99 (212)
Q Consensus        98 ~~   99 (212)
                      ..
T Consensus        81 As   82 (372)
T COG0012          81 AS   82 (372)
T ss_pred             CC
T ss_conf             54


No 191
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional
Probab=99.48  E-value=1.2e-12  Score=91.94  Aligned_cols=162  Identities=17%  Similarity=0.200  Sum_probs=108.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCC-CC------------------------EEEECCCCCEEEECCEEEEEEEEEEEEC
Q ss_conf             6868999748998898999997389-73------------------------7987388841452120266555678508
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNR-KN------------------------LARTSNAPGRTQHLNFFVPKDFSNLKNN   82 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~-~~------------------------~a~~~~~p~tt~~~~~~~~~~~~~~~~~   82 (212)
                      +..++.++|+..+|||||+=+|+=. ..                        .|-..+..-..+..+.+.......+...
T Consensus        26 ~~l~~v~~GhVD~GKSTl~GrlL~~~~~v~~~~~~~~~~~s~~~g~~~~~~~~a~l~D~l~~ERe~GiTIdva~~~f~t~  105 (475)
T PRK05124         26 SLLRFLTCGSVDDGKSTLIGRLLHDTKQIYEDQLASLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTE  105 (475)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHHCCCEEEEEEEEEECC
T ss_conf             85799999055797788889999981997889999999999982887772224442059988986697169567899538


Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-CCCCCCCCCC
Q ss_conf             964999976001011122447898888998777766420000011223578875454554321025753-2212222111
Q gi|254780484|r   83 LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS-YQIVLTKIDK  161 (212)
Q Consensus        83 ~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~  161 (212)
                      ...+.++|+||+..+.             -.+.......+..+.++++..+..+|..+....+...+++ .++++||+|+
T Consensus       106 ~r~~~i~DaPGH~~f~-------------~NMitGas~aD~aiLvVdA~~G~~~QTreH~~i~~llGI~~iIVaVNKMDl  172 (475)
T PRK05124        106 KRKFIIADTPGHEQYT-------------RNMATGASTCDLAILLIDARKGVLDQTRRHSFIATLLGIKHLVVAVNKMDL  172 (475)
T ss_pred             CEEEEEEECCCHHHHH-------------HHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEECHHC
T ss_conf             7689997379638778-------------889888876788999998988947888999999986599859999850431


Q ss_pred             CCHH--HHHHHHHHHHHHHHHCCC-CCCCEEEEECCCCCCHHHH
Q ss_conf             1024--689999999999753136-8986899988888998999
Q gi|254780484|r  162 LSPT--TAQETLEKTKYLIRNYPT-AHPEVIPTSSVKRKGIEVL  202 (212)
Q Consensus       162 ~~~~--~~~~~~~~~~~~~~~~~~-~~~~i~~vSA~~g~Gi~eL  202 (212)
                      ++-+  .-+....++...+..... ....++|+||.+|.||-+.
T Consensus       173 V~~~~~~f~~I~~e~~~~l~~~g~~~~v~~IPISal~GdNIv~~  216 (475)
T PRK05124        173 VDYSEEVFERIREDYLTFAEQLPGNLDIRFVPLSALEGDNVVSQ  216 (475)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCCC
T ss_conf             35439999999999999999749988850775413457676215


No 192
>cd04140 ARHI_like ARHI subfamily.  ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties.  ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer.  ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity.   Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity.  ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Due to
Probab=99.48  E-value=3.6e-13  Score=94.88  Aligned_cols=155  Identities=15%  Similarity=0.147  Sum_probs=84.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+++++..+..  ..-.|+. ..  .  .............+.++||+|.+.........      
T Consensus         3 KivllGd~~VGKTsli~r~~~~~F~--~~y~~Ti-~~--~--~~~~i~~~~~~~~l~iwDtaG~e~~~~l~~~~------   69 (165)
T cd04140           3 RVVVFGAGGVGKSSLVLRFVKGTFR--ESYIPTI-ED--T--YRQVISCSKNICTLQITDTTGSHQFPAMQRLS------   69 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCC-CC--E--EEEEEEECCEEEEEEEEECCCCCCCCCCHHHH------
T ss_conf             9999899997699999999649699--9868845-42--0--55899999999999999899984654232445------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHH--H---HHHHHHH--CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             987777664200000112235788754--5---4554321--02575322122221111024689999999999753136
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQI--D---QDVFSFL--DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT  183 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~--~---~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~  183 (212)
                          .   ......+.+.+......-.  .   ..+....  .....|+++|.||+|+.....+..  ++.++....+  
T Consensus        70 ----~---~~a~~~ilvydit~~~Sf~~~~~~~~~i~~~~~~~~~~~piilVgNK~Dl~~~r~V~~--~e~~~~a~~~--  138 (165)
T cd04140          70 ----I---SKGHAFILVYSVTSKQSLEELKPIYELICEIKGNNIEKIPIMLVGNKCDESHKREVSS--NEGAACATEW--  138 (165)
T ss_pred             ----H---CCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCH--HHHHHHHHHC--
T ss_conf             ----0---6885799981389878999999999999999615888887899864246400278899--9999999986--


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             898689998888899899999999872
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                       +-+++.+||++|.||+++.+.|.+..
T Consensus       139 -~~~~~E~SAk~~~nV~e~F~~l~~l~  164 (165)
T cd04140         139 -NCAFMETSAKTNHNVQELFQELLNLE  164 (165)
T ss_pred             -CCEEEEECCCCCCCHHHHHHHHHHCC
T ss_conf             -98899974477948799999998140


No 193
>cd04103 Centaurin_gamma Centaurin gamma.  The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains.  Centaurin gamma contains an additional GTPase domain near its N-terminus.  The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism.  Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP.  Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments.  A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues. 
Probab=99.48  E-value=1.4e-13  Score=97.22  Aligned_cols=153  Identities=12%  Similarity=0.122  Sum_probs=85.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|-++||||||+++++..+.. .. ..| +.   +.  .............+.++||+|.....           
T Consensus         1 ~KivllGd~~VGKTsl~~Rf~~~~F~-~~-~~p-t~---~~--~~~~~~vdg~~~~l~i~DTaG~~~~~-----------   61 (158)
T cd04103           1 LKLGIVGNLQSGKSALVHRYLTGSYV-QL-ESP-EG---GR--FKKEVLVDGQSHLLLIRDEGGAPDAQ-----------   61 (158)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCC-CC-CCC-CC---CE--EEEEEEECCEEEEEEEEECCCCCCHH-----------
T ss_conf             99999996998799999999809478-74-446-64---41--79999999999999999589983433-----------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCC--CC---HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             998777766420000011223578--87---5454554321025753221222211110246899999999997531368
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHG--VK---QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~--~~---~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                          ...   ..+..+.+.+....  +.   ....++.+.......|++++.||.|+-....+....++.++....  .+
T Consensus        62 ----~~~---~ada~ilVydit~~~SF~~v~~~~~~i~~~~~~~~ipiilvGnK~dl~~~~~r~V~~~e~~~~a~~--~~  132 (158)
T cd04103          62 ----FAS---WVDAVIFVFSLENEASFQTVYNLYHQLSSYRNISEIPLILVGTQDAISESNPRVIDDARARQLCAD--MK  132 (158)
T ss_pred             ----HHC---CCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCEECCHHHHHHHHHH--CC
T ss_conf             ----321---499899999889888999999999999985597899689998770036577614799999999985--69


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             98689998888899899999999872
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .-+++.+||++|.||+++++.+.+.|
T Consensus       133 ~~~f~EtSAk~~~NV~~~F~~~~~~i  158 (158)
T cd04103         133 RCSYYETCATYGLNVERVFQEAAQKI  158 (158)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             98899901799959899999999639


No 194
>cd04144 Ras2 Ras2 subfamily.  The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis.  In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family.  Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=99.47  E-value=2.1e-13  Score=96.21  Aligned_cols=155  Identities=16%  Similarity=0.115  Sum_probs=86.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|.++||||||+.+++..+. ... -.|+.. .    ..............+.++||+|.+.+....         
T Consensus         1 KivviGd~gVGKTsli~r~~~~~F-~~~-y~pTi~-~----~~~k~~~~~~~~~~l~iwDtaG~e~~~~l~---------   64 (190)
T cd04144           1 KLVVLGDGGVGKTALTIQLCLNHF-VET-YDPTIE-D----SYRKQVVVDGQPCMLEVLDTAGQEEYTALR---------   64 (190)
T ss_pred             CEEEECCCCCCHHHHHHHHHHCCC-CCC-CCCCCC-E----EEEEEEEECCEEEEEEEEECCCCCCHHHHH---------
T ss_conf             989999899878999999962979-988-699724-7----889999999999999999899973116788---------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHH-H----HHH--HHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             98777766420000011223578875454-5----543--2102575322122221111024689999999999753136
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQIDQ-D----VFS--FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT  183 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~----~~~--~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~  183 (212)
                       ....   ...+..+++.+......-... .    +..  .......|+++|.||+|+.....+..  ++..+....+  
T Consensus        65 -~~~~---r~a~~~ilVydvtd~~SF~~l~~w~~~i~~~~~~~~~~~piiLVGNK~Dl~~~r~V~~--~e~~~~a~~~--  136 (190)
T cd04144          65 -DQWI---REGEGFILVYSITSRSTFERVERFREQIQRVKDESAADVPIMIVGNKCDKVYEREVST--EEGAALARRL--  136 (190)
T ss_pred             -HHHH---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHCCCCCH--HHHHHHHHHC--
T ss_conf             -9982---3676589997279778999999999999998533799952895145535033057899--9999999980--


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             898689998888899899999999872
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                       +-.++.+||++|.||+++++.|.+.|
T Consensus       137 -~~~~~E~SAk~~~nV~e~F~~l~~~i  162 (190)
T cd04144         137 -GCEFIEASAKTNVNVERAFYTLVRAL  162 (190)
T ss_pred             -CCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             -99899973588809799999999999


No 195
>cd01899 Ygr210 Ygr210 subfamily.  Ygr210 is a member of Obg-like family and present in archaea and fungi.  They are characterized by a distinct glycine-rich motif immediately following the Walker B motif.  The Ygr210 and YyaF/YchF subfamilies appear to form one major branch of the Obg-like family.  Among eukaryotes, the Ygr210 subfamily is represented only in fungi.  These fungal proteins form a tight cluster with their archaeal orthologs, which suggests the possibility of horizontal transfer from archaea to fungi.
Probab=99.47  E-value=3.4e-14  Score=100.74  Aligned_cols=71  Identities=23%  Similarity=0.273  Sum_probs=48.0

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEE----EEE------------EEEE--EECCCEEEEEECCH
Q ss_conf             99974899889899999738973798738884145212026----655------------5678--50896499997600
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV----PKD------------FSNL--KNNLPAMALVDMPG   93 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~----~~~------------~~~~--~~~~~~~~~~DtpG   93 (212)
                      |+|||.|||||||||||+|...  +...++|+||-.+|...    ...            .+..  ...-.++.++|.+|
T Consensus         1 iGiVGlPNvGKSTlFnAlT~~~--~~~anyPF~TIePN~Gv~~v~v~~p~~~l~~~~~~~~~~~~~~~r~vPve~vDIAG   78 (318)
T cd01899           1 IGLVGKPNAGKSTFFNAATLAD--VEIANYPFTTIDPNVGVGYVRVECPCKELGVSCNPRYGKCIDGKRYVPVELIDVAG   78 (318)
T ss_pred             CCEECCCCCCHHHHHHHHHCCC--CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCEECCEEEEECHH
T ss_conf             9344889898899999997799--85127996676774162005568841666433043312014774003326752100


Q ss_pred             HHHHHHHHHHH
Q ss_conf             10111224478
Q gi|254780484|r   94 YGYARAPKKNV  104 (212)
Q Consensus        94 ~~~~~~~~~~~  104 (212)
                      +-.....+...
T Consensus        79 LV~GAskG~GL   89 (318)
T cd01899          79 LVPGAHEGKGL   89 (318)
T ss_pred             HHCCCCCCCCC
T ss_conf             10566457766


No 196
>cd04135 Tc10 TC10 subfamily.  TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro.  Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration.  TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins.  GTP-bound TC10 in vitro can bind numerous potential effectors.  Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes.  TC10 mRNAs are highly expressed in three types of mouse muscle tissues:  leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns.  TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti
Probab=99.47  E-value=2.9e-13  Score=95.39  Aligned_cols=158  Identities=15%  Similarity=0.113  Sum_probs=83.8

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||+.++.+.+..  ..-.|+ ...    ..............+.++||+|...+.....       
T Consensus         1 ~Kiv~vGd~~VGKTsli~rf~~~~f~--~~y~pT-i~~----~~~~~i~v~~~~~~l~i~DTaG~e~~~~~~~-------   66 (174)
T cd04135           1 LKCVVVGDGAVGKTCLLMSYANDAFP--EEYVPT-VFD----HYAVSVTVGGKQYLLGLYDTAGQEDYDRLRP-------   66 (174)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCE-EEE----EEEEEEEECCEEEEEEEEECCCCCCCHHHHH-------
T ss_conf             98999998998599999999629899--886885-752----0227999999999999997976403155659-------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--CHH---HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHH----------HHHHH
Q ss_conf             9987777664200000112235788--754---54554321025753221222211110246899----------99999
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--KQI---DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQE----------TLEKT  174 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~---~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~----------~~~~~  174 (212)
                         ...   ......+.+.+.....  ...   ....... .....|++++.||+|+.+......          ..++-
T Consensus        67 ---~~~---~~a~~~ilvydi~~~~Sf~~~~~~w~~~~~~-~~~~~piilvgnK~DL~~~~~~~~~~~~~~~r~Vs~eeg  139 (174)
T cd04135          67 ---LSY---PMTDVFLICFSVVNPASFQNVKEEWVPELKE-YAPNVPYLLVGTQIDLRDDPKTLARLNDMKEKPVTVEQG  139 (174)
T ss_pred             ---HHH---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHH-HCCCCCEEEEEECHHHCCCHHHHHHHCCCCCCCCCHHHH
T ss_conf             ---985---5787678984379778899999999999998-684998899968523004434554530045766399999


Q ss_pred             HHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             999753136898689998888899899999999872
Q gi|254780484|r  175 KYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       175 ~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+...+  .+...++.+||++|.||+++.+.+...+
T Consensus       140 ~~~A~~--~g~~~f~E~SAkt~~nV~e~F~~~i~~i  173 (174)
T cd04135         140 QKLAKE--IGAHCYVECSALTQKGLKTVFDEAILAI  173 (174)
T ss_pred             HHHHHH--CCCCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             999997--7998999905487949899999999997


No 197
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily.  RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively.  RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis.  Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression.  In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo.  RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors.  Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm.  Both are believed to have tu
Probab=99.46  E-value=1.4e-13  Score=97.13  Aligned_cols=157  Identities=15%  Similarity=0.184  Sum_probs=86.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|-++||||||+++++.......  -.|+ ...    ..............+.++||+|..........       
T Consensus         1 Kiv~vGd~~VGKTsli~rf~~~~f~~~--y~~T-~~~----~~~~~~~v~~~~~~l~iwDtaG~e~~~~~~~~-------   66 (165)
T cd04146           1 KIAVLGASGVGKSALVVRFLTKRFIGE--YDPN-LES----LYSRQVTIDGEQVSLEILDTAGQQQADTEQLE-------   66 (165)
T ss_pred             CEEEECCCCCCHHHHHHHHHHCCCCCC--CCCC-CCC----EEEEEEEECCEEEEEEEEECCCCCCCCHHHHH-------
T ss_conf             999999899778999999974989987--5995-563----05799999999999999928985012201255-------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHH--H--HHHHHH--HCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             987777664200000112235788754--5--455432--1025753221222211110246899999999997531368
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQI--D--QDVFSF--LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~--~--~~~~~~--~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                        ...   ......+.+.+......-.  .  ......  ......|++++.||+|+.....+.  .++..+.....   
T Consensus        67 --~~~---~~a~~~ilvydit~~~Sf~~~~~~~~~i~~~~~~~~~~piilVGNK~DL~~~r~Vs--~ee~~~~a~~~---  136 (165)
T cd04146          67 --RSI---RWADGFVLVYSITDRSSFDEISQLKQLIREIKKRDREIPVILVGNKADLLHYRQVS--TEEGEKLASEL---  136 (165)
T ss_pred             --HHC---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCC--HHHHHHHHHHC---
T ss_conf             --430---45878999986588899999999999999984669995399844554521036779--99999999981---


Q ss_pred             CCCEEEEECCCC-CCHHHHHHHHHHHHC
Q ss_conf             986899988888-998999999998728
Q gi|254780484|r  185 HPEVIPTSSVKR-KGIEVLRKAILETIN  211 (212)
Q Consensus       185 ~~~i~~vSA~~g-~Gi~eL~~~I~~~l~  211 (212)
                      +-+++.+||++| .||+++++.|.+.+.
T Consensus       137 ~~~f~E~SAk~~~~~V~~~F~~l~~~i~  164 (165)
T cd04146         137 GCLFFEVSAAEDYDGVHSVFHELCREVR  164 (165)
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHHHHC
T ss_conf             9989997520878269999999999966


No 198
>cd04109 Rab28 Rab28 subfamily.  First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA).  In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos.  Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus.  The two human isoforms are presumbly the result of alternative splicing.  Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs 
Probab=99.46  E-value=1e-12  Score=92.23  Aligned_cols=156  Identities=16%  Similarity=0.121  Sum_probs=82.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEEC-CCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             8999748998898999997389737987388841452120266555678508-964999976001011122447898888
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNN-LPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~-~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      +|+++|-++||||||+++++..... ..+ .|+....    ........... ...+.++||+|..........      
T Consensus         2 KvvllGd~~VGKTSli~rf~~~~F~-~~y-~~TiG~d----~~~k~i~i~~~~~v~l~iwDtaGqe~~~~~~~~------   69 (215)
T cd04109           2 KIVVLGDGAVGKTSLCRRFAKEGFG-KSY-KQTIGLD----FFSKRVTLPGNLNVTLQVWDIGGQSIGGKMLDK------   69 (215)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC-CCC-CCCCCEE----EEEEEEEECCCCEEEEEEEECCCCCCHHHHHHH------
T ss_conf             7999999997099999999749898-877-8865578----899999987994699999969985002378999------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC-----CHHHHHHHHHHCCC--CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             9987777664200000112235788-----75454554321025--7532212222111102468999999999975313
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV-----KQIDQDVFSFLDKK--AVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP  182 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~--~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~  182 (212)
                          +.   .-....+++.|.....     ..+...+.+.....  ..++++|.||+|+.....+  ..++.++....+ 
T Consensus        70 ----y~---~~a~~~ilVYDitn~~SF~~l~~W~~~i~~~~~~~~~~~~iiLVGNK~DL~~~R~V--s~ee~~~~A~~~-  139 (215)
T cd04109          70 ----YI---YGAHAVFLVYDVTNSQSFENLEDWYSMVRKVLKSSETQPLVVLVGNKTDLEHNRTV--KDDKHARFAQAN-  139 (215)
T ss_pred             ----HH---HHHCCEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHCCC--CHHHHHHHHHHC-
T ss_conf             ----99---75151377414786789998999999999985045778529999754542864776--999999999982-


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             6898689998888899899999999872
Q gi|254780484|r  183 TAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       183 ~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                        +-+++.+||++|.||+++++.|...|
T Consensus       140 --g~~f~E~SAktg~nV~e~F~~la~~i  165 (215)
T cd04109         140 --GMESCLVSAKTGDRVNLLFQQLAAEL  165 (215)
T ss_pred             --CCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             --99899983899949899999999999


No 199
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]
Probab=99.45  E-value=9.6e-13  Score=92.40  Aligned_cols=158  Identities=22%  Similarity=0.333  Sum_probs=118.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCC-CEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897-37987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRK-NLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~-~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      -|+-+|+-..|||||+.+++|.. .....-..-|+|.+.++.      .....+..+.|+|.||+...            
T Consensus         2 ii~t~GhidHgkT~L~~altg~~~d~l~EekKRG~TiDlg~~------y~~~~d~~~~fIDvpgh~~~------------   63 (447)
T COG3276           2 IIGTAGHIDHGKTTLLKALTGGVTDRLPEEKKRGITIDLGFY------YRKLEDGVMGFIDVPGHPDF------------   63 (447)
T ss_pred             EEEEEEEEECCCHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE------ECCCCCCCEEEEECCCCHHH------------
T ss_conf             699740020143022333025533205456615846842057------32577773688618984788------------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCC-CCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             9987777664200000112235788754545543210257532-212222111102468999999999975313689868
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSY-QIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEV  188 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i  188 (212)
                       ...........+.++++++...+...+..+....+...+++. ++|++|+|.++....+..++.+...+.   ....++
T Consensus        64 -i~~miag~~~~d~alLvV~~deGl~~qtgEhL~iLdllgi~~giivltk~D~~d~~r~e~~i~~Il~~l~---l~~~~i  139 (447)
T COG3276          64 -ISNLLAGLGGIDYALLVVAADEGLMAQTGEHLLILDLLGIKNGIIVLTKADRVDEARIEQKIKQILADLS---LANAKI  139 (447)
T ss_pred             -HHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCC---CCCCCC
T ss_conf             -9999854057745899984755766436889999986198732899962234467889999999986502---000323


Q ss_pred             EEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9998888899899999999872
Q gi|254780484|r  189 IPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       189 ~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +++||.+|+||++|++.|.+.+
T Consensus       140 ~~~s~~~g~Gi~~Lk~~l~~L~  161 (447)
T COG3276         140 FKTSAKTGRGIEELKNELIDLL  161 (447)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHH
T ss_conf             0110125787799999998752


No 200
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]
Probab=99.45  E-value=9.7e-13  Score=92.36  Aligned_cols=167  Identities=20%  Similarity=0.245  Sum_probs=105.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCC----------EEEECCC--CCEEEECCEEEEE---EEEEEE------ECCCEEEEE
Q ss_conf             899974899889899999738973----------7987388--8414521202665---556785------089649999
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKN----------LARTSNA--PGRTQHLNFFVPK---DFSNLK------NNLPAMALV   89 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~----------~a~~~~~--p~tt~~~~~~~~~---~~~~~~------~~~~~~~~~   89 (212)
                      .|+.||+..+|||||..||+|-..          +.+---+  ..-...+.+....   ......      .-...+.|+
T Consensus        12 NIG~vGHVdHGKtTlv~AlsGvwT~~hseElkRgitIkLGYAd~~i~kC~~c~~~~~y~~~~~C~~cg~~~~l~R~VSfV   91 (415)
T COG5257          12 NIGMVGHVDHGKTTLTKALSGVWTDRHSEELKRGITIKLGYADAKIYKCPECYRPECYTTEPKCPNCGAETELVRRVSFV   91 (415)
T ss_pred             EEEEEEECCCCHHHHEEHHHCEEEECHHHHHHCCCEEEECCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEE
T ss_conf             76234201466241100331334302068875684798402557457577778876623478777789973079999974


Q ss_pred             ECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC-CCHHHHHHHHHHCCC-CCCCCCCCCCCCCCCHHHH
Q ss_conf             76001011122447898888998777766420000011223578-875454554321025-7532212222111102468
Q gi|254780484|r   90 DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG-VKQIDQDVFSFLDKK-AVSYQIVLTKIDKLSPTTA  167 (212)
Q Consensus        90 DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~-~~~~~~v~nK~D~~~~~~~  167 (212)
                      |.||++..-             .-++......+..+++..+... ...|..+.+--+.-. -..++++.||+|++..+..
T Consensus        92 DaPGHe~LM-------------ATMLsGAAlMDgAlLvIaANEpcPQPQT~EHl~AleIigik~iiIvQNKIDlV~~E~A  158 (415)
T COG5257          92 DAPGHETLM-------------ATMLSGAALMDGALLVIAANEPCPQPQTREHLMALEIIGIKNIIIVQNKIDLVSRERA  158 (415)
T ss_pred             ECCCHHHHH-------------HHHHCCHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEECCCCEECHHHH
T ss_conf             079669999-------------9886023442153899953898989731877887766265339999523011159998


Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9999999999753136898689998888899899999999872
Q gi|254780484|r  168 QETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       168 ~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .++.+++++.++.....+.|++|+||.++.|||.|.++|.+.+
T Consensus       159 lE~y~qIk~FvkGt~Ae~aPIIPiSA~~~~NIDal~e~i~~~I  201 (415)
T COG5257         159 LENYEQIKEFVKGTVAENAPIIPISAQHKANIDALIEAIEKYI  201 (415)
T ss_pred             HHHHHHHHHHHCCCCCCCCCEEEEHHHHCCCHHHHHHHHHHHC
T ss_conf             8879999998626334799544325643058799999999868


No 201
>cd04143 Rhes_like Rhes_like subfamily.  This subfamily includes Rhes (Ras homolog enriched in striatum) and Dexras1/AGS1 (activator of G-protein signaling 1).  These proteins are homologous, but exhibit significant differences in tissue distribution and subcellular localization.  Rhes is found primarily in the striatum of the brain, but is also expressed in other areas of the brain, such as the cerebral cortex, hippocampus, inferior colliculus, and cerebellum.  Rhes expression is controlled by thyroid hormones.  In rat PC12 cells, Rhes is farnesylated and localizes to the plasma membrane.  Rhes binds and activates PI3K, and plays a role in coupling serpentine membrane receptors with heterotrimeric G-protein signaling.  Rhes has recently been shown to be reduced under conditions of dopamine supersensitivity and may play a role in determining dopamine receptor sensitivity.  Dexras1/AGS1 is a dexamethasone-induced Ras protein that is expressed primarily in the brain, with low expression l
Probab=99.45  E-value=4.1e-14  Score=100.26  Aligned_cols=156  Identities=13%  Similarity=0.212  Sum_probs=87.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|.++|.++||||||++++++.+..  ..-.|+. .+.    .............+.++||+|.+.+........     
T Consensus         2 KIvvlGdsgVGKTSLi~Rf~~~~F~--~~y~pTi-~d~----~~k~i~i~g~~v~L~IwDTaGqe~f~sl~~~y~-----   69 (247)
T cd04143           2 RMVVLGASKVGKTAIVSRFLGGRFE--EQYTPTI-EDF----HRKLYSIRGEVYQLDILDTSGNHPFPAMRRLSI-----   69 (247)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCC--CCCCCCH-HHE----EEEEEEECCEEEEEEEEECCCCCCCCCCHHHHH-----
T ss_conf             7999998997899999999649689--9878883-531----889999999999999996766536874420131-----


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCC--CCHHHH---HHHH--------HHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             98777766420000011223578--875454---5543--------2102575322122221111024689999999999
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHG--VKQIDQ---DVFS--------FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYL  177 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~---~~~~--------~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~  177 (212)
                              ......+.+.+....  +.....   ++.+        .......|++++.||+|+-...++.  .++..+.
T Consensus        70 --------~~a~~~IlVYDITnr~SFe~v~~w~~~I~e~k~~~~~~~~~~~~vpiiLVGNK~DL~~~R~Vs--~eEa~~~  139 (247)
T cd04143          70 --------LTGDVFILVFSLDNRESFEEVCRLREQILETKSCLKNKTKENVKIPMVICGNKADRDFPREVQ--RDEVEQL  139 (247)
T ss_pred             --------HCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCHHCCCCC--HHHHHHH
T ss_conf             --------217789999979987899989999999998640010013578887589986655432017879--9999999


Q ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             753136898689998888899899999999872
Q gi|254780484|r  178 IRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       178 ~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ...  ..+-.++.+||++|.||+|+++.|....
T Consensus       140 ~A~--~~~~~f~EtSAKt~~NV~E~F~~L~~~~  170 (247)
T cd04143         140 VGG--DENCAYFEVSAKKNSNLDEMFRALFSLA  170 (247)
T ss_pred             HHH--HCCCEEEECCCCCCCCHHHHHHHHHHHC
T ss_conf             997--6898799887899949899999999854


No 202
>cd04130 Wrch_1 Wrch-1 subfamily.  Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42.  Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation.  Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function.  The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells.  Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes.  The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases.  Most Rho proteins contain a lipid modification site at the C-terminus, 
Probab=99.45  E-value=8.6e-13  Score=92.67  Aligned_cols=156  Identities=15%  Similarity=0.103  Sum_probs=82.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||+.+++..+..  ..-.|+ ...    ..............+.++||+|.+........      
T Consensus         1 iKvvlvGd~~VGKTsli~r~~~~~F~--~~y~pT-~~~----~~~~~i~~~~~~v~l~iwDtaG~e~~~~l~~~------   67 (173)
T cd04130           1 LKCVLVGDGAVGKTSLIVSYTTNGYP--TEYVPT-AFD----NFSVVVLVDGKPVRLQLCDTAGQDEFDKLRPL------   67 (173)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCC-EEE----EEEEEEEECCEEEEEEEEECCCCCCCCHHHHH------
T ss_conf             98999998997889999999619999--985783-589----99999999999999999989987344345676------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHHH--HCCCCCCCCCCCCCCCCCCHHHHHHH----------HHHHH
Q ss_conf             998777766420000011223578--87545455432--10257532212222111102468999----------99999
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHG--VKQIDQDVFSF--LDKKAVSYQIVLTKIDKLSPTTAQET----------LEKTK  175 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~--~~~~~~~~~~v~nK~D~~~~~~~~~~----------~~~~~  175 (212)
                          ..   ......+.+.+....  +..........  ......|++++.||+|+.........          .+...
T Consensus        68 ----~~---~~a~~~ilvydv~~~~Sf~~l~~~w~~~i~~~~~~~piilvGnK~DL~~~~~~~~~~~~~~~r~Vs~~e~~  140 (173)
T cd04130          68 ----CY---PDTDVFLLCFSVVNPSSFQNISEKWIPEIRKHNPKAPIILVGTQADLRTDVNVLIQLARYGEKPVSQSRAK  140 (173)
T ss_pred             ----HH---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHH
T ss_conf             ----61---37878999996598788999999999999960989988999887011001335544433257557899999


Q ss_pred             HHHHHCCCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             99753136898689998888899899999999
Q gi|254780484|r  176 YLIRNYPTAHPEVIPTSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       176 ~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~  207 (212)
                      +....  .+..+++.+||++|.||+++++.+.
T Consensus       141 ~~a~~--~~~~~y~EtSAkt~~nV~e~Fe~~i  170 (173)
T cd04130         141 ALAEK--IGACEYIECSALTQKNLKEVFDTAI  170 (173)
T ss_pred             HHHHH--CCCCEEEEECCCCCCCHHHHHHHHH
T ss_conf             99998--4996899968688969799999998


No 203
>TIGR00491 aIF-2 translation initiation factor aIF-2; InterPro: IPR004544 Initiation factor 2 (IF-2) is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-2 promotes the GTP-dependent binding of the initiator tRNA to the small subunit of the ribosome. IF-2 is a protein of about 70 to 95 Kd which contains a central GTP-binding domain flanked by a highly variable N-terminal domain and a more conserved C-terminal domain. Some members of this family undergo protein self splicing that involves a post-translational excision of the intein followed by peptide ligation.; GO: 0003743 translation initiation factor activity, 0005525 GTP binding, 0006413 translational initiation, 0005622 intracellular.
Probab=99.44  E-value=2.4e-13  Score=95.83  Aligned_cols=153  Identities=21%  Similarity=0.285  Sum_probs=105.1

Q ss_pred             CCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEE------------CCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             889899999738973798738884145212026655567850------------89649999760010111224478988
Q gi|254780484|r   40 VGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN------------NLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        40 vGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~------------~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      |--+||+.++-|.++++.  ...+-|.+.+.+......+...            .-+++.++||||+..+.....+    
T Consensus       561 vhnTTLLDkIRks~Vv~k--EAGgiTQhiGAsevP~dVI~~ic~Dl~K~f~i~~~iPGLLfIDTPGHeaFt~LRkR----  634 (1145)
T TIGR00491       561 VHNTTLLDKIRKSAVVKK--EAGGITQHIGASEVPLDVIKKICGDLLKKFKIKLKIPGLLFIDTPGHEAFTNLRKR----  634 (1145)
T ss_pred             EECCCCCCCCCCCCEEEE--CCCCCCEECCCEECCHHHHHHHCHHHHHCEEEEEECCEEEEEECCCCHHHHCCCCC----
T ss_conf             851433100033401324--77884010066654668986513212114025786580158607862344220100----


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCH-----------------HHHHHH
Q ss_conf             889987777664200000112235788754545543210257532212222111102-----------------468999
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSP-----------------TTAQET  170 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~-----------------~~~~~~  170 (212)
                               .-.++++.++++|...++++|+.+-.+.+.....|++++.||+|.++-                 ...+..
T Consensus       635 ---------GGAlADlAILvVDInEGfkpQT~EA~~ILr~~ktPFvVAANKIDrI~GW~~~e~~~fl~~~~kq~~~~~~~  705 (1145)
T TIGR00491       635 ---------GGALADLAILVVDINEGFKPQTEEALNILRSFKTPFVVAANKIDRIPGWKSHEGRPFLESYEKQEQRVKQN  705 (1145)
T ss_pred             ---------CCHHHHHHEEEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHCCHHHHHH
T ss_conf             ---------10363011013410269840348999996128987289503305588964548851666654111678866


Q ss_pred             HHHH----HHH--HHHCC------------CCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             9999----999--75313------------6898689998888899899999999
Q gi|254780484|r  171 LEKT----KYL--IRNYP------------TAHPEVIPTSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       171 ~~~~----~~~--~~~~~------------~~~~~i~~vSA~~g~Gi~eL~~~I~  207 (212)
                      ++..    .-.  +.+..            ..-.-++||||.||+||-||.--|.
T Consensus       706 l~~~~y~lv~~kPL~e~GF~AerFdRv~Dft~tVaviPvSA~tGEGIpelL~~l~  760 (1145)
T TIGR00491       706 LDKKVYNLVIKKPLAEEGFEAERFDRVRDFTRTVAVIPVSAVTGEGIPELLLILA  760 (1145)
T ss_pred             HHHHHHHHHHCCCHHHCCCCCCCCCCEECEEEEEEEEEEECCCCCCHHHHHHHHH
T ss_conf             8877898873022112588712255200001136898866567897489999998


No 204
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=99.44  E-value=2e-12  Score=90.53  Aligned_cols=158  Identities=22%  Similarity=0.241  Sum_probs=91.8

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      -.+|.++|..|||||||++.|.+.+. ..+  .||  ...+      ......+...+.+.|++|.......      ..
T Consensus        19 ~~kIlilGld~aGKTTil~~l~~~~~-~~~--~PT--~Gfn------~e~i~~~~~~~~~wDvgG~~~~R~l------W~   81 (190)
T cd00879          19 EAKILFLGLDNAGKTTLLHMLKDDRL-AQH--VPT--LHPT------SEELTIGNIKFKTFDLGGHEQARRL------WK   81 (190)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHCCCC-CEE--CCC--CCCC------EEEEEECCEEEEEEECCCCCCCCCC------HH
T ss_conf             04899990699988999999807995-315--265--5874------5999989999999989998455543------88


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCHH-----HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH--HHHHHC
Q ss_conf             89987777664200000112235788754-----54554321025753221222211110246899999999--997531
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGVKQI-----DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK--YLIRNY  181 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~--~~~~~~  181 (212)
                      .    +   ....+.+++++|+.+..+-.     ...+.......+.|++++.||.|+...-..++..+.+.  ......
T Consensus        82 ~----Y---~~~~~~iIfVVDssD~~r~~eak~~L~~lL~~~~l~~~PlLIlaNK~Dl~~a~~~~ei~~~L~L~~~~~~~  154 (190)
T cd00879          82 D----Y---FPEVDGIVFLVDAADPERFQESKEELDSLLSDEELANVPFLILGNKIDLPGAVSEEELRQALGLYGTTTGK  154 (190)
T ss_pred             H----H---HHCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHCCCCCCCCCC
T ss_conf             8----8---43113799999776778999999999999855500698089998666776798999999883984201554


Q ss_pred             -------CCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             -------36898689998888899899999999872
Q gi|254780484|r  182 -------PTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       182 -------~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                             ......++++||.+|+|++|-.+.|.+.|
T Consensus       155 ~~~~~~~~~r~~~i~~csA~tG~Gl~egl~WLs~~l  190 (190)
T cd00879         155 GVSLKVSGIRPIEVFMCSVVKRQGYGEAFRWLSQYL  190 (190)
T ss_pred             CCCCCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHC
T ss_conf             433454577614999655067968289999998549


No 205
>cd01874 Cdc42 Cdc42 subfamily.  Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases.  These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway.  Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth.  In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus.  Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand.  In addi
Probab=99.44  E-value=8e-13  Score=92.86  Aligned_cols=158  Identities=14%  Similarity=0.122  Sum_probs=83.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|.++||||||+.+++..+..  ..-.|+....     .............+.++||+|.+.+.....       
T Consensus         2 vKvv~lGd~~VGKTsli~r~~~~~f~--~~y~pti~~~-----~~~~~~~~~~~v~l~iwDTaG~e~~~~l~~-------   67 (175)
T cd01874           2 IKCVVVGDGAVGKTCLLISYTTNKFP--SEYVPTVFDN-----YAVTVMIGGEPYTLGLFDTAGQEDYDRLRP-------   67 (175)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCEEEE-----EEEEEEECCEEEEEEEEECCCCCCCHHHHH-------
T ss_conf             79999899995889999999649899--9867863478-----999999999999999998999745124658-------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--CHHHHHHHHH--HCCCCCCCCCCCCCCCCCCHHHHHHHH----------HHHH
Q ss_conf             9987777664200000112235788--7545455432--102575322122221111024689999----------9999
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--KQIDQDVFSF--LDKKAVSYQIVLTKIDKLSPTTAQETL----------EKTK  175 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~--~~~~~~~~~~v~nK~D~~~~~~~~~~~----------~~~~  175 (212)
                         ...   ...+..+.+.+.....  ..........  ......|++++.||+|+.+.....+.+          ++-+
T Consensus        68 ---~~~---~~~~~~ilvydv~d~~Sf~~i~~~w~~~i~~~~~~~p~iLVGnK~DL~~~~~~~~~~~~~~~r~V~~~eg~  141 (175)
T cd01874          68 ---LSY---PQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETGE  141 (175)
T ss_pred             ---HHH---HCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHH
T ss_conf             ---877---13888899963798788999999999999982989988999987203356666777644026566899999


Q ss_pred             HHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             9975313689868999888889989999999987
Q gi|254780484|r  176 YLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       176 ~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      +....  .+...++.+||++|+||+++++.+...
T Consensus       142 ~lA~~--~~~~~y~EtSAk~g~nV~e~F~~~i~~  173 (175)
T cd01874         142 KLARD--LKAVKYVECSALTQKGLKNVFDEAILA  173 (175)
T ss_pred             HHHHH--CCCCEEEECCCCCCCCHHHHHHHHHHH
T ss_conf             99997--599599991337895979999999998


No 206
>PRK00007 elongation factor G; Reviewed
Probab=99.43  E-value=2.5e-12  Score=89.99  Aligned_cols=128  Identities=13%  Similarity=0.136  Sum_probs=87.8

Q ss_pred             HHCCCCCCCEEEEECCCCCCHHHHHHHHHC---C-CCEEEECCCCCEE------EECCEEEEEEEEEEEEC-CCEEEEEE
Q ss_conf             758876686899974899889899999738---9-7379873888414------52120266555678508-96499997
Q gi|254780484|r   22 GLLPKAGPPEIAFSGRSNVGKSSLINILVN---R-KNLARTSNAPGRT------QHLNFFVPKDFSNLKNN-LPAMALVD   90 (212)
Q Consensus        22 ~~~P~~~~p~VaivG~~NvGKSSLiNaL~g---~-~~~a~~~~~p~tt------~~~~~~~~~~~~~~~~~-~~~~~~~D   90 (212)
                      +..|-+++..|||+|+..+|||||.-+|.-   . ++...+....+++      +..+.+.........+. ...+.++|
T Consensus         3 ~~~~ie~IRNi~IiaHvd~GKTTL~e~lL~~sg~i~~~G~v~~g~t~~D~~~~E~eRgITI~s~~~s~~~~~~~~iNlID   82 (693)
T PRK00007          3 RTTPLERYRNIGIMAHIDAGKTTTTERILFYTGVSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWKDGHRINIID   82 (693)
T ss_pred             CCCCHHHCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCHHHHHCCCCEEECEEEEEECCCEEEEEEE
T ss_conf             88966787099999169999899999999966984658424389855678288997698873222548826973899991


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             600101112244789888899877776642000001122357887545455432102575322122221111
Q gi|254780484|r   91 MPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL  162 (212)
Q Consensus        91 tpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~  162 (212)
                      |||+-.+..             .......+.+.++.+.|+..+...+...........++|.++++||+|..
T Consensus        83 TPGHvDF~~-------------Ev~~aLrv~DgAvlVvDav~GV~~qT~~v~r~a~~~~lp~i~fINK~Dr~  141 (693)
T PRK00007         83 TPGHVDFTI-------------EVERSLRVLDGAVAVFCAVGGVEPQSETVWRQADKYKVPRIVFVNKMDRT  141 (693)
T ss_pred             CCCCCCHHH-------------HHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             979752489-------------99999998586899998898877779999999987598969999797789


No 207
>KOG1424 consensus
Probab=99.43  E-value=1.3e-13  Score=97.30  Aligned_cols=62  Identities=39%  Similarity=0.587  Sum_probs=50.2

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHH
Q ss_conf             868999748998898999997389737987388841452120266555678508964999976001011122
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAP  100 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~  100 (212)
                      ...|++||+|||||||+||+|.|+|+ +.|+.+||.|...         +...-...++++|.||+-.....
T Consensus       314 ~vtVG~VGYPNVGKSSTINaLvG~Kk-VsVS~TPGkTKHF---------QTi~ls~~v~LCDCPGLVfPSf~  375 (562)
T KOG1424         314 VVTVGFVGYPNVGKSSTINALVGRKK-VSVSSTPGKTKHF---------QTIFLSPSVCLCDCPGLVFPSFS  375 (562)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCCE-EEEECCCCCCCCE---------EEEEECCCCEECCCCCCCCCCCC
T ss_conf             05887524888762777888755744-6663489876403---------78970787644478872156877


No 208
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran is involved in the active transport of proteins through nuclear pores.
Probab=99.42  E-value=5.7e-13  Score=93.72  Aligned_cols=150  Identities=9%  Similarity=0.044  Sum_probs=82.0

Q ss_pred             ECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             74899889899999738973798738884145212026655567850896499997600101112244789888899877
Q gi|254780484|r   35 SGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRY  114 (212)
Q Consensus        35 vG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~  114 (212)
                      +|-++||||||+++++..+..  ..-.||.-..    ..............+.++||+|.+.+........         
T Consensus         1 vGD~gVGKTsli~R~~~~~F~--~~y~pTiGvd----~~~~~~~~~~~~i~l~iWDTAGqE~f~sl~~~yy---------   65 (200)
T smart00176        1 VGDGGTGKTTFVKRHLTGEFE--KKYVATLGVE----VHPLVFHTNRGPIRFNVWDTAGQEKFGGLRDGYY---------   65 (200)
T ss_pred             CCCCCCCHHHHHHHHHCCCCC--CCCCCCEEEE----EEEEEEEECCEEEEEEEEECCCCCCCCCCCHHHC---------
T ss_conf             989887899999999409999--9978871489----8999999899899999998988700011026550---------


Q ss_pred             HHHHHHHCCCCCCCCCCCC--CCHHHHHHHHHH-CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             7766420000011223578--875454554321-0257532212222111102468999999999975313689868999
Q gi|254780484|r  115 LSERSTLRCVYLLIDCRHG--VKQIDQDVFSFL-DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT  191 (212)
Q Consensus       115 ~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~-~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~v  191 (212)
                          ....+.+.+.+....  +......+.+.. .....|++++.||+|+-+. .+...  .. ....   ..+-+++.+
T Consensus        66 ----r~a~~~IlvfDvt~~~SF~~l~~W~~~l~~~~~~ipiiLvGNK~DL~~r-~V~~e--~~-~~a~---~~~~~y~Et  134 (200)
T smart00176       66 ----IQGQCAIIMFDVTARVTYKNVPNWHRDLVRVCENIPIVLCGNKVDVKDR-KVKAK--SI-TFHR---KKNLQYYDI  134 (200)
T ss_pred             ----CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC-CCCHH--HH-HHHH---HCCCCEEEE
T ss_conf             ----5787889996358778999899999999985799988999988757404-36599--99-9999---879978983


Q ss_pred             ECCCCCCHHHHHHHHHHHH
Q ss_conf             8888899899999999872
Q gi|254780484|r  192 SSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       192 SA~~g~Gi~eL~~~I~~~l  210 (212)
                      ||++|+|+++++..|...|
T Consensus       135 SAKt~~Nv~e~F~~Lar~L  153 (200)
T smart00176      135 SAKSNYNFEKPFLWLARKL  153 (200)
T ss_pred             ECCCCCCHHHHHHHHHHHH
T ss_conf             0046969799999999998


No 209
>cd04129 Rho2 Rho2 subfamily.  Rho2 is a fungal GTPase that plays a role in cell morphogenesis, control of cell wall integrity, control of growth polarity, and maintenance of growth direction.  Rho2 activates the protein kinase C homolog Pck2, and Pck2 controls Mok1, the major (1-3) alpha-D-glucan synthase.  Together with Rho1 (RhoA), Rho2 regulates the construction of the cell wall.  Unlike Rho1, Rho2 is not an essential protein, but its overexpression is lethal.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for proper intracellular localization via membrane attachment.  As with other Rho family GTPases, the GDP/GTP cycling is regulated by GEFs (guanine nucleotide exchange factors), GAPs (GTPase-activating proteins) and GDIs (guanine nucleotide dissociation inhibitors).
Probab=99.40  E-value=1.4e-12  Score=91.45  Aligned_cols=160  Identities=13%  Similarity=0.107  Sum_probs=83.6

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      +-+|+++|.++||||||++++.+... .. .-.|+. .. .  . ............+.++||+|.+.+.......    
T Consensus         1 r~KivllGd~~VGKTsLi~r~~~~~f-~~-~y~pTi-~~-~--~-~~~i~v~~~~v~l~iwDTaG~e~~~~~~~~~----   69 (187)
T cd04129           1 RRKLVIVGDGACGKTSLLSVFTLGEF-PE-EYHPTV-FE-N--Y-VTDCRVDGKPVQLALWDTAGQEEYERLRPLS----   69 (187)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHCCC-CC-CCCCCE-EE-E--E-EEEEEECCEEEEEEEEECCCCCCCCCCCCCE----
T ss_conf             91999999899768999999982989-99-878866-78-9--8-9999999999999999788870345460412----


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCC--CHHHHHHHHHH--CCCCCCCCCCCCCCCCCCHHH--------HHHHHHHHHH
Q ss_conf             89987777664200000112235788--75454554321--025753221222211110246--------8999999999
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGV--KQIDQDVFSFL--DKKAVSYQIVLTKIDKLSPTT--------AQETLEKTKY  176 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~--------~~~~~~~~~~  176 (212)
                            .   ......+++.+.....  ...........  .....|++++.||+|+-....        .....+.-..
T Consensus        70 ------~---~~a~~~ilvydi~~~~Sf~~~~~~w~~~~~~~~~~~piilVGnK~DL~~~~~~~~~~~~~r~V~~~~g~~  140 (187)
T cd04129          70 ------Y---SKAHVILIGFAVDTPDSLENVRTKWIEEVRRYCPNVPVILVGLKKDLRQDAVAKEEYRTQRFVPIQQGKR  140 (187)
T ss_pred             ------E---CCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHCCCCCHHHHHH
T ss_conf             ------3---3885899970269866799999999999998587998899988600113411211122315578999999


Q ss_pred             HHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9753136898689998888899899999999872
Q gi|254780484|r  177 LIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       177 ~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ..+.  .+...++.+||++|.||+++++.+.+.+
T Consensus       141 ~a~~--~~~~~y~EtSAk~~~nV~e~F~~~~r~~  172 (187)
T cd04129         141 VAKE--IGAKKYMECSALTGEGVDDVFEAATRAA  172 (187)
T ss_pred             HHHH--CCCCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9998--4997899968899979899999999999


No 210
>TIGR02528 EutP ethanolamine utilization protein, EutP; InterPro: IPR012381   Members of this family function in ethanolamine  and propanediol  degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively.  The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems.  Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose , . More than 10f the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect , . The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella , , . Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 biogenic amine metabolic process.
Probab=99.40  E-value=9.4e-13  Score=92.46  Aligned_cols=142  Identities=20%  Similarity=0.248  Sum_probs=86.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|++||++++||+||+|+|-|.+....      +|...           .+.  +-..+||||......         ..
T Consensus         2 r~~f~G~~gCGKTTL~q~L~g~~~~YK------KTQAv-----------E~~--~k~~IDTPGEY~enr---------~~   53 (144)
T TIGR02528         2 RIMFIGSVGCGKTTLTQALQGEEIKYK------KTQAV-----------EYK--DKEAIDTPGEYVENR---------RY   53 (144)
T ss_pred             EEEEEECCCCCHHHHHHHCCCCCCCEE------EEEEE-----------EEC--CCCCCCCCCCCCCCC---------CH
T ss_conf             178871588874435431168732102------33445-----------425--888655985001575---------23


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             98777766420000011223578875454554321025753221222211110246899999999997531368986899
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP  190 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  190 (212)
                      ...........+..+++.++.......-..+....  ..+|++-+++|+|+.+.+..-+   ..++.+..  .+-.++|.
T Consensus        54 Y~AL~vtaaDAd~i~lV~~a~~~~~~f~PgF~~~f--~kK~~IG~vTK~DLA~~d~~i~---r~~~~L~~--AG~~~iF~  126 (144)
T TIGR02528        54 YSALIVTAADADVIALVQSATDEESRFSPGFASIF--VKKEVIGIVTKIDLAEADKDIE---RAKRLLET--AGAEKIFE  126 (144)
T ss_pred             HHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCC--CCCCEEEEEEECCCCCCHHHHH---HHHHHHHH--CCCCCCEE
T ss_conf             78888887210236677357764223785000236--7886347884037887734799---99999872--36543316


Q ss_pred             EECCCCCCHHHHHHHHH
Q ss_conf             98888899899999999
Q gi|254780484|r  191 TSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       191 vSA~~g~Gi~eL~~~I~  207 (212)
                      +|+....||++|++.|.
T Consensus       127 ~~~~d~~G~~~l~~yL~  143 (144)
T TIGR02528       127 ISSVDEKGIEELVDYLN  143 (144)
T ss_pred             ECCCCCHHHHHHHHHHC
T ss_conf             50778045899999844


No 211
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]
Probab=99.40  E-value=7.7e-13  Score=92.95  Aligned_cols=170  Identities=18%  Similarity=0.182  Sum_probs=112.0

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHCCCC-------EEEEC------CCCCEEEECCEEEEEEEEEEEECCCEEEEE
Q ss_conf             58876686899974899889899999738973-------79873------888414521202665556785089649999
Q gi|254780484|r   23 LLPKAGPPEIAFSGRSNVGKSSLINILVNRKN-------LARTS------NAPGRTQHLNFFVPKDFSNLKNNLPAMALV   89 (212)
Q Consensus        23 ~~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~-------~a~~~------~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~   89 (212)
                      ..|..++...+|+.+-.+|||||-.+|...-.       .+.+-      ..-|-|...+..+.... ........+.++
T Consensus         3 ~~~~~~IRNFsIIAHIDHGKSTLaDRlle~t~~~~~Rem~~Q~LDsMdiERERGITIKaq~v~l~Yk-~~~g~~Y~lnlI   81 (603)
T COG0481           3 FTPQKNIRNFSIIAHIDHGKSTLADRLLELTGGLSEREMRAQVLDSMDIERERGITIKAQAVRLNYK-AKDGETYVLNLI   81 (603)
T ss_pred             CCCHHHCCCEEEEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEEE-ECCCCEEEEEEC
T ss_conf             6725442322799984278204889999984676767888875221346766284587327899999-479977999972


Q ss_pred             ECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             76001011122447898888998777766420000011223578875454554321025753221222211110246899
Q gi|254780484|r   90 DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQE  169 (212)
Q Consensus        90 DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~  169 (212)
                      ||||+-.+...-.             .....+-..+.+.|+..+...|.....-...+.+..++.|+||+|+-. .+.+.
T Consensus        82 DTPGHVDFsYEVS-------------RSLAACEGalLvVDAsQGveAQTlAN~YlAle~~LeIiPViNKIDLP~-Adper  147 (603)
T COG0481          82 DTPGHVDFSYEVS-------------RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPA-ADPER  147 (603)
T ss_pred             CCCCCCCEEEEEH-------------HHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCC-CCHHH
T ss_conf             7998443677761-------------337637771899987655378899999999876967997532256887-89789


Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             99999999753136898689998888899899999999872
Q gi|254780484|r  170 TLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ..+++.+.+   ...-.+++.+||++|.||+++.++|.+.+
T Consensus       148 vk~eIe~~i---Gid~~dav~~SAKtG~gI~~iLe~Iv~~i  185 (603)
T COG0481         148 VKQEIEDII---GIDASDAVLVSAKTGIGIEDVLEAIVEKI  185 (603)
T ss_pred             HHHHHHHHH---CCCCCCCEEEECCCCCCHHHHHHHHHHHC
T ss_conf             999999870---98952004676346899799999999628


No 212
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]
Probab=99.40  E-value=1.1e-11  Score=86.42  Aligned_cols=158  Identities=17%  Similarity=0.261  Sum_probs=101.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHC---------------------CC--CEEEECCCCCEEEECCEEEEEEEEEEEECCCEEE
Q ss_conf             899974899889899999738---------------------97--3798738884145212026655567850896499
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVN---------------------RK--NLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMA   87 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g---------------------~~--~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~   87 (212)
                      .++++|++++|||||+-+|+=                     +.  .++-+.+..-+.+..+.+.......+..+...+.
T Consensus         9 nl~~iGHVD~GKSTl~GrLly~~G~id~~tmeK~~~ea~~~gK~sf~fawvlD~tkeERerGvTi~~~~~~fet~k~~~t   88 (428)
T COG5256           9 NLVFIGHVDAGKSTLVGRLLYDLGEIDKRTMEKLEKEAKELGKESFKFAWVLDKTKEERERGVTIDVAHSKFETDKYNFT   88 (428)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHCCEEEEEEEEEEECCCCEEE
T ss_conf             89998378787034455657773797989999999999861977168999853886678666689977788643770589


Q ss_pred             EEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC-------CCHHHHHHHHHHCCCCCC-CCCCCCCC
Q ss_conf             9976001011122447898888998777766420000011223578-------875454554321025753-22122221
Q gi|254780484|r   88 LVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG-------VKQIDQDVFSFLDKKAVS-YQIVLTKI  159 (212)
Q Consensus        88 ~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~-~~~v~nK~  159 (212)
                      ++|+||+..+...             ....+..++..++++++..+       ...|..+..-.....++. .++++||+
T Consensus        89 IiDaPGHrdFvkn-------------mItGasqAD~aVLVV~a~~~efE~g~~~~gQtrEH~~La~tlGi~~lIVavNKM  155 (428)
T COG5256          89 IIDAPGHRDFVKN-------------MITGASQADVAVLVVDARDGEFEAGFGVGGQTREHAFLARTLGIKQLIVAVNKM  155 (428)
T ss_pred             EEECCCHHHHHHH-------------HHCCHHHCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             9607846778987-------------631331336799999888983101436587516789999856975699999715


Q ss_pred             CCCCH--HHHHHHHHHHHHHHHHCCCC--CCCEEEEECCCCCCHHH
Q ss_conf             11102--46899999999997531368--98689998888899899
Q gi|254780484|r  160 DKLSP--TTAQETLEKTKYLIRNYPTA--HPEVIPTSSVKRKGIEV  201 (212)
Q Consensus       160 D~~~~--~~~~~~~~~~~~~~~~~~~~--~~~i~~vSA~~g~Gi~e  201 (212)
                      |.++-  +.-++...++..+++.....  ..+++|+||.+|.|+.+
T Consensus       156 D~v~wde~rf~ei~~~v~~l~k~~G~~~~~v~FIPiSg~~G~Nl~~  201 (428)
T COG5256         156 DLVSWDEERFEEIVSEVSKLLKMVGYNPKDVPFIPISGFKGDNLTK  201 (428)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCC
T ss_conf             6666279999999999999999719986677079622446776332


No 213
>cd04131 Rnd Rnd subfamily.  The Rnd subfamily contains Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8.  These novel Rho family proteins have substantial structural differences compared to other Rho members, including N- and C-terminal extensions relative to other Rhos.  Rnd3/RhoE is farnesylated at the C-terminal prenylation site, unlike most other Rho proteins that are geranylgeranylated.  In addition, Rnd members are unable to hydrolyze GTP and are resistant to GAP activity.  They are believed to exist only in the GTP-bound conformation, and are antagonists of RhoA activity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=99.39  E-value=2.7e-12  Score=89.85  Aligned_cols=158  Identities=11%  Similarity=0.076  Sum_probs=82.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|-++||||||++++++...  ...-.|+. .. +   .............+.++||+|.+.+......      
T Consensus         2 ~KivlvGd~~VGKTsLi~r~~~~~F--~~~y~pTi-~~-~---~~~~~~v~~~~v~l~iwDTaGqe~~~~l~~~------   68 (178)
T cd04131           2 CKIVVVGDVQCGKTALLQVFAKDCY--PETYVPTV-FE-N---YTASFEIDEQRIELSLWDTSGSPYYDNVRPL------   68 (178)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCC--CCCCCCCE-EE-E---EEEEEEECCEEEEEEEEECCCCHHHCCHHHH------
T ss_conf             0999999999778999999963999--99857856-88-8---8999999999999999968987421103667------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--CHHHHHHHHHH--CCCCCCCCCCCCCCCCCCHHHHHHH----------HHHHH
Q ss_conf             9987777664200000112235788--75454554321--0257532212222111102468999----------99999
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--KQIDQDVFSFL--DKKAVSYQIVLTKIDKLSPTTAQET----------LEKTK  175 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~~~~----------~~~~~  175 (212)
                          ..   ......+.+.+.....  ...........  .....|++++.||+|+..+......          .++-.
T Consensus        69 ----~y---~~a~~~ilvydit~~~Sf~~v~~~W~~ei~~~~~~~~iiLVGnK~DLr~~~~~~~~~~~~~~~~Vs~eeg~  141 (178)
T cd04131          69 ----CY---PDSDAVLICFDISRPETLDSVLKKWRGEIQEFCPNTKVLLVGCKTDLRTDLSTLMELSHQRQAPVSYEQGC  141 (178)
T ss_pred             ----HH---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHH
T ss_conf             ----73---46878999973798788999999999999986879988999985436644455667764467776899999


Q ss_pred             HHHHHCCCCCCCEEEEECCCCC-CHHHHHHHHHHH
Q ss_conf             9975313689868999888889-989999999987
Q gi|254780484|r  176 YLIRNYPTAHPEVIPTSSVKRK-GIEVLRKAILET  209 (212)
Q Consensus       176 ~~~~~~~~~~~~i~~vSA~~g~-Gi~eL~~~I~~~  209 (212)
                      .....  .+-..++.+||++|+ |++++++.+...
T Consensus       142 ~~A~~--~ga~~y~EtSAktg~ngV~evF~~a~~~  174 (178)
T cd04131         142 AIAKQ--LGAEIYLECSAFTSEKSVRDIFHVATMA  174 (178)
T ss_pred             HHHHH--CCCCEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             99997--4998999978486873989999999999


No 214
>pfam05049 IIGP Interferon-inducible GTPase (IIGP). Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence. IIGP is predominantly associated with the Golgi apparatus and also localizes to the endoplasmic reticulum and exerts a distinct role in IFN-induced intracellular membrane trafficking or processing.
Probab=99.39  E-value=1.2e-11  Score=86.15  Aligned_cols=165  Identities=21%  Similarity=0.278  Sum_probs=105.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCE---EEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             868999748998898999997389737987388841---45212026655567850896499997600101112244789
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGR---TQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~t---t~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      +..||+.|-+++||||++|||-|-......+...|.   |..+..+     .  ...-+.+.++|.||............
T Consensus        35 ~lnIavtGesG~GkSsfINalRg~g~e~~~aA~tGvvetT~~~~~Y-----~--hp~~pnV~lwDLPG~gt~~f~~~~Yl  107 (375)
T pfam05049        35 PLKIAVTGDSGNGKSSFINALRGIGHEEDGSAPTGVVETTMKRTPY-----S--HPHFPNVVLWDLPGLGATNFTVETYL  107 (375)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCEEECCCCCCC-----C--CCCCCCEEEECCCCCCCCCCCHHHHH
T ss_conf             2479985489986789999874789877776876876632675567-----8--99999807962899998998989999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC---------HHHHHHHHHHHHH
Q ss_conf             8888998777766420000011223578875454554321025753221222211110---------2468999999999
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS---------PTTAQETLEKTKY  176 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~---------~~~~~~~~~~~~~  176 (212)
                      .          .......+.+++-....+...+..+.......++.+.+|.+|+|.--         .-..++.++.+++
T Consensus       108 ~----------~~~f~~yDfFiiiss~rf~~n~v~LAk~i~~mgK~fyfVrtKvD~Dl~~e~~~kp~~F~~e~~Lq~IR~  177 (375)
T pfam05049       108 E----------EMKFSEYDFFIIISSERFSLNDVKLAKAIQRMGKRFYFVRTKLDSDLSNEQKGKPQTFPKEKVLQNIQD  177 (375)
T ss_pred             H----------HCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHCCCCCCCHHHHHHHHHH
T ss_conf             8----------748564778999967754320189999999838947999862367606576258999998999999999


Q ss_pred             H----HHHCCCCCCCEEEEECCC--CCCHHHHHHHHHHHH
Q ss_conf             9----753136898689998888--899899999999872
Q gi|254780484|r  177 L----IRNYPTAHPEVIPTSSVK--RKGIEVLRKAILETI  210 (212)
Q Consensus       177 ~----~~~~~~~~~~i~~vSA~~--g~Gi~eL~~~I~~~l  210 (212)
                      .    +.......+++|.||...  .+.+..|.+.|.+-|
T Consensus       178 ~c~~~L~k~gv~eP~VFLvSnfdl~~yDFp~L~~TL~~eL  217 (375)
T pfam05049       178 NCRNNLQKEGVKEPPIFLVSNLDPSHYDFPKLRDTLLKDL  217 (375)
T ss_pred             HHHHHHHHCCCCCCCEEEEECCCHHHCCHHHHHHHHHHHH
T ss_conf             9999998758889978998178813268189999999873


No 215
>PRK09602 translation-associated GTPase; Reviewed
Probab=99.38  E-value=4.9e-13  Score=94.08  Aligned_cols=69  Identities=25%  Similarity=0.219  Sum_probs=48.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEE--------------EEE----ECCCEEEEEEC
Q ss_conf             689997489988989999973897379873888414521202665556--------------785----08964999976
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS--------------NLK----NNLPAMALVDM   91 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~--------------~~~----~~~~~~~~~Dt   91 (212)
                      .+++|||.|||||||||||||+.+  +...++|++|..+|........              ...    ..-.++.++|.
T Consensus         3 lk~GIVGLPNvGKSTlFnaLT~~~--~~~aNyPF~TIePn~Gi~~v~v~~pd~~l~~~~~~~~~~~~~~~~~vpie~vDI   80 (396)
T PRK09602          3 IQIGLVGKPNVGKSTFFSAATLAD--VEIANYPFTTIDPNVGVAYVRVECPCKELGVKCNPRNGKCIDGVRFIPVELIDV   80 (396)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCC--CCCCCCCCCCCCCCCCEEECCCCCCHHHHHHHCCCCCCCCCCCCEEEEEEEEEC
T ss_conf             348888899998899999997799--864589988877843625233688436665430654221357733655899875


Q ss_pred             CHHHHHHHH
Q ss_conf             001011122
Q gi|254780484|r   92 PGYGYARAP  100 (212)
Q Consensus        92 pG~~~~~~~  100 (212)
                      ||+......
T Consensus        81 AGLVkGAS~   89 (396)
T PRK09602         81 AGLVPGAHE   89 (396)
T ss_pred             CCCCCCCCC
T ss_conf             556765011


No 216
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=99.38  E-value=3.1e-12  Score=89.48  Aligned_cols=157  Identities=22%  Similarity=0.211  Sum_probs=92.6

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      -.+|.++|-.|||||||++.|.+.+. ..+.++.+-.          ..........+.+.|..|.....      ..+.
T Consensus        17 e~~ililGLd~aGKTTil~~lk~~~~-~~~~PT~g~~----------~e~~~~~~~~~~~wDlgG~~~~R------~lW~   79 (184)
T smart00178       17 HAKILFLGLDNAGKTTLLHMLKNDRL-AQHQPTQHPT----------SEELAIGNIKFTTFDLGGHQQAR------RLWK   79 (184)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCC-CCCCCCCCCC----------EEEEEECCEEEEEEECCCCHHHH------HHHH
T ss_conf             14799996588988999999806997-5305787886----------48999999999999889877788------9999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCHHH--H---HHHHHHCCCCCCCCCCCCCCCCCC---HHHHHHHHHHHHHHHHH
Q ss_conf             899877776642000001122357887545--4---554321025753221222211110---24689999999999753
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGVKQID--Q---DVFSFLDKKAVSYQIVLTKIDKLS---PTTAQETLEKTKYLIRN  180 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~---~~~~~~~~~~~~~~~v~nK~D~~~---~~~~~~~~~~~~~~~~~  180 (212)
                      ..       ......+++++|+.+..+-..  .   .........+.|++++.||.|+-.   ..++.+.++- ......
T Consensus        80 ~Y-------y~~~~~iIfVVDssD~~r~~eak~~L~~ll~~~~l~~~PlLilaNKqDl~~a~~~~ei~~~L~L-~~~~~~  151 (184)
T smart00178       80 DY-------FPEVNGIVYLVDAYDKERFAESKRELDALLSDEELATVPFLILGNKIDAPYAASEDELRYALGL-TNTTGS  151 (184)
T ss_pred             HH-------HCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHCC-HHHHCC
T ss_conf             88-------2167589999726868899999999999864676559709999975677789999999988195-123265


Q ss_pred             CC---CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             13---6898689998888899899999999872
Q gi|254780484|r  181 YP---TAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       181 ~~---~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ..   .....++++||.+|+|+++-.+.|.+.+
T Consensus       152 ~~~~~~r~~~i~~~SA~tG~Gl~egl~WLs~~i  184 (184)
T smart00178      152 KGKVGVRPLEVFMCSVVRRMGYGEGFKWLSQYI  184 (184)
T ss_pred             CCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             576677631999735607978699999998409


No 217
>KOG0394 consensus
Probab=99.37  E-value=5.5e-13  Score=93.79  Aligned_cols=165  Identities=15%  Similarity=0.078  Sum_probs=99.2

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      +..+.+|.|.|-++||||||+|.++.++.. .-+     -..++......+..+......+.++||+|.++++.......
T Consensus         6 K~~lLKViiLGDsGVGKtSLmn~yv~~kF~-~qy-----kaTIgadFltKev~Vd~~~vtlQiWDTAGQERFqsLg~aFY   79 (210)
T KOG0394           6 KRTLLKVIILGDSGVGKTSLMNQYVNKKFS-QQY-----KATIGADFLTKEVQVDDRSVTLQIWDTAGQERFQSLGVAFY   79 (210)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHH-HHH-----CCCCCCEEEEEEEEECCEEEEEEEEECCCHHHHHHCCCCEE
T ss_conf             664359999379984478999999888888-874-----32000110322799867699999873311777631464112


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCC------CCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             888899877776642000001122357------88754545543210257532212222111102468999999999975
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRH------GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR  179 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~  179 (212)
                      +          ..... ...+..+...      .+++.-+...+.......|++++.||+|.-....+....+..+.  +
T Consensus        80 R----------gaDcC-vlvydv~~~~Sfe~L~~Wr~EFl~qa~~~~Pe~FPFVilGNKiD~~~~~~r~VS~~~Aq~--W  146 (210)
T KOG0394          80 R----------GADCC-VLVYDVNNPKSFENLENWRKEFLIQASPQDPETFPFVILGNKIDVDGGKSRQVSEKKAQT--W  146 (210)
T ss_pred             C----------CCCEE-EEEECCCCHHHHCCHHHHHHHHHHHCCCCCCCCCCEEEECCCCCCCCCCCCEEEHHHHHH--H
T ss_conf             4----------77547-898326864665118789999987468799775667997551147777501201889999--9


Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             313689868999888889989999999987
Q gi|254780484|r  180 NYPTAHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       180 ~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      .-..++.|.+.+||+.+.|+++..+.+...
T Consensus       147 C~s~gnipyfEtSAK~~~NV~~AFe~ia~~  176 (210)
T KOG0394         147 CKSKGNIPYFETSAKEATNVDEAFEEIARR  176 (210)
T ss_pred             HHHCCCCEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             986599506871024344689999999999


No 218
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily.  Rnd2/Rho7 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd3/RhoE/Rho8.  Rnd2/Rho7 is transiently expressed in radially migrating cells in the brain while they are within the subventricular zone of the hippocampus and cerebral cortex.  These migrating cells typically develop into pyramidal neurons.  Cells that exogenously expressed Rnd2/Rho7 failed to migrate to upper layers of the brain, suggesting that Rnd2/Rho7 plays a role in the radial migration and morphological changes of developing pyramidal neurons, and that Rnd2/Rho7 degradation is necessary for proper cellular migration.  The Rnd2/Rho7 GEF Rapostlin is found primarily in the brain and together with Rnd2/Rho7 induces dendrite branching.  Unlike Rnd1/Rho6 and Rnd3/RhoE/Rho8, which are RhoA antagonists, Rnd2/Rho7 binds the GEF Pragmin and significantly stimulates RhoA activity and Rho-A mediated cell contraction.  Rnd2/Rho7 is also found to be expressed in sperma
Probab=99.36  E-value=2.6e-11  Score=84.12  Aligned_cols=158  Identities=13%  Similarity=0.119  Sum_probs=83.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|.++|-++||||||+.+++....  ...-.|+.  ..+   .............+.++||+|.+.+.....       
T Consensus         2 ~KiVlvGD~~VGKTsLl~~f~~~~F--~~~y~pTi--~~~---~~~~~~vd~~~v~L~iWDTAGqE~y~~lr~-------   67 (222)
T cd04173           2 CKIVVVGDAECGKTALLQVFAKDAY--PGSYVPTV--FEN---YTASFEIDKRRIELNMWDTSGSSYYDNVRP-------   67 (222)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC--CCCCCCCE--EEE---EEEEEEECCEEEEEEEECCCCCCHHHHHHH-------
T ss_conf             0999989899898999999963999--99847845--877---899999999999999976888503455678-------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHH--HHCCCCCCCCCCCCCCCCCCHHHHHHHHHH----------HH
Q ss_conf             998777766420000011223578--8754545543--210257532212222111102468999999----------99
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHG--VKQIDQDVFS--FLDKKAVSYQIVLTKIDKLSPTTAQETLEK----------TK  175 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~--~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~----------~~  175 (212)
                         .+.....   ..+.+.+....  +.........  .......|+++|.||+|+-++......+..          -.
T Consensus        68 ---~yyr~a~---~~llvfdit~~~SF~~v~~~W~~ei~~~~p~~piiLVGnK~DLR~d~~~~~el~~~~~~pVt~eeg~  141 (222)
T cd04173          68 ---LAYPDSD---AVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRTDLATLRELSKQRLIPVTHEQGT  141 (222)
T ss_pred             ---HHCCCCC---EEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHH
T ss_conf             ---7503698---9999983897788999999999999985899978999587424568788999985578887899999


Q ss_pred             HHHHHCCCCCCCEEEEECCCCC-CHHHHHHHHHHH
Q ss_conf             9975313689868999888889-989999999987
Q gi|254780484|r  176 YLIRNYPTAHPEVIPTSSVKRK-GIEVLRKAILET  209 (212)
Q Consensus       176 ~~~~~~~~~~~~i~~vSA~~g~-Gi~eL~~~I~~~  209 (212)
                      .+..  ..+...++.+||++|+ |++++++.....
T Consensus       142 ~lA~--~~ga~~y~EcSAk~~~n~V~evF~~a~~~  174 (222)
T cd04173         142 VLAK--QVGAVSYVECSSRSSERSVRDVFHVATVA  174 (222)
T ss_pred             HHHH--HCCCCEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             9999--76998899888486874989999999999


No 219
>KOG0092 consensus
Probab=99.36  E-value=1.4e-12  Score=91.38  Aligned_cols=157  Identities=16%  Similarity=0.142  Sum_probs=88.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      -+|+++|.+|||||||+-++...+..  ....|+.-.    -..............+.++||+|.+.+........    
T Consensus         6 ~KvvLLG~~~VGKSSlV~Rfvk~~F~--e~~e~TIGa----aF~tktv~~~~~~ikfeIWDTAGQERy~slapMYy----   75 (200)
T KOG0092           6 FKVVLLGDSGVGKSSLVLRFVKDQFH--ENIEPTIGA----AFLTKTVTVDDNTIKFEIWDTAGQERYHSLAPMYY----   75 (200)
T ss_pred             EEEEEECCCCCCCHHHHHHHHHCCCC--CCCCCCCCE----EEEEEEEEECCCEEEEEEEECCCCCCCCCCCCCEE----
T ss_conf             79999867877702411222327566--323454000----78999998489578999987677300335561010----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCC--CCCHHHHHHHHH--HCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             99877776642000001122357--887545455432--10257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRH--GVKQIDQDVFSF--LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~--~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                            +...   ..+++.|...  .+........+.  .......+.++.||+|+....++.  .++.....++   .+
T Consensus        76 ------RgA~---AAivvYDit~~~SF~~aK~WvkeL~~~~~~~~vialvGNK~DL~~~R~V~--~~ea~~yAe~---~g  141 (200)
T KOG0092          76 ------RGAN---AAIVVYDITDEESFEKAKNWVKELQRQASPNIVIALVGNKADLLERREVE--FEEAQAYAES---QG  141 (200)
T ss_pred             ------CCCC---EEEEEEECCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCCCCC--HHHHHHHHHH---CC
T ss_conf             ------4776---79999855667899999999999986279875999832516541034546--8888989985---49


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -.++.+||++|.|++++...|.+.|
T Consensus       142 ll~~ETSAKTg~Nv~~if~~Ia~~l  166 (200)
T KOG0092         142 LLFFETSAKTGENVNEIFQAIAEKL  166 (200)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             8799985255658999999999756


No 220
>COG1161 Predicted GTPases [General function prediction only]
Probab=99.36  E-value=8.3e-13  Score=92.77  Aligned_cols=61  Identities=36%  Similarity=0.493  Sum_probs=48.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAP  100 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~  100 (212)
                      ..|.++|.||||||||||+|.|++. +.+++.||+|.....         ..-.....+.||||+......
T Consensus       133 ~~v~vvG~PNVGKSslIN~L~~k~~-~~~s~~PG~Tk~~q~---------i~~~~~i~LlDtPGii~~~~~  193 (322)
T COG1161         133 IRVGVVGYPNVGKSTLINRLLGKKV-AKTSNRPGTTKGIQW---------IKLDDGIYLLDTPGIIPPKFD  193 (322)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCC-CCCCCCCCEECCCEE---------EECCCCEEEEECCCCCCCCCC
T ss_conf             0899987897648999999862055-523799962045168---------972786289738880788643


No 221
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily.  Rnd1/Rho6 is a member of the novel Rho subfamily Rnd, together with Rnd2/Rho7 and Rnd3/RhoE/Rho8.  Rnd1/Rho6 binds GTP but does not hydrolyze it to GDP, indicating that it is constitutively active.  In rat, Rnd1/Rho6 is highly expressed in the cerebral cortex and hippocampus during synapse formation, and plays a role in spine formation.  Rnd1/Rho6 is also expressed in the liver and in endothelial cells, and is upregulated in uterine myometrial cells during pregnancy.  Like Rnd3/RhoE/Rho8, Rnd1/Rho6 is believed to function as an antagonist to RhoA.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=99.35  E-value=1.4e-11  Score=85.65  Aligned_cols=167  Identities=11%  Similarity=0.137  Sum_probs=86.8

Q ss_pred             HHCCCCCCC--EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHH
Q ss_conf             758876686--899974899889899999738973798738884145212026655567850896499997600101112
Q gi|254780484|r   22 GLLPKAGPP--EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARA   99 (212)
Q Consensus        22 ~~~P~~~~p--~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~   99 (212)
                      ++.|++...  +|.+||-++||||||+++++.... . ..-.|+.  ..+   .............+.++||+|.+.+..
T Consensus         4 ~~~~~p~~~~~KiVlVGD~~VGKTsLl~~~~~~~F-~-~~y~pTv--~~~---~~~~i~v~~~~v~L~lWDTAGqE~y~~   76 (232)
T cd04174           4 RRIPQPLVMRCKLVLVGDVQCGKTAMLQVLAKDCY-P-ETYVPTV--FEN---YTAGLETEEQRVELSLWDTSGSPYYDN   76 (232)
T ss_pred             CCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHCCC-C-CCCCCCE--EEE---EEEEEEECCEEEEEEEEECCCCCCCCH
T ss_conf             67999985588999999899899999999973989-9-9858836--888---899999999999999983899701003


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC--C-CCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHH----
Q ss_conf             244789888899877776642000001122357--8-875454554321025753221222211110246899999----
Q gi|254780484|r  100 PKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH--G-VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLE----  172 (212)
Q Consensus       100 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~-~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~----  172 (212)
                      ...          .+........++..+.+...  . ...+..++.+.  ....|+++|.||+|+-.+...-..+.    
T Consensus        77 lr~----------~yY~~a~~~ll~Fdvt~~~Sfe~~~~~Wi~Ei~~~--~p~~piiLVGnK~DLr~d~~~l~~L~~~~~  144 (232)
T cd04174          77 VRP----------LCYSDSDAVLLCFDISRPETVDSALKKWKAEIMDY--CPSTRILLIGCKTDLRTDLSTLMELSNQKQ  144 (232)
T ss_pred             HHH----------HHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHH--CCCCCEEEEEECHHCCCCHHHHHHHHHCCC
T ss_conf             679----------97406878999996898799998999999999986--899978999876021547577889975688


Q ss_pred             ------HHHHHHHHCCCCCCCEEEEECCCCC-CHHHHHHHHHHH
Q ss_conf             ------9999975313689868999888889-989999999987
Q gi|254780484|r  173 ------KTKYLIRNYPTAHPEVIPTSSVKRK-GIEVLRKAILET  209 (212)
Q Consensus       173 ------~~~~~~~~~~~~~~~i~~vSA~~g~-Gi~eL~~~I~~~  209 (212)
                            +-....+  ..+...++.+||++|+ |++++++.....
T Consensus       145 ~pVt~eeg~~~Ak--~iga~~Y~E~SA~tge~~v~~vF~~a~~~  186 (232)
T cd04174         145 APISYEQGCALAK--QLGAEVYLECSAFTSEKSIHSIFRSASLL  186 (232)
T ss_pred             CCCCHHHHHHHHH--HCCCCEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             8757999999999--74997899875686662599999999999


No 222
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]
Probab=99.34  E-value=1.3e-11  Score=85.86  Aligned_cols=169  Identities=18%  Similarity=0.221  Sum_probs=119.9

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCC--------EEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHH
Q ss_conf             686899974899889899999738973--------798738884145212026655567850896499997600101112
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKN--------LARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARA   99 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~--------~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~   99 (212)
                      ++..|||+-+..+||+||+.+|+.|.-        ...+.+..--.+..+.+......-..+.+..+.++||||+-.+..
T Consensus         4 ~iRNIAIIAHVDHGKTTLVD~LLkQSGtf~~~e~v~ERvMDSnDlEkERGITILaKnTav~~~~~~INIvDTPGHADFGG   83 (603)
T COG1217           4 DIRNIAIIAHVDHGKTTLVDALLKQSGTFREREEVAERVMDSNDLEKERGITILAKNTAVNYNGTRINIVDTPGHADFGG   83 (603)
T ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHCCCCCCCCCHHHHHCCCCCHHHHCCCEEEECCCEEECCCEEEEEECCCCCCCCCC
T ss_conf             65306899984488102899998731654456520144037642344349389851524620883898765898677662


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             24478988889987777664200000112235788754545543210257532212222111102468999999999975
Q gi|254780484|r  100 PKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR  179 (212)
Q Consensus       100 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~  179 (212)
                      .-+..             ....+.++++.|+..+...|..-........+.+.++|+||+|.-. ......++++-+++.
T Consensus        84 EVERv-------------l~MVDgvlLlVDA~EGpMPQTrFVlkKAl~~gL~PIVVvNKiDrp~-Arp~~Vvd~vfDLf~  149 (603)
T COG1217          84 EVERV-------------LSMVDGVLLLVDASEGPMPQTRFVLKKALALGLKPIVVINKIDRPD-ARPDEVVDEVFDLFV  149 (603)
T ss_pred             HHHHH-------------HHHCCEEEEEEECCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCC-CCHHHHHHHHHHHHH
T ss_conf             54511-------------4323348999975558887314448999974998489996778999-887899999999999


Q ss_pred             HCC----CCCCCEEEEECCCCC----------CHHHHHHHHHHHH
Q ss_conf             313----689868999888889----------9899999999872
Q gi|254780484|r  180 NYP----TAHPEVIPTSSVKRK----------GIEVLRKAILETI  210 (212)
Q Consensus       180 ~~~----~~~~~i~~vSA~~g~----------Gi~eL~~~I~~~l  210 (212)
                      ...    ..+-|+++.||..|+          +++-|++.|.+++
T Consensus       150 ~L~A~deQLdFPivYAS~~~G~a~~~~~~~~~~m~pLfe~I~~hv  194 (603)
T COG1217         150 ELGATDEQLDFPIVYASARNGTASLDPEDEADDMAPLFETILDHV  194 (603)
T ss_pred             HHCCCHHHCCCEEEEEECCCCEECCCCCCCCCCHHHHHHHHHHHC
T ss_conf             819974557870798541475101586555553168999999758


No 223
>KOG1144 consensus
Probab=99.32  E-value=1.7e-11  Score=85.26  Aligned_cols=166  Identities=19%  Similarity=0.276  Sum_probs=117.8

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEE------------EEEEECCCEEEEEECCHHHH
Q ss_conf             868999748998898999997389737987388841452120266555------------67850896499997600101
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDF------------SNLKNNLPAMALVDMPGYGY   96 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~------------~~~~~~~~~~~~~DtpG~~~   96 (212)
                      -|-+||+|+...||+-|+..|.+..  +....+.|.|..++.+.....            .-.....+.+.++||||+..
T Consensus       475 SPIcCilGHVDTGKTKlld~ir~tN--VqegeaggitqqIgAt~fp~~ni~e~tk~~~~~~K~~~kvPg~lvIdtpghEs  552 (1064)
T KOG1144         475 SPICCILGHVDTGKTKLLDKIRGTN--VQEGEAGGITQQIGATYFPAENIREKTKELKKDAKKRLKVPGLLVIDTPGHES  552 (1064)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHCCC--CCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHH
T ss_conf             8637897111266057888762055--32244566000005411526778999999875023313787048965887255


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHH----------
Q ss_conf             1122447898888998777766420000011223578875454554321025753221222211110246----------
Q gi|254780484|r   97 ARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTT----------  166 (212)
Q Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~----------  166 (212)
                      +..             ........++..+.+.+...+...+..+-++.+.....|+++++||+|.+..+.          
T Consensus       553 Ftn-------------lRsrgsslC~~aIlvvdImhGlepqtiESi~lLR~rktpFivALNKiDRLYgwk~~p~~~i~~~  619 (1064)
T KOG1144         553 FTN-------------LRSRGSSLCDLAILVVDIMHGLEPQTIESINLLRMRKTPFIVALNKIDRLYGWKSCPNAPIVEA  619 (1064)
T ss_pred             HHH-------------HHHCCCCCCCEEEEEEEHHCCCCCCHHHHHHHHHHCCCCEEEEEHHHHHHCCCCCCCCCHHHHH
T ss_conf             555-------------6650433455377785311167742067899887548975986101344404424898319999


Q ss_pred             -----------HHHHHHHHHHHHHHC------C------CCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             -----------899999999997531------3------689868999888889989999999987
Q gi|254780484|r  167 -----------AQETLEKTKYLIRNY------P------TAHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       167 -----------~~~~~~~~~~~~~~~------~------~~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                                 -...++.+...+.+.      +      .....++|+||.+|+||-.|.-.|.+.
T Consensus       620 lkkQ~k~v~~EF~~R~~~ii~efaEQgLN~~LyykNk~~~~~vsiVPTSA~sGeGipdLl~llv~l  685 (1064)
T KOG1144         620 LKKQKKDVQNEFKERLNNIIVEFAEQGLNAELYYKNKEMGETVSIVPTSAISGEGIPDLLLLLVQL  685 (1064)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHEEECCCCCCEEEEEECCCCCCCCHHHHHHHHHHH
T ss_conf             987447899999999999999999711044342314674655886212213678807899999999


No 224
>PRK12740 elongation factor G; Reviewed
Probab=99.31  E-value=4.5e-11  Score=82.81  Aligned_cols=115  Identities=13%  Similarity=0.203  Sum_probs=80.7

Q ss_pred             ECCCCCCHHHHHHHHHCCC----CEEEECCCCCEE------EECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHH
Q ss_conf             7489988989999973897----379873888414------521202665556785089649999760010111224478
Q gi|254780484|r   35 SGRSNVGKSSLINILVNRK----NLARTSNAPGRT------QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNV  104 (212)
Q Consensus        35 vG~~NvGKSSLiNaL~g~~----~~a~~~~~p~tt------~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~  104 (212)
                      +|+..+|||||.-+|.-..    ....+....+.+      +..+.+.........+.+..+.++||||+-.+..     
T Consensus         1 iaHvd~GKTTL~e~lL~~sg~i~~~G~v~~g~t~~D~~~~E~eRgITI~ss~~s~~~~~~~iNlIDTPGHvDF~~-----   75 (670)
T PRK12740          1 VGHSGAGKTTLTEAILFYTGAIHRIGEVEDGTTTMDFMPEERERGISIQSAATTCEWKGHKINIIDTPGHVDFTG-----   75 (670)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEEEEEEEEEECCEEEEEEECCCCCCHHH-----
T ss_conf             989988888999999996599875761438971467809999739973221388988998999992979751489-----


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             9888899877776642000001122357887545455432102575322122221111
Q gi|254780484|r  105 DSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL  162 (212)
Q Consensus       105 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~  162 (212)
                              .........+.++.+.|+..+...+...........++|.++++||+|..
T Consensus        76 --------EV~~aLrv~DgAvlvVDaveGV~~qT~~v~r~a~~~~lp~ilvINKiDr~  125 (670)
T PRK12740         76 --------EVERALRVLDGAVVVVCAVGGVEVQTETVWRYAEEYGVPRIAFVNKLDRA  125 (670)
T ss_pred             --------HHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             --------99999998686899997899973789999999998799969999797899


No 225
>KOG0461 consensus
Probab=99.30  E-value=5.1e-11  Score=82.47  Aligned_cols=168  Identities=18%  Similarity=0.226  Sum_probs=107.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEE--------ECCCEEEEEECCHHHHHHHHH
Q ss_conf             689997489988989999973897379873888414521202665556785--------089649999760010111224
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK--------NNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~--------~~~~~~~~~DtpG~~~~~~~~  101 (212)
                      ..++|.|+..+||+||-.||..--..+.-+.-|..+..-++....-.....        ....++.++|.||+..     
T Consensus         8 ~N~GiLGHvDSGKTtLarals~~~STaAFDk~pqS~eRgiTLDLGFS~~~v~~parLpq~e~lq~tlvDCPGHas-----   82 (522)
T KOG0461           8 LNLGILGHVDSGKTTLARALSELGSTAAFDKHPQSTERGITLDLGFSTMTVLSPARLPQGEQLQFTLVDCPGHAS-----   82 (522)
T ss_pred             EEEEEEEECCCCHHHHHHHHHHHCCHHHHCCCCCCCCCCEEEEECCEEEECCCCCCCCCCCCCEEEEEECCCHHH-----
T ss_conf             244357402576489999998631403322487531046267412204413572337876641269971797088-----


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHH----HHHH
Q ss_conf             478988889987777664200000112235788754545543210257532212222111102468999999----9999
Q gi|254780484|r  102 KNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEK----TKYL  177 (212)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~----~~~~  177 (212)
                              +..-........+.-+.++|...+...+.-+..-.-...-...++++||+|.+...+++..+++    ++.-
T Consensus        83 --------LIRtiiggaqiiDlm~lviDv~kG~QtQtAEcLiig~~~c~klvvvinkid~lpE~qr~ski~k~~kk~~Kt  154 (522)
T KOG0461          83 --------LIRTIIGGAQIIDLMILVIDVQKGKQTQTAECLIIGELLCKKLVVVINKIDVLPENQRASKIEKSAKKVRKT  154 (522)
T ss_pred             --------HHHHHHCCHHHHEEEEEEEEHHCCCCCCCCHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             --------999997101200134678861017666521454437664462699995012265302456789999999977


Q ss_pred             HHHCCCC-CCCEEEEECCCC----CCHHHHHHHHHHHH
Q ss_conf             7531368-986899988888----99899999999872
Q gi|254780484|r  178 IRNYPTA-HPEVIPTSSVKR----KGIEVLRKAILETI  210 (212)
Q Consensus       178 ~~~~~~~-~~~i~~vSA~~g----~Gi~eL~~~I~~~l  210 (212)
                      ++....+ ..|++++||..|    ++|.+|++.|.+.+
T Consensus       155 Le~t~f~g~~PI~~vsa~~G~~~~~~i~eL~e~l~s~i  192 (522)
T KOG0461         155 LESTGFDGNSPIVEVSAADGYFKEEMIQELKEALESRI  192 (522)
T ss_pred             HHHCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHH
T ss_conf             87457688885267643787540667899999999762


No 226
>PRK13768 GTPase; Provisional
Probab=99.29  E-value=1.1e-11  Score=86.33  Aligned_cols=176  Identities=20%  Similarity=0.120  Sum_probs=95.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHC-----CCCEEEECCCCCEEEECCEEEEEE------------------------------
Q ss_conf             899974899889899999738-----973798738884145212026655------------------------------
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVN-----RKNLARTSNAPGRTQHLNFFVPKD------------------------------   75 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g-----~~~~a~~~~~p~tt~~~~~~~~~~------------------------------   75 (212)
                      -+.++|.+++||||+++++..     .+..+.+.-.|.....+=......                              
T Consensus         4 ~~~ViGpaGSGKsT~~~~l~~~l~~~~r~~~vvNLDPA~e~~pY~~~iDIRd~i~~~dVM~~~~LGPNGali~~~e~l~~   83 (253)
T PRK13768          4 IVFFLGTAGSGKTTLVGALSDWLEEQGYDVAIVNLDPAVEYLPYKPDIDVREYVSAREIMRKYGLGPNGALIASVDLLLT   83 (253)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHHCCHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             89998999998899999999999976997599978986658999988637861789999988198964689999999999


Q ss_pred             -----EEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC-----CHHHHHHHHHH
Q ss_conf             -----56785089649999760010111224478988889987777664200000112235788-----75454554321
Q gi|254780484|r   76 -----FSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGV-----KQIDQDVFSFL  145 (212)
Q Consensus        76 -----~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~  145 (212)
                           .......+..+.++||||....=........   ........ ... ...+..|...-.     ...........
T Consensus        84 ~~d~l~~~i~~~~~dY~i~D~PGQiElft~~~~~~~---i~~~L~~~-~~~-~~v~l~D~~~~~~~~~fiS~~L~a~s~m  158 (253)
T PRK13768         84 KAEEIKEEIERLDADYVLVDTPGQMELFAFRESGRY---LVEKLSSG-SKS-LSVYLIDAVLAKDPSDFVSLLLLALSVQ  158 (253)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCEEEEECCHHHHH---HHHHHHCC-CCE-EEEEEECHHHHCCHHHHHHHHHHHHHHH
T ss_conf             899999998515887599826874432223407999---99998636-862-8999845056378879999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHH------------------------HHHHHHCCCCCCCEEEEECCCCCCHHH
Q ss_conf             02575322122221111024689999999------------------------999753136898689998888899899
Q gi|254780484|r  146 DKKAVSYQIVLTKIDKLSPTTAQETLEKT------------------------KYLIRNYPTAHPEVIPTSSVKRKGIEV  201 (212)
Q Consensus       146 ~~~~~~~~~v~nK~D~~~~~~~~~~~~~~------------------------~~~~~~~~~~~~~i~~vSA~~g~Gi~e  201 (212)
                      .....|.+.|+||+|++.++..++..++.                        -..+.+ ......++|+||++|+|+++
T Consensus       159 ~~l~lP~inVlsK~Dll~~~~~~~i~~~~~D~~~l~~~l~~~~~~~~~l~~~l~~~l~e-~~~~v~~ipvS~~~~eg~~~  237 (253)
T PRK13768        159 LRLGLPQIPVLNKIDLLSEEELERIRKWLEDPETLLEELKLDKGVQGDLAEELLSALEE-SGIPVRVIPVSAKTGEGFEE  237 (253)
T ss_pred             HHCCCCEEEEEEHHHCCCHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHH-HCCCCCEEEEECCCCCCHHH
T ss_conf             97399979986768627837799999986299999999850611589999999999998-46666527756898787999


Q ss_pred             HHHHHHHHHCC
Q ss_conf             99999987287
Q gi|254780484|r  202 LRKAILETINY  212 (212)
Q Consensus       202 L~~~I~~~l~~  212 (212)
                      |...|.+.+.|
T Consensus       238 l~~~I~~~~~~  248 (253)
T PRK13768        238 LYALLQEVFCG  248 (253)
T ss_pred             HHHHHHHHHCC
T ss_conf             99999999626


No 227
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily.  Rnd3/RhoE/Rho8 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd2/Rho7.  Rnd3/RhoE is known to bind the serine-threonine kinase ROCK I.  Unphosphorylated Rnd3/RhoE associates primarily with membranes, but ROCK I-phosphorylated Rnd3/RhoE localizes in the cytosol.  Phosphorylation of Rnd3/RhoE correlates with its activity in disrupting RhoA-induced stress fibers and inhibiting Ras-induced fibroblast transformation.  In cells that lack stress fibers, such as macrophages and monocytes, Rnd3/RhoE induces a redistribution of actin, causing morphological changes in the cell.  In addition, Rnd3/RhoE has been shown to inhibit cell cycle progression in G1 phase at a point upstream of the pRb family pocket protein checkpoint.  Rnd3/RhoE has also been shown to inhibit Ras- and Raf-induced fibroblast transformation.  In mammary epithelial tumor cells, Rnd3/RhoE regulates the assembly of the apical junction complex and tight
Probab=99.26  E-value=2.2e-11  Score=84.58  Aligned_cols=158  Identities=13%  Similarity=0.105  Sum_probs=81.8

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|-++||||||+++++.... . ..-.|+.  ...   .............+.++||+|.+.+........    
T Consensus         6 ~KivlvGd~~VGKTsLi~r~~~~~F-~-~~y~pTi--~~~---~~~~~~i~~~~v~l~iwDTaGqe~f~~l~~~~y----   74 (182)
T cd04172           6 CKIVVVGDSQCGKTALLHVFAKDCF-P-ENYVPTV--FEN---YTASFEIDTQRIELSLWDTSGSPYYDNVRPLSY----   74 (182)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCC-C-CCCCCEE--EEE---EEEEEEECCEEEEEEEEECCCCHHCCCCCHHHH----
T ss_conf             8999999999899999999983999-9-9868735--322---689999999999999996898620122125551----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHHHH--CCCCCCCCCCCCCCCCCCHHHHHH----------HHHHHH
Q ss_conf             998777766420000011223578--875454554321--025753221222211110246899----------999999
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHG--VKQIDQDVFSFL--DKKAVSYQIVLTKIDKLSPTTAQE----------TLEKTK  175 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~~~----------~~~~~~  175 (212)
                               ...+..+.+.+....  +...........  .....|++++.||+|+-.+.....          ..++-.
T Consensus        75 ---------~~~~~~ilvydit~~~Sf~~v~~~W~~ei~~~~~~~~iiLVGnK~DLr~~~~~~~~l~~~~~~~Vs~eeg~  145 (182)
T cd04172          75 ---------PDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDLTTLVELSNHRQTPVSYDQGA  145 (182)
T ss_pred             ---------CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHH
T ss_conf             ---------27878999964897788999999999999986879988999617101244145667764567786999999


Q ss_pred             HHHHHCCCCCCCEEEEECCCCC-CHHHHHHHHHHH
Q ss_conf             9975313689868999888889-989999999987
Q gi|254780484|r  176 YLIRNYPTAHPEVIPTSSVKRK-GIEVLRKAILET  209 (212)
Q Consensus       176 ~~~~~~~~~~~~i~~vSA~~g~-Gi~eL~~~I~~~  209 (212)
                      +....  .+-.+++.+||++|. |++++++...+.
T Consensus       146 ~~A~~--~g~~~y~EtSAk~~~n~V~e~F~~a~~a  178 (182)
T cd04172         146 NMAKQ--IGAATYIECSALQSENSVRDIFHVATLA  178 (182)
T ss_pred             HHHHH--CCCCEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             99997--6997999917078995989999999999


No 228
>TIGR00092 TIGR00092 GTP-binding protein YchF; InterPro: IPR004396 This is a family of conserved hypothetical proteins found in both prokaryotes and eukaryotes. While the function of these proteins is not known, the crystal structure of P44681 from SWISSPROT from Haemophilus influenzae has been determined . This protein consists of three domains: an N-terminal domain which has a mononucleotide binding fold typical for the P-loop NTPases, a central domain which forms an alpha-helical coiled coil, and a C-terminal domain composed of a six-stranded half-barrel curved around an alpha helix. The central and C-terminal domains are topologically similar to RNA-binding proteins, while the N-terminal region contains the features typical of GTP-dependent molecular switches. The purified protein was capable of binding both double-stranded nucleic acid and GTP. It was suggested, therefore, that this protein might be part of a nucleoprotein complex and could function as a GTP-dependent translation factor.; GO: 0005525 GTP binding.
Probab=99.25  E-value=3.1e-12  Score=89.45  Aligned_cols=76  Identities=24%  Similarity=0.235  Sum_probs=57.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEE------------CCCEEEEEECCHHHHH
Q ss_conf             6899974899889899999738973798738884145212026655567850------------8964999976001011
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN------------NLPAMALVDMPGYGYA   97 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~------------~~~~~~~~DtpG~~~~   97 (212)
                      ++=+|||-|||||||||||||..+ ++.-.++|+.|-.++...+......-.            -.+++.++|.+|+-.-
T Consensus         3 l~aGIVGLpNVGKSTlF~AiT~~~-~ge~ANYPFaTIePn~g~V~vpd~RLd~La~i~k~~k~evptt~~fvDIAGLvkG   81 (390)
T TIGR00092         3 LKAGIVGLPNVGKSTLFNAITNLQ-LGEAANYPFATIEPNTGVVNVPDPRLDKLAEIYKPEKVEVPTTLEFVDIAGLVKG   81 (390)
T ss_pred             CCCCCEECCCCCHHHHHHHHHHCC-CCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHCCCEEECCEEEEEEEECCCCCC
T ss_conf             876530068760557999998266-7776688876516764446258853334776406420411404899862234100


Q ss_pred             HHHHHHHHH
Q ss_conf             122447898
Q gi|254780484|r   98 RAPKKNVDS  106 (212)
Q Consensus        98 ~~~~~~~~~  106 (212)
                      ...++..+.
T Consensus        82 AS~GeGLGN   90 (390)
T TIGR00092        82 ASKGEGLGN   90 (390)
T ss_pred             CCCCCCCHH
T ss_conf             015787233


No 229
>cd01900 YchF YchF subfamily.  YchF is a member of the Obg family, which includes four other subfamilies of GTPases: Obg, DRG, Ygr210, and NOG1.  Obg is an essential gene that is involved in DNA replication in C. crescentus and Streptomyces griseus and is associated with the ribosome.  Several members of the family, including YchF, possess the TGS domain related to the RNA-binding proteins.  Experimental data and genomic analysis suggest that YchF may be part of a nucleoprotein complex and may function as a GTP-dependent translational factor.
Probab=99.24  E-value=7.9e-12  Score=87.13  Aligned_cols=66  Identities=27%  Similarity=0.240  Sum_probs=47.8

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEE-----------ECCCEEEEEECCHHHHHHH
Q ss_conf             9997489988989999973897379873888414521202665556785-----------0896499997600101112
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK-----------NNLPAMALVDMPGYGYARA   99 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~-----------~~~~~~~~~DtpG~~~~~~   99 (212)
                      |+|||.||||||||||+||+.+  +...++|++|..++.....+.....           .-...+.++|.||+.....
T Consensus         1 ~GivGlpnvGKstlFnalT~~~--~~~~nypf~ti~pn~g~v~VpD~Rl~~L~~~~~p~k~i~a~vefvDIaGLvkgAs   77 (274)
T cd01900           1 IGIVGLPNVGKSTLFNALTKAG--AEAANYPFCTIEPNVGIVPVPDERLDKLAEIVKPKKIVPATIEFVDIAGLVKGAS   77 (274)
T ss_pred             CCEECCCCCCHHHHHHHHHCCC--CCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCC
T ss_conf             9564789998899999997799--8745899777268058996775658899873177651235789985465567752


No 230
>pfam03308 ArgK ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems.
Probab=99.23  E-value=1.5e-10  Score=79.84  Aligned_cols=67  Identities=24%  Similarity=0.263  Sum_probs=44.3

Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH-CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
Q ss_conf             02575322122221111024689999999999753-13689868999888889989999999987287
Q gi|254780484|r  146 DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN-YPTAHPEVIPTSSVKRKGIEVLRKAILETINY  212 (212)
Q Consensus       146 ~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~-~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~~  212 (212)
                      .-..+.-++++||+|.-..+.....+.....+... ...+.++++.+||.+|+|+++|++.|.++.+|
T Consensus       164 GImEiaDi~vVNKaD~~~A~~~~~~l~~~l~l~~~~~~~W~p~Vl~tSA~~g~Gi~el~~~I~~~~~~  231 (267)
T pfam03308       164 GLMEIADIYVVNKADLPGAERTARELRSALHLLTPKEAGWRPPVLTTSAVTGEGIDELWDAIEEHREF  231 (267)
T ss_pred             HHHHHCCEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             37653548999667647699999999999851798778999998998747889999999999999999


No 231
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=99.23  E-value=3.3e-11  Score=83.53  Aligned_cols=151  Identities=18%  Similarity=0.232  Sum_probs=87.2

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99974899889899999738973798738884145212026655567850896499997600101112244789888899
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLI  111 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~  111 (212)
                      |.++|-.|+|||||+++|.+... ..  ..||.    ++    ....+......+.+.|.+|....+      ..+..  
T Consensus         2 ililGLd~aGKTTil~~l~~~~~-~~--~~PT~----G~----~~~~~~~~~~~l~~~DlgG~~~~R------~lW~~--   62 (167)
T cd04161           2 LLTVGLDNAGKTTLVSALQGEIP-KK--VAPTV----GF----TPTKLRLDKYEVCIFDLGGGANFR------GIWVN--   62 (167)
T ss_pred             EEEEEECCCCHHHHHHHHCCCCC-CC--CCCCC----CC----CEEEEEECCEEEEEEECCCCHHHH------HHHHH--
T ss_conf             89990089988999999828998-76--50877----73----179999899999999899877888------99998--


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCHHH--HH---HHHHHCCCCCCCCCCCCCCCCCCH---HHHHHHHHHHHHHHHHCCC
Q ss_conf             877776642000001122357887545--45---543210257532212222111102---4689999999999753136
Q gi|254780484|r  112 VRYLSERSTLRCVYLLIDCRHGVKQID--QD---VFSFLDKKAVSYQIVLTKIDKLSP---TTAQETLEKTKYLIRNYPT  183 (212)
Q Consensus       112 ~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~---~~~~~~~~~~~~~~v~nK~D~~~~---~~~~~~~~~~~~~~~~~~~  183 (212)
                      +     ......+++++|..+..+-.+  .+   ........+.|++++.||.|+-..   .++.+.+. +.+.. ....
T Consensus        63 Y-----~~~~~gIIfVVDssD~~rl~eak~~L~~lL~~~~l~~~PiLIlaNKqDl~~a~~~~ei~~~L~-L~~l~-~~~~  135 (167)
T cd04161          63 Y-----YAEAHGLVFVVDSSDDDRVQEVKEILRELLQHPRVSGKPILVLANKQDKKNALLGADVIEYLS-LEKLV-NENK  135 (167)
T ss_pred             H-----CCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEECCCCCCCCCHHHHHHHHC-CHHHC-CCCC
T ss_conf             7-----347765799985575889999999999996588778995999988657615899999998819-74240-8998


Q ss_pred             CCCCEEEEECCCCCC------HHHHHHHHHH
Q ss_conf             898689998888899------8999999998
Q gi|254780484|r  184 AHPEVIPTSSVKRKG------IEVLRKAILE  208 (212)
Q Consensus       184 ~~~~i~~vSA~~g~G------i~eL~~~I~~  208 (212)
                      ..-.+.++||.+|+|      +++=.++|..
T Consensus       136 ~~~~I~~csA~tG~G~~~~~~l~eGl~WL~~  166 (167)
T cd04161         136 SLCHIEPCSAIEGLGKKIDPSIVEGLRWLLA  166 (167)
T ss_pred             CEEEEEECEEECCCCCCCCCCHHHHHHHHHC
T ss_conf             6379995764448887876631549989864


No 232
>KOG0094 consensus
Probab=99.22  E-value=1.2e-10  Score=80.44  Aligned_cols=159  Identities=19%  Similarity=0.191  Sum_probs=89.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      -+|.++|-.+|||+||+++++-.+.  .. ++.- |  ++.-..............+.++||+|.++++...        
T Consensus        23 ~KlVflGdqsVGKTslItRf~yd~f--d~-~YqA-T--IGiDFlskt~~l~d~~vrLQlWDTAGQERFrsli--------   88 (221)
T KOG0094          23 YKLVFLGDQSVGKTSLITRFMYDKF--DN-TYQA-T--IGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLI--------   88 (221)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHH--CC-CCCC-E--EEEEEEEEEEEECCCEEEEEEEECCCHHHHHHHH--------
T ss_conf             7899986676544788889987630--46-4565-4--6567778889973817899987544678775310--------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHH---HHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             9987777664200000112235788754545543---2102575322122221111024689999999999753136898
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS---FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP  186 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (212)
                        -.+.....+.+.+..+.+ ...+......+.+   .-......+.+|.||.|++++.+......+  ...+++   +.
T Consensus        89 --psY~Rds~vaviVyDit~-~~Sfe~t~kWi~dv~~e~gs~~viI~LVGnKtDL~dkrqvs~eEg~--~kAkel---~a  160 (221)
T KOG0094          89 --PSYIRDSSVAVIVYDITD-RNSFENTSKWIEDVRRERGSDDVIIFLVGNKTDLSDKRQVSIEEGE--RKAKEL---NA  160 (221)
T ss_pred             --HHHCCCCEEEEEEEECCC-CCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCHHHHHHHHHH--HHHHHH---CC
T ss_conf             --555038737999996356-4017769999999986068886599997163124446565388789--889872---95


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             689998888899899999999872
Q gi|254780484|r  187 EVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       187 ~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .++.+||+.|.|+.+|+..|...|
T Consensus       161 ~f~etsak~g~NVk~lFrrIaa~l  184 (221)
T KOG0094         161 EFIETSAKAGENVKQLFRRIAAAL  184 (221)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHC
T ss_conf             899830447998899999999866


No 233
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=99.22  E-value=4.8e-11  Score=82.63  Aligned_cols=157  Identities=20%  Similarity=0.226  Sum_probs=84.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCE-----EEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737-----9873888414521202665556785089649999760010111224478
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNL-----ARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNV  104 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~-----a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~  104 (212)
                      .+|+++|.+|||||||+|+|.+....     ..+...+.++...      .     .....+.++||+|.......... 
T Consensus         6 ~kivv~G~~g~GKTtl~~~l~~~~~~~~~~~t~~~~~~~~~~~~------~-----~~~~~~~~~Dt~gq~~~~~~~~~-   73 (219)
T COG1100           6 FKIVVLGDGGVGKTTLLNRLVGDEFPEGYPPTIGNLDPAKTIEP------Y-----RRNIKLQLWDTAGQEEYRSLRPE-   73 (219)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCEEECCCCCEEEC------C-----CCCEEEEEEECCCHHHHHHHHHH-
T ss_conf             79999999999889999999647676556761454043203622------6-----66002676767986999998875-


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCC--CCCHHHHHHHHHHCC---CCCCCCCCCCCCCCCCHHHHHHHHH-------
Q ss_conf             9888899877776642000001122357--887545455432102---5753221222211110246899999-------
Q gi|254780484|r  105 DSWGGLIVRYLSERSTLRCVYLLIDCRH--GVKQIDQDVFSFLDK---KAVSYQIVLTKIDKLSPTTAQETLE-------  172 (212)
Q Consensus       105 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~---~~~~~~~v~nK~D~~~~~~~~~~~~-------  172 (212)
                               +.   ......+.+.+...  ............+..   ...|++++.||+|+.........+.       
T Consensus        74 ---------y~---~~~~~~l~~~d~~~~~~~~~~~~~~~~~l~~~~~~~~~iilv~nK~Dl~~~~~~~~~~~~~~~~~~  141 (219)
T COG1100          74 ---------YY---RGANGILIVYDSTLRESSDELTEEWLEELRELAPDDVPILLVGNKIDLFDEQSSSEEILNQLNREV  141 (219)
T ss_pred             ---------CC---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCC
T ss_conf             ---------04---389789999976205657889999999998746688679996976105543013678877532453


Q ss_pred             ---HHHHHHHHCCCCCCCEEEEECC--CCCCHHHHHHHHHHHH
Q ss_conf             ---9999975313689868999888--8899899999999872
Q gi|254780484|r  173 ---KTKYLIRNYPTAHPEVIPTSSV--KRKGIEVLRKAILETI  210 (212)
Q Consensus       173 ---~~~~~~~~~~~~~~~i~~vSA~--~g~Gi~eL~~~I~~~l  210 (212)
                         ...............++.+||+  .+.|++++.+.+...+
T Consensus       142 ~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~v~~~~~~~~~~~  184 (219)
T COG1100         142 VLLVLAPKAVLPEVANPALLETSAKSLTGPNVNELFKELLRKL  184 (219)
T ss_pred             EEHHHHHHHHHHHHHHHHHHEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             0002223444233200044324210167878789999999999


No 234
>PRK09435 arginine/ornithine transport system ATPase; Provisional
Probab=99.21  E-value=1.5e-10  Score=79.74  Aligned_cols=66  Identities=24%  Similarity=0.278  Sum_probs=44.5

Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH----CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
Q ss_conf             2575322122221111024689999999999753----13689868999888889989999999987287
Q gi|254780484|r  147 KKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN----YPTAHPEVIPTSSVKRKGIEVLRKAILETINY  212 (212)
Q Consensus       147 ~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~----~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~~  212 (212)
                      -..+.-++++||+|.-..........+++..+..    ...+.++++.+||.+|.||++|++.|.++..|
T Consensus       185 ImEiaDi~vVNKaDgd~~~~A~~t~~e~~~aL~l~~~~~~~W~ppVl~~SA~~g~GI~eL~~~I~~h~~~  254 (325)
T PRK09435        185 IMELADLIVINKADGDNHTAARRAAAEYRSALRLLRPKDPGWQPPVLTCSALEGEGIDELWQAIEDHRAA  254 (325)
T ss_pred             HHHHCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             7750426899776755658999999999999860788789999998999815899879999999999999


No 235
>KOG0078 consensus
Probab=99.21  E-value=2.7e-10  Score=78.32  Aligned_cols=162  Identities=17%  Similarity=0.100  Sum_probs=92.5

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHH
Q ss_conf             87668689997489988989999973897379873888414521202665556785089649999760010111224478
Q gi|254780484|r   25 PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNV  104 (212)
Q Consensus        25 P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~  104 (212)
                      |-+.+.+|.++|.++||||+|+-.+.....   ...... |....  .-............+.++||+|.++........
T Consensus         8 ~~d~~~kvlliGDs~vGKt~~l~rf~d~~f---~~~~~s-TiGID--Fk~kti~l~g~~i~lQiWDtaGQerf~ti~~sY   81 (207)
T KOG0078           8 DYDYLFKLLLIGDSGVGKTCLLLRFSDDSF---NTSFIS-TIGID--FKIKTIELDGKKIKLQIWDTAGQERFRTITTAY   81 (207)
T ss_pred             CCCEEEEEEEECCCCCCHHHHHHHHHHCCC---CCCCCC-EEEEE--EEEEEEEECCEEEEEEEEECCCCHHHHHHHHHH
T ss_conf             845189999977898765576665440667---677651-58788--788899838908999999724305678899999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCC--CCHH--HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             98888998777766420000011223578--8754--5455432102575322122221111024689999999999753
Q gi|254780484|r  105 DSWGGLIVRYLSERSTLRCVYLLIDCRHG--VKQI--DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN  180 (212)
Q Consensus       105 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~--~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~  180 (212)
                      .             .-+..++.+.|....  +...  .....+.......+.++|.||+|+-.+..+..  +.-+.+..+
T Consensus        82 y-------------rgA~gi~LvyDitne~Sfeni~~W~~~I~e~a~~~v~~~LvGNK~D~~~~R~V~~--e~ge~lA~e  146 (207)
T KOG0078          82 Y-------------RGAMGILLVYDITNEKSFENIRNWIKNIDEHASDDVVKILVGNKCDLEEKRQVSK--ERGEALARE  146 (207)
T ss_pred             H-------------HHCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCH--HHHHHHHHH
T ss_conf             8-------------6548249999845257777799999999863788874898511412101333567--999999998


Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             136898689998888899899999999872
Q gi|254780484|r  181 YPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       181 ~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +   +..++.+||++|.||++..-.|...+
T Consensus       147 ~---G~~F~EtSAk~~~NI~eaF~~La~~i  173 (207)
T KOG0078         147 Y---GIKFFETSAKTNFNIEEAFLSLARDI  173 (207)
T ss_pred             H---CCEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             4---98279713367998899999999999


No 236
>pfam04548 AIG1 AIG1 family. Arabidopsis protein AIG1 appears to be involved in plant resistance to bacteria.
Probab=99.20  E-value=1.6e-10  Score=79.63  Aligned_cols=163  Identities=17%  Similarity=0.205  Sum_probs=92.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|.++|++++||||-.|+|+|++...........|..      .........+..+.++||||+............ ..
T Consensus         1 LrivLlGktG~GKSstgNtILG~~~F~s~~~~~~vT~~------c~~~~~~~~gr~v~ViDTPgl~~~~~~~~~~~~-ei   73 (200)
T pfam04548         1 LRIVLVGKTGNGKSATGNSILGRKAFESKLRAQGVTKT------CQLVSRTWDGRIINVIDTPGLFDLSVSNDFISK-EI   73 (200)
T ss_pred             CEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCCEE------EEEEEEEECCEEEEEEECCCCCCCCCCHHHHHH-HH
T ss_conf             98999799998436557661797533578988887413------689999989968999978663576778699999-99


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHC----CC-CCCCCCCCCCCCCCCHHHHHHHHHH-----HHHHHH
Q ss_conf             9987777664200000112235788754545543210----25-7532212222111102468999999-----999975
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLD----KK-AVSYQIVLTKIDKLSPTTAQETLEK-----TKYLIR  179 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~-~~~~~~v~nK~D~~~~~~~~~~~~~-----~~~~~~  179 (212)
                      ..... ....-..+.+++.... .+.+.+....+.+.    .. -...+++++..|.+....++..+..     ++..+.
T Consensus        74 ~~~~~-l~~pGpHa~LLVi~~~-rfT~ee~~~v~~i~~~FGe~~~~~tIVLFT~~D~L~~~si~~~i~~~~~~~Lq~li~  151 (200)
T pfam04548        74 IRCLL-LAEPGPHAVLLVLSLG-RFTEEEEQALRTLQELFGSKILDYMIVVFTRKDDLEDDSLDDYLSDGCPEFLKEVLR  151 (200)
T ss_pred             HHHHH-HCCCCCCEEEEEEECC-CCCHHHHHHHHHHHHHHHHHHHHHEEEEEECHHHCCCCCHHHHHHHCCHHHHHHHHH
T ss_conf             99998-5589985799998668-888899999999999975786800999997802149997999987227399999998


Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             3136898689998888899899999999872
Q gi|254780484|r  180 NYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       180 ~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ..   .      ...+...+.+|.++|.+.+
T Consensus       152 ~~---~------~~~~~~QV~eLL~kIe~mv  173 (200)
T pfam04548       152 TA---D------GEEKEEQVQQLLALVEAIV  173 (200)
T ss_pred             HC---C------CCCCHHHHHHHHHHHHHHH
T ss_conf             77---8------8545799999999999999


No 237
>COG2229 Predicted GTPase [General function prediction only]
Probab=99.20  E-value=8e-10  Score=75.59  Aligned_cols=163  Identities=15%  Similarity=0.212  Sum_probs=102.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEEC---CCCCEEEECCEEEEEEEEEEE-ECCCEEEEEECCHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873---888414521202665556785-08964999976001011122447
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTS---NAPGRTQHLNFFVPKDFSNLK-NNLPAMALVDMPGYGYARAPKKN  103 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~---~~p~tt~~~~~~~~~~~~~~~-~~~~~~~~~DtpG~~~~~~~~~~  103 (212)
                      ..++|++.|.-++||+|++.+++.+...+...   ...+... ...+.....+... .++..+.+++|||+.+.+..-+.
T Consensus         9 ~~~KIvv~G~~~agKtTfv~~~s~k~~v~t~~~~~~~s~k~k-r~tTva~D~g~~~~~~~~~v~LfgtPGq~RF~fm~~~   87 (187)
T COG2229           9 IETKIVVIGPVGAGKTTFVRALSDKPLVITEADASSVSGKGK-RPTTVAMDFGSIELDEDTGVHLFGTPGQERFKFMWEI   87 (187)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHCCCCCEEECCCCCCCCCCC-CCEEEEECCCCEEECCCCEEEEECCCCCHHHHHHHHH
T ss_conf             010699984436640667887653456201033555544664-5506863241137758616899658970778989998


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCC-CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             8988889987777664200000112235788754545543210257-532212222111102468999999999975313
Q gi|254780484|r  104 VDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA-VSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP  182 (212)
Q Consensus       104 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~  182 (212)
                                ..   .-....++..|+..........+.++..... +|+++.+||.|+-+..-.++..+.+...     
T Consensus        88 ----------l~---~ga~gaivlVDss~~~~~~a~~ii~f~~~~~~ip~vVa~NK~DL~~a~ppe~i~e~l~~~-----  149 (187)
T COG2229          88 ----------LS---RGAVGAIVLVDSSRPITFHAEEIIDFLTSRNPIPVVVAINKQDLFDALPPEKIREALKLE-----  149 (187)
T ss_pred             ----------HH---CCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHHHHHC-----
T ss_conf             ----------74---876428999956999646789999988520688789995042257789989999999711-----


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             689868999888889989999999987
Q gi|254780484|r  183 TAHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       183 ~~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      ....+++.++|..++|..+..+.+...
T Consensus       150 ~~~~~vi~~~a~e~~~~~~~L~~ll~~  176 (187)
T COG2229         150 LLSVPVIEIDATEGEGARDQLDVLLLK  176 (187)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHH
T ss_conf             279864434424634178999998730


No 238
>TIGR00436 era GTP-binding protein Era; InterPro: IPR005662   Era is an essential G-protein in Escherichia coli identified originally as a homologue protein to Ras (E. coli Ras-like protein). It binds to GTP/GDP and contains a low intrinsic GTPase activity. Its function remains elusive, although it may be associated with cell division, energy metabolism, and cell-cycle check point. The protein has recently been shown to specifically bind to 16S rRNA and the 30S ribosomal subunit . Involvement of Era in protein synthesis is suggested by the fact that Era depletion results in the translation defect both in vitro and in vivo. A Type 2 KH domain is found near the C-terminus. ; GO: 0003723 RNA binding, 0005525 GTP binding, 0005622 intracellular.
Probab=99.18  E-value=2.4e-10  Score=78.66  Aligned_cols=166  Identities=22%  Similarity=0.258  Sum_probs=116.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCE-EEEEECCHHHHH-HHHHHHHHHHH
Q ss_conf             8999748998898999997389737987388841452120266555678508964-999976001011-12244789888
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPA-MALVDMPGYGYA-RAPKKNVDSWG  108 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~-~~~~DtpG~~~~-~~~~~~~~~~~  108 (212)
                      .++++|+||+|||||+|.+.|++. +.+++.+.+++.      ...+........ ..++|+||+... .......    
T Consensus         2 ~~~~~g~~~~g~~~~~~~~~~~~~-~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~d~pg~~~~~~~~~~~~----   70 (278)
T TIGR00436         2 FVAILGRPNVGKSTLLNKLLGQKI-SITSPKPQTTRN------RISGILTTGASQNIIFIDTPGFHEPEKHKLGEL----   70 (278)
T ss_pred             CEEECCCCCCCHHHHHHHHHCCCH-HCCCCCCHHHHH------HHHEEEECCCCCCEEEEECCCCCCHHHHHHHHH----
T ss_conf             112115776533667776632410-100231012343------320012236655157862587651245677888----


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC-CHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             899877776642000001122357887545455432102575322122221111-0246899999999997531368986
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL-SPTTAQETLEKTKYLIRNYPTAHPE  187 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~-~~~~~~~~~~~~~~~~~~~~~~~~~  187 (212)
                       ................+..+........+......+.....|.....++.|.. .+.............   ......+
T Consensus        71 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~  146 (278)
T TIGR00436        71 -LNKEARSALGGVDLLLFVVDSDEWNGDGDEFLLEKLQNLKRPVLLTLNKLDNKNFPDKLLPLLDKYAGL---EDFKPWP  146 (278)
T ss_pred             -HHHHHHHHHCCCEEEEEEEECCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHH---HCCCCCC
T ss_conf             -888887531232268898633445564046889876520210100122333101035677777666554---2046752


Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             899988888998999999998728
Q gi|254780484|r  188 VIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       188 i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      ++++|+.++.+.+.+...+...+.
T Consensus       147 ~~~~~~~~~~~~~~~~~~~~~~~~  170 (278)
T TIGR00436       147 IVPISALKGDNTEELKAFLEAKLP  170 (278)
T ss_pred             EEEHHHHHHCHHHHHHHHHHHHCC
T ss_conf             011011210005778888775303


No 239
>cd01873 RhoBTB RhoBTB subfamily.  Members of the RhoBTB subfamily of Rho GTPases are present in vertebrates, Drosophila, and Dictyostelium.  RhoBTB proteins are characterized by a modular organization, consisting of a GTPase domain, a proline rich region, a tandem of two BTB (Broad-Complex, Tramtrack, and Bric a brac) domains, and a C-terminal region of unknown function.  RhoBTB proteins may act as docking points for multiple components participating in signal transduction cascades.  RhoBTB genes appeared upregulated in some cancer cell lines, suggesting a participation of RhoBTB proteins in the pathogenesis of particular tumors.  Note that the Dictyostelium RacA GTPase domain is more closely related to Rac proteins than to RhoBTB proteins, where RacA actually belongs.  Thus, the Dictyostelium RacA is not included here.  Most Rho proteins contain a lipid modification site at the C-terminus; however, RhoBTB is one of few Rho subfamilies that lack this feature.
Probab=99.17  E-value=8.5e-11  Score=81.19  Aligned_cols=161  Identities=16%  Similarity=0.125  Sum_probs=76.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEE----ECCCCCEEEECCEEEEE----EEE--EEEECCCEEEEEECCHHHHHHH
Q ss_conf             6899974899889899999738973798----73888414521202665----556--7850896499997600101112
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLAR----TSNAPGRTQHLNFFVPK----DFS--NLKNNLPAMALVDMPGYGYARA   99 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~----~~~~p~tt~~~~~~~~~----~~~--~~~~~~~~~~~~DtpG~~~~~~   99 (212)
                      .+|.+||-++||||||+.+....+....    ....|+.-. .......    ...  ........+.++||+|....  
T Consensus         3 ~KiVlvGDs~VGKTsLl~~~~~n~~~~~~~~~~~~~pTv~~-~~~~~~~~~~~~~~~~~vdg~~v~L~iWDTAG~~~~--   79 (195)
T cd01873           3 IKCVVVGDNAVGKTRLICARACNKTLTQYQLLATHVPTVWA-IDQYRVCQEVLERSRDVVDGVSVSLRLWDTFGDHDK--   79 (195)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCC-CCCCEEEEEECCCCEEEECCEEEEEEEEECCCCHHH--
T ss_conf             79999878998989999778747876556566675886633-333134444302211421895999999978996200--


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC--CCCHHHHHHHHHH--CCCCCCCCCCCCCCCCCCHHHHH-------
Q ss_conf             244789888899877776642000001122357--8875454554321--02575322122221111024689-------
Q gi|254780484|r  100 PKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH--GVKQIDQDVFSFL--DKKAVSYQIVLTKIDKLSPTTAQ-------  168 (212)
Q Consensus       100 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~~-------  168 (212)
                         ..    ...  +.    .....+.+.+...  .+..........+  .....|+++|.||+|+-......       
T Consensus        80 ---~r----~~~--y~----~~~~~ll~fdv~~~~Sf~~v~~~W~~ei~~~~~~~piiLVG~K~DLr~~~~~~~~~~~~~  146 (195)
T cd01873          80 ---DR----RFA--YG----RSDVVLLCFSIASPNSLRNVKTMWYPEIRHFCPRVPVILVGCKLDLRYADLDEVNRARRP  146 (195)
T ss_pred             ---CC----CCC--CC----CCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHCCCCCHHHHHHHHC
T ss_conf             ---12----143--56----888999999669801489999999999998689998899963757544630245554300


Q ss_pred             ----------HHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             ----------99999999975313689868999888889989999999987
Q gi|254780484|r  169 ----------ETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       169 ----------~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                                ...++-+...++.   +.+++.+||++|+||+++.+.+.+.
T Consensus       147 ~~~~~~~~~~v~~ee~~~~A~~~---g~~y~EtSAkt~~gV~e~F~~air~  194 (195)
T cd01873         147 LARPIKNADILPPETGRAVAKEL---GIPYYETSVVTQFGVKDVFDNAIRA  194 (195)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHH---CCEEEECCCCCCCCHHHHHHHHHHH
T ss_conf             13655435767899999999982---9989982848798979999999982


No 240
>cd01855 YqeH YqeH.  YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts.  Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.
Probab=99.16  E-value=4.1e-11  Score=82.99  Aligned_cols=55  Identities=38%  Similarity=0.503  Sum_probs=38.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCC-------CEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHH
Q ss_conf             89997489988989999973897-------37987388841452120266555678508964999976001
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRK-------NLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGY   94 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~-------~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~   94 (212)
                      .|.+||.||||||||||+|....       ..+.++..||||.......        . .....+.||||+
T Consensus       129 ~vyvvG~~NvGKSTLiN~Ll~~~~~~~~~~~~~t~S~~PGTTl~~i~~~--------l-~~~~~l~DtPGi  190 (190)
T cd01855         129 DVYVVGATNVGKSTLINALLKKDNGKKKLKDLLTTSPIPGTTLDLIKIP--------L-GNGKKLYDTPGI  190 (190)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCCEEEE--------C-CCCCEEEECCCC
T ss_conf             5799805875467999998630234434566406679997316525897--------3-999999959599


No 241
>TIGR00487 IF-2 translation initiation factor IF-2; InterPro: IPR000178 Initiation factor 2 (IF-2) (gene infB)  is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-2 promotes the GTP-dependent binding of the initiator tRNA to the small subunit of the ribosome. IF-2 is a protein of about 70 to 95 Kd which contains a central GTP-binding domain flanked by a highly variable N-terminal domain and a more conserved C-terminal domain. Bacterial IF-2 is structurally and functionally related to eukaryotic mitochondrial IF-2 (IF-2(mt))  as well as to algal and plants chloroplast IF-2 (IF-2(chl)). Both IF-2(mt) and IF-2(chl) are encoded by nuclear genes and are produced as precursor proteins with a transit peptide. An exception are red algae where IF-2(chl) is encoded by the plastid genome .; GO: 0003743 translation initiation factor activity, 0005525 GTP binding, 0006413 translational initiation, 0005622 intracellular.
Probab=99.16  E-value=4.7e-10  Score=76.92  Aligned_cols=164  Identities=24%  Similarity=0.330  Sum_probs=119.5

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCE-EEEEECCHHHHHHHHHH
Q ss_conf             88766868999748998898999997389737987388841452120266555678508964-99997600101112244
Q gi|254780484|r   24 LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPA-MALVDMPGYGYARAPKK  102 (212)
Q Consensus        24 ~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~-~~~~DtpG~~~~~~~~~  102 (212)
                      .-...+|-|.++|+...||++|+..+-..+.  ......+.|...+.+.     ....+... +.+.||||+..+..   
T Consensus        85 ~~~~~pp~~~~~gh~dhg~~~ll~~~~~~~~--~~~~~gg~~~~~g~y~-----~~~~~~~~~~~f~d~pgh~~f~~---  154 (594)
T TIGR00487        85 LLVPRPPVVTIMGHVDHGKTSLLDSIRKTKV--AAGEAGGITQHIGAYH-----VEKEDGKKWITFLDTPGHEAFTL---  154 (594)
T ss_pred             HHHCCCCEEEEEECCCCCCHHHHHHHHHCCC--CCCCCCCCHHHCCEEE-----EEECCCCEEEEEECCCCHHHHHH---
T ss_conf             1102476368851235540345655541000--0111365201013045-----66428843799840775367787---


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC--HHHHHHHHHHHHHHHHH
Q ss_conf             7898888998777766420000011223578875454554321025753221222211110--24689999999999753
Q gi|254780484|r  103 NVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS--PTTAQETLEKTKYLIRN  180 (212)
Q Consensus       103 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~--~~~~~~~~~~~~~~~~~  180 (212)
                                +........+....+.....+...+..+..........|.++.+||+|+-.  ++.....+..+. ....
T Consensus       155 ----------~~~~g~~~~d~~~~~~~~~dg~~~~~~~~~~h~~~~~~p~~~~~n~~d~p~~~pd~~~~~~~~~g-~~~~  223 (594)
T TIGR00487       155 ----------MRARGAKVTDIVVLVVAADDGVKPQTIEAISHAKAANVPLIVAVNKIDKPEANPDRVKQELSEYG-LVPE  223 (594)
T ss_pred             ----------HHHCCCCEEEEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHCC-CCCH
T ss_conf             ----------76337610015799984155642356887653333077369986124676678778999987517-7501


Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             1368986899988888998999999998
Q gi|254780484|r  181 YPTAHPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       181 ~~~~~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      .|.+...++++||.+|.|+++|.+.+.-
T Consensus       224 ~wgg~~~~~~~~~~~g~g~~~l~~~~l~  251 (594)
T TIGR00487       224 DWGGDTIFVPVSALTGDGIDELLDAILL  251 (594)
T ss_pred             HCCCCEEEEEEECCCCCCHHHHHHHHHH
T ss_conf             1278346886200136765788888887


No 242
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1).  This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria.  The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2.  AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family.  The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections.  The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins).
Probab=99.13  E-value=2.9e-10  Score=78.13  Aligned_cols=172  Identities=13%  Similarity=0.156  Sum_probs=97.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|+++|++++||||.-|.|.|++...........|..      .........+..+.++||||+............ +.
T Consensus         1 LrIvLlGktGsGKSstgNtILG~~~F~s~~~~~svT~~------c~~~~~~~~gr~v~VIDTPg~~dt~~~~~~~~~-ei   73 (196)
T cd01852           1 LRLVLVGKTGAGKSATGNTILGREVFESKLSASSVTKT------CQKESAVWDGRRVNVIDTPGLFDTSVSPEQLSK-EI   73 (196)
T ss_pred             CEEEEECCCCCCCHHHHEEECCCCCCCCCCCCCCCCEE------EEEEEEEECCCEEEEEECCCCCCCCCCHHHHHH-HH
T ss_conf             98999789998615340325687666788999987558------888889988937999967763565589799999-99


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHH----HHCCC-CCCCCCCCCCCCCCCHHHHHHHHHHHHH-HHHHCCC
Q ss_conf             9987777664200000112235788754545543----21025-7532212222111102468999999999-9753136
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS----FLDKK-AVSYQIVLTKIDKLSPTTAQETLEKTKY-LIRNYPT  183 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~-~~~~~~v~nK~D~~~~~~~~~~~~~~~~-~~~~~~~  183 (212)
                      ...... ...-..+.+++.... .+.+.+....+    ..... ....+++++..|.+....+++.+..-.. +..-...
T Consensus        74 ~~~~~l-~~pGpHa~LLVi~~~-rfT~ee~~~v~~i~~~FGe~~~~~tivLFT~~D~L~~~sie~~i~~~~~~L~~li~k  151 (196)
T cd01852          74 VRCLSL-SAPGPHAFLLVVPLG-RFTEEEEQAVETLQELFGEKVLDHTIVLFTRGDDLEGGTLEDYLENSCEALKRLLEK  151 (196)
T ss_pred             HHHHHH-CCCCCEEEEEEEECC-CCCHHHHHHHHHHHHHHCHHHHHHEEEEEECCCCCCCCCHHHHHHHCCHHHHHHHHH
T ss_conf             999984-389973999999789-889899999999999977786852899996540116886999987346999999998


Q ss_pred             CCCCEEEEECC-----CCCCHHHHHHHHHHHH
Q ss_conf             89868999888-----8899899999999872
Q gi|254780484|r  184 AHPEVIPTSSV-----KRKGIEVLRKAILETI  210 (212)
Q Consensus       184 ~~~~i~~vSA~-----~g~Gi~eL~~~I~~~l  210 (212)
                      ++..++.+.-+     +...+.+|.+.|.+.+
T Consensus       152 Cg~Ry~~fnN~~~~~~~~~QV~eLl~kIe~mv  183 (196)
T cd01852         152 CGGRYVAFNNKAKGEEQEQQVKELLAKVESMV  183 (196)
T ss_pred             HCCEEEEEECCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             59989998678997513899999999999999


No 243
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily.  Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project.  It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2).  This is a novel subfamily identified in human cancers that is uncharacterized to date.
Probab=99.12  E-value=3.9e-10  Score=77.42  Aligned_cols=152  Identities=18%  Similarity=0.251  Sum_probs=86.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|.++|..|||||||+++|.+.+...  +..||..  .+      .......+..+.+.|++|....+.      .+...
T Consensus         1 kIlilGLd~aGKTTil~~l~~~~~~~--~~~PT~G--f~------~~~i~~~~~~l~~wDlgGq~~~R~------~W~~Y   64 (164)
T cd04162           1 QILVLGLDGAGKTSLLHSLSSERSLE--SVVPTTG--FN------SVAIPTQDAIMELLEIGGSQNLRK------YWKRY   64 (164)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCCCC--CCCCCCC--CC------EEEEEECCEEEEEEECCCHHHHHH------HHHHH
T ss_conf             99999679998999999981699876--5356327--74------699998999999985375288865------69987


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHH--HHHHHHH-CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC--CC
Q ss_conf             9877776642000001122357887545--4554321-02575322122221111024689999999999753136--89
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQID--QDVFSFL-DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT--AH  185 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~-~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~--~~  185 (212)
                             ......++++.|+.+..+-.+  .++...+ ...+.|.+++.||.|+-..-...    ++.+.+.....  ..
T Consensus        65 -------~~~~~gIIfVVDssD~~rl~eak~~L~~ll~~~~~~PlLIlaNKqDl~~a~s~~----ei~~~L~L~~i~~~r  133 (164)
T cd04162          65 -------LSGSQGLIFVVDSADSERLPLARQELHQLLQHPPDLPLVVLANKQDLPAARSVQ----EIHKELELEPIARGR  133 (164)
T ss_pred             -------HHCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHH----HHHHHCCCCCCCCCC
T ss_conf             -------117758999995688889999999999997087998699998632433699999----999866994637999


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             868999888889989999999987
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      .=.+..+|.+|.|+++-.+.|.+.
T Consensus       134 ~w~iq~~s~~g~gl~~~~~~l~~~  157 (164)
T cd04162         134 RWILQGTSLDDDGSPSRMEAVKDL  157 (164)
T ss_pred             CEEEEEECCCCCCCHHHHHHHHHH
T ss_conf             889971104799858999999999


No 244
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta).  SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane.  Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP.  SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane.  The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane.  SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon.  High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ
Probab=99.11  E-value=1.8e-09  Score=73.62  Aligned_cols=161  Identities=21%  Similarity=0.229  Sum_probs=84.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      |.|-|+|.+|+||+||++.|...+..     .+.++..++......  ........+.++|+||+...+..     ....
T Consensus         1 ptvLl~Gl~~aGKT~Lf~~L~~~~~~-----~T~tS~~~n~~~~~~--~~~~~~~~~~lvD~PGH~klR~~-----~~~~   68 (203)
T cd04105           1 PTVLLLGPSDSGKTALFTKLTTGKYR-----STVTSIEPNVATFIL--NSEGKGKKFRLVDVPGHPKLRDK-----LLET   68 (203)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCC-----CCCCCCCCCCEEEEC--CCCCCCCEEEEEECCCCHHHHHH-----HHHH
T ss_conf             95999907999899999999749988-----877888786206640--24668727999987996889999-----9999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCC---HHHHHHHHHH-----CCCCCCCCCCCCCCCCCC---HHHHHHHHHHHHHHH
Q ss_conf             99877776642000001122357887---5454554321-----025753221222211110---246899999999997
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVK---QIDQDVFSFL-----DKKAVSYQIVLTKIDKLS---PTTAQETLEKTKYLI  178 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~-----~~~~~~~~~v~nK~D~~~---~~~~~~~~~~~~~~~  178 (212)
                          +   ......+++++|+.....   ..-..+.+.+     .....|+++++||.|+..   ...+.+.++..-..+
T Consensus        69 ----~---~~~~~gIVfvVDs~~~~~~l~~~Ae~Ly~iL~~~~~~~~~iPvLIacNKqDl~tA~~~~~Ik~~LE~Ei~~l  141 (203)
T cd04105          69 ----L---KNSAKGIVFVVDSATFQKNLKDVAEFLYDILTDLEKVKNKIPVLIACNKQDLFTAKPAKKIKEQLEKELNTL  141 (203)
T ss_pred             ----H---HHCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             ----8---754989999996887511199999999999862664368998899986614345789999999999999999


Q ss_pred             HHC------------------------------CCCCCCEEEEECC-CCCCHHHHHHHHHHH
Q ss_conf             531------------------------------3689868999888-889989999999987
Q gi|254780484|r  179 RNY------------------------------PTAHPEVIPTSSV-KRKGIEVLRKAILET  209 (212)
Q Consensus       179 ~~~------------------------------~~~~~~i~~vSA~-~g~Gi~eL~~~I~~~  209 (212)
                      ...                              ......++..|++ .+.|++.+.++|.+.
T Consensus       142 r~srs~~l~~~~~~~~~~~~~~~~~~~~F~F~~l~~~V~f~~gsv~~~~~~i~~~~~wi~e~  203 (203)
T cd04105         142 RESRSKSLSSLDGDEGSKESLGDKGGKSFEFDQLEGKVEFLEGSVKVDGGGIDGWEEWIDEL  203 (203)
T ss_pred             HHHHHCCCCCCCCCCCCCHHHCCCCCCCEEEECCCCCEEEEEEEEECCCCCCHHHHHHHHHC
T ss_conf             99774244334455553112147788852540279825899736725888705999999759


No 245
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]
Probab=99.10  E-value=1.9e-09  Score=73.46  Aligned_cols=65  Identities=25%  Similarity=0.331  Sum_probs=44.6

Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH---HHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
Q ss_conf             5753221222211110246899999999997---5313689868999888889989999999987287
Q gi|254780484|r  148 KAVSYQIVLTKIDKLSPTTAQETLEKTKYLI---RNYPTAHPEVIPTSSVKRKGIEVLRKAILETINY  212 (212)
Q Consensus       148 ~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~---~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~~  212 (212)
                      ..+--++++||.|.-..+.-...+...-...   .....|.++++.+||.+|+|+++|+++|.++.+|
T Consensus       188 mEiaDi~vINKaD~~~A~~a~r~l~~al~~~~~~~~~~~W~ppv~~t~A~~g~Gi~~L~~ai~~h~~~  255 (323)
T COG1703         188 MEIADIIVINKADRKGAEKAARELRSALDLLREVWRENGWRPPVVTTSALEGEGIDELWDAIEDHRKF  255 (323)
T ss_pred             HHHHHEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             65403356725672658999999999997511454236888864676413577879999999999999


No 246
>TIGR02034 CysN sulfate adenylyltransferase, large subunit; InterPro: IPR011779    Metabolic assimilation of sulphur from inorganic sulphate, requires sulphate activation by coupling to a nucleoside, for the production of high-energy nucleoside phosphosulphates. This pathway appears to be similar in all prokaryotic organisms. Activation is first achieved through sulphation of sulphate with ATP by sulphate adenylyltransferase (ATP sulphurylase) to produce 5'-phosphosulphate (APS), coupled by GTP hydrolysis. Subsequently, APS is phosphorylated by an APS kinase to produce 3'-phosphoadenosine-5'-phosphosulphate (PAPS) . In Escherichia coli, ATP sulphurylase is a heterodimer composed of two subunits encoded by cysD and cysN, with APS kinase encoded by cysC. These genes are located in a unidirectionally transcribed gene cluster, and have been shown to be required for the synthesis of sulphur-containing amino acids . Homologous to this E. coli activation pathway are nodPQH gene products found among members of the Rhizobiaceae family. These gene products have been shown to exhibit ATP sulphurase and APS kinase activity, yet are involved in Nod factor sulphation, and sulphation of other macromolecules . With members of the Rhizobiaceae family, nodQ often appears as a fusion of cysN (large subunit of ATP sulphurase) and cysC (APS kinase) , .; GO: 0016772 transferase activity transferring phosphorus-containing groups.
Probab=99.09  E-value=7.7e-11  Score=81.45  Aligned_cols=153  Identities=19%  Similarity=0.238  Sum_probs=102.7

Q ss_pred             ECCCCCCHHHHHHHHHCC-CC--------EEEECCCCCE----------------EEECCEEEEEEEEEEEECCCEEEEE
Q ss_conf             748998898999997389-73--------7987388841----------------4521202665556785089649999
Q gi|254780484|r   35 SGRSNVGKSSLINILVNR-KN--------LARTSNAPGR----------------TQHLNFFVPKDFSNLKNNLPAMALV   89 (212)
Q Consensus        35 vG~~NvGKSSLiNaL~g~-~~--------~a~~~~~p~t----------------t~~~~~~~~~~~~~~~~~~~~~~~~   89 (212)
                      .|-..=||||||=+|+-- |.        +-..|..-++                -+..+.+-+.-++-+.-+..++.+.
T Consensus         6 CGSVDDGKSTLIGRLLhDtK~i~eDQL~~l~~DS~~~G~~G~~iD~ALLVDGL~AEREQGITIDVAYRYFsT~KRkFIvA   85 (411)
T TIGR02034         6 CGSVDDGKSTLIGRLLHDTKQIYEDQLAALERDSKKHGTQGEEIDLALLVDGLQAEREQGITIDVAYRYFSTDKRKFIVA   85 (411)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEE
T ss_conf             05445873102222255552168999999885225534788765234133067744324861213313257787617884


Q ss_pred             ECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-CCCCCCCCCCCCHHHH-
Q ss_conf             76001011122447898888998777766420000011223578875454554321025753-2212222111102468-
Q gi|254780484|r   90 DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS-YQIVLTKIDKLSPTTA-  167 (212)
Q Consensus        90 DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~~~~~~~-  167 (212)
                      ||||++-+       .+....      .+.-+++.+..+|+..+...|.....-.....++. +++++||+|+++-++. 
T Consensus        86 DTPGHEQY-------TRNMAT------GAST~dlAvlLvDAR~Gvl~QTRRHs~i~sLLGIrh~VlAVNKmDLvdyd~~v  152 (411)
T TIGR02034        86 DTPGHEQY-------TRNMAT------GASTADLAVLLVDARKGVLEQTRRHSYIASLLGIRHVVLAVNKMDLVDYDEEV  152 (411)
T ss_pred             CCCCCCCC-------CCCCCH------HCCCCCEEEEEEEHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHH
T ss_conf             08559415-------443000------01311246655421021345677999998860453899999701114765788


Q ss_pred             -HHHHHHHHHHHHHC-CCCCCCEEEEECCCCCCHH
Q ss_conf             -99999999997531-3689868999888889989
Q gi|254780484|r  168 -QETLEKTKYLIRNY-PTAHPEVIPTSSVKRKGIE  200 (212)
Q Consensus       168 -~~~~~~~~~~~~~~-~~~~~~i~~vSA~~g~Gi~  200 (212)
                       +...+.+..+-... ......++|+||.+|+|+-
T Consensus       153 F~~I~~~y~~fa~~L~g~~~~~~iP~SAL~GdNv~  187 (411)
T TIGR02034       153 FENIKKDYLAFAEQLAGVRDVTFIPLSALKGDNVV  187 (411)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCEE
T ss_conf             99999999999986389834799873313687402


No 247
>PRK13796 GTP-binding protein YqeH; Provisional
Probab=99.08  E-value=1.8e-10  Score=79.26  Aligned_cols=58  Identities=33%  Similarity=0.370  Sum_probs=42.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHC----CCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHH
Q ss_conf             899974899889899999738----9737987388841452120266555678508964999976001011
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVN----RKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYA   97 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g----~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~   97 (212)
                      .|-+||.+|||||||||+|..    .+..+.++..||||......        . -+....++||||+...
T Consensus       164 dvyvVG~tNvGKSTLiN~ll~~~~~~~~~iT~S~~PGTTL~~i~i--------p-l~~~~~l~DTPGi~~~  225 (367)
T PRK13796        164 DVYVVGVTNVGKSTLINRIIKEITGEKDVITTSRFPGTTLDKIEI--------P-LDDGSFLYDTPGIIHR  225 (367)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCEEE--------E-CCCCCEEECCCCCCCH
T ss_conf             589991575758999999998716787731344899863031787--------2-3898567558886674


No 248
>KOG1491 consensus
Probab=99.07  E-value=1.3e-10  Score=80.07  Aligned_cols=73  Identities=23%  Similarity=0.177  Sum_probs=52.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEE-----------ECCCEEEEEECCHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785-----------0896499997600101
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK-----------NNLPAMALVDMPGYGY   96 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~-----------~~~~~~~~~DtpG~~~   96 (212)
                      +-++++|||.||||||||||+||..+  +...++|++|.+++..+........           .-...+.+.|.+|+..
T Consensus        19 ~~lkiGIVGlPNvGKST~fnalT~~~--a~~~NfPF~TIdPn~a~V~v~d~Rfd~l~~~Y~~~~~vpa~l~v~DIAGLvk   96 (391)
T KOG1491          19 NNLKIGIVGLPNVGKSTFFNALTKSK--AGAANFPFCTIDPNEARVEVPDSRFDLLCPIYGPKSKVPAFLTVYDIAGLVK   96 (391)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHCCC--CCCCCCCCCEECCCCCEEECCCHHHHHHHHHCCCCCEEEEEEEEEEECCCCC
T ss_conf             76402575179874688999986079--8856787402563411222682588999885287661233578986212356


Q ss_pred             HHHHHH
Q ss_conf             112244
Q gi|254780484|r   97 ARAPKK  102 (212)
Q Consensus        97 ~~~~~~  102 (212)
                      -...+.
T Consensus        97 GAs~G~  102 (391)
T KOG1491          97 GASAGE  102 (391)
T ss_pred             CCCCCC
T ss_conf             764576


No 249
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH. This family describes YqeH, a member of a larger family of GTPases involved in ribosome biogenesis. Like YqlF, it shows a cyclical permutation relative to GTPases EngA (in which the GTPase domain is duplicated), Era, and others. Members of this protein family are found in a relatively small number of bacterial species, including Bacillus subtilis but not Escherichia coli.
Probab=99.07  E-value=2e-10  Score=79.06  Aligned_cols=58  Identities=38%  Similarity=0.437  Sum_probs=42.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHCC----CCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHH
Q ss_conf             8999748998898999997389----737987388841452120266555678508964999976001011
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNR----KNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYA   97 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~----~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~   97 (212)
                      .|-+||.+|||||||+|+|.+.    +..+.++..||||.......        . +....+.||||+...
T Consensus       156 dvyvvG~tNvGKSTliN~Ll~~~~~~~~~~T~S~~PGTTL~~i~i~--------l-~~~~~i~DTPGi~~~  217 (360)
T TIGR03597       156 DVYVVGVTNVGKSSLINKLLKQNNGDKDVITTSPFPGTTLDLIEIP--------L-DDGHSLYDTPGIINS  217 (360)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHCCCCCCCEEECCCCCCCCCCEEEE--------C-CCCCEEECCCCCCCH
T ss_conf             5899916866589999999876167777236458998533307875--------3-899557457765574


No 250
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]
Probab=99.06  E-value=2e-09  Score=73.38  Aligned_cols=141  Identities=22%  Similarity=0.306  Sum_probs=82.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      ++++||..++||+||+|+|-|...+..      +|...           .+.  .-..+||||......    .  +.+.
T Consensus         3 ri~~vG~~gcGKTtL~q~L~G~~~lyk------KTQAv-----------e~~--d~~~IDTPGEy~~~~----~--~Y~a   57 (148)
T COG4917           3 RIAFVGQVGCGKTTLFQSLYGNDTLYK------KTQAV-----------EFN--DKGDIDTPGEYFEHP----R--WYHA   57 (148)
T ss_pred             EEEEECCCCCCCHHHHHHHHCCHHHHC------CCCEE-----------ECC--CCCCCCCCHHHHHHH----H--HHHH
T ss_conf             068751456573167888616033210------00013-----------304--755658806665246----7--8999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             98777766420000011223578875454554321025753221222211110246899999999997531368986899
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP  190 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  190 (212)
                      ....   .......+.+..........-..   +...-..|++-+++|.|+..+.+++    ..++.+.+  .+-.++|.
T Consensus        58 L~tt---~~dadvi~~v~~and~~s~f~p~---f~~~~~k~vIgvVTK~DLaed~dI~----~~~~~L~e--aGa~~iF~  125 (148)
T COG4917          58 LITT---LQDADVIIYVHAANDPESRFPPG---FLDIGVKKVIGVVTKADLAEDADIS----LVKRWLRE--AGAEPIFE  125 (148)
T ss_pred             HHHH---HHCCCEEEEEECCCCCCCCCCCC---CCCCCCCCEEEEEECCCCCCHHHHH----HHHHHHHH--CCCCCEEE
T ss_conf             9887---61133255430026844448842---1344666558998603466467689----99999997--48752688


Q ss_pred             EECCCCCCHHHHHHHHHH
Q ss_conf             988888998999999998
Q gi|254780484|r  191 TSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       191 vSA~~g~Gi~eL~~~I~~  208 (212)
                      +||....|+++|++.|..
T Consensus       126 ~s~~d~~gv~~l~~~L~~  143 (148)
T COG4917         126 TSAVDNQGVEELVDYLAS  143 (148)
T ss_pred             EECCCCCCHHHHHHHHHH
T ss_conf             725583119999999974


No 251
>TIGR00750 lao LAO/AO transport system ATPase; InterPro: IPR005129   Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components. In Escherichia coli K-12, the arginine-ornithine transport system requires an arginine-ornithine-binding protein and the lysine-arginine-ornithine (LAO) transport system includes a LAO-binding protein. Both periplasmic proteins can be phosphorylated by a single kinase, ArgK  resulting in reduced levels of transport activity of the periplasmic transport systems that include each of the binding proteins. The ArgK protein acts as an ATPase enzyme and as a kinase..
Probab=99.06  E-value=1.1e-09  Score=74.71  Aligned_cols=66  Identities=23%  Similarity=0.238  Sum_probs=44.2

Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHH-----HHH-------------------HHHHHCCCCCCCEEEEECCCCCCHHH
Q ss_conf             025753221222211110246899999-----999-------------------99753136898689998888899899
Q gi|254780484|r  146 DKKAVSYQIVLTKIDKLSPTTAQETLE-----KTK-------------------YLIRNYPTAHPEVIPTSSVKRKGIEV  201 (212)
Q Consensus       146 ~~~~~~~~~v~nK~D~~~~~~~~~~~~-----~~~-------------------~~~~~~~~~~~~i~~vSA~~g~Gi~e  201 (212)
                      ....+--+.|+||.|.-..+++.....     ..+                   .....+..|.|+++.+||..|.||+|
T Consensus       179 G~mEiaDI~VVNKaD~~~a~~v~~~a~~~l~l~~esvqmlsqmthadearvq~G~~~~r~~gW~Ppv~~tsA~~G~Gi~E  258 (333)
T TIGR00750       179 GVMEIADIYVVNKADGEGAEEVKTLARLMLALDLESVQMLSQMTHADEARVQKGEIYRREKGWRPPVLKTSAVEGRGIDE  258 (333)
T ss_pred             HHHEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHCCCCCCEEEEECCCCCCCHH
T ss_conf             43023248788168876658999999998888888999998653333444302655110105899638873356887167


Q ss_pred             HHHHHHHHHC
Q ss_conf             9999998728
Q gi|254780484|r  202 LRKAILETIN  211 (212)
Q Consensus       202 L~~~I~~~l~  211 (212)
                      |+++|.++=.
T Consensus       259 L~daI~eH~~  268 (333)
T TIGR00750       259 LWDAIEEHKK  268 (333)
T ss_pred             HHHHHHHHHH
T ss_conf             8999999999


No 252
>TIGR00231 small_GTP small GTP-binding protein domain; InterPro: IPR005225   Proteins with a small GTP-binding domain include Ras, RhoA, Rab11, translation elongation factor G, translation initiation factor IF-2, tetratcycline resistance protein TetM, CDC42, Era, ADP-ribosylation factors, tdhF, and many others . In some proteins the domain occurs more than once. Among them there is a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.; GO: 0005525 GTP binding.
Probab=99.05  E-value=1.6e-09  Score=73.89  Aligned_cols=171  Identities=24%  Similarity=0.245  Sum_probs=106.5

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCC--CEEEECCEEEEEEEEEE------EECCCEEEEEECCHHHHHHHH
Q ss_conf             8689997489988989999973897379873888--41452120266555678------508964999976001011122
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAP--GRTQHLNFFVPKDFSNL------KNNLPAMALVDMPGYGYARAP  100 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p--~tt~~~~~~~~~~~~~~------~~~~~~~~~~DtpG~~~~~~~  100 (212)
                      .+.++++|++|+|||+|++.+.+.+. ..+...|  +++...........+..      .+ +..+.++||||+......
T Consensus         3 ~~~~~~~g~~~~Gk~~l~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~w-~~~~~~~d~~G~~~~~~~   80 (186)
T TIGR00231         3 DIKIGIVGDPNVGKSTLLNRLLGNKG-SITESGPTDGTTRDYVTESIEEDGKTITGATFQW-GYKFNLLDTPGLHRQEDY   80 (186)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHCCC-CEEECCCCCCCCHHHHEEEEEECCEEEEEEEEEC-CEEEEEEECCCCHHHHHH
T ss_conf             50589973477660455544541012-0010232333200000011345580234343102-427898625771135555


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHH--HHHHHHHHHHHHH
Q ss_conf             44789888899877776642000001122357887545455432102575322122221111024--6899999999997
Q gi|254780484|r  101 KKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPT--TAQETLEKTKYLI  178 (212)
Q Consensus       101 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~--~~~~~~~~~~~~~  178 (212)
                      .....   ..................+.+.......+...........+.|.+++.||+|+....  .............
T Consensus        81 ~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~  157 (186)
T TIGR00231        81 DALRR---LYYPEVLSSLEVLDLVILVLDVEDGLEKDTKEIIHHADKYGVPILLVGNKIDLKDEKPGYFVDLKPHLASLF  157 (186)
T ss_pred             HHHHH---HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCEEEHHHHHHHHH
T ss_conf             44543---322344544433333332221110010256778753221274169985133655467540100003455555


Q ss_pred             HHCCCCCCC-EEEEECCCCCCHHHHHHHH
Q ss_conf             531368986-8999888889989999999
Q gi|254780484|r  179 RNYPTAHPE-VIPTSSVKRKGIEVLRKAI  206 (212)
Q Consensus       179 ~~~~~~~~~-i~~vSA~~g~Gi~eL~~~I  206 (212)
                        ......+ +++.|+.++.|++.+.+.+
T Consensus       158 --~~~~~~~~~~~~~~~~~~~~~~~~~~~  184 (186)
T TIGR00231       158 --AKLNGEPHFIPLSAETGKGIDSLFGLV  184 (186)
T ss_pred             --HHHCCCCCEEECCHHHHCCHHHHHHHH
T ss_conf             --542366401111001110045566654


No 253
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]
Probab=99.03  E-value=1.9e-09  Score=73.47  Aligned_cols=160  Identities=18%  Similarity=0.206  Sum_probs=106.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCC-CC--------EEEECCCCCEE----------------EECCEEEEEEEEEEEEC
Q ss_conf             6868999748998898999997389-73--------79873888414----------------52120266555678508
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNR-KN--------LARTSNAPGRT----------------QHLNFFVPKDFSNLKNN   82 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~-~~--------~a~~~~~p~tt----------------~~~~~~~~~~~~~~~~~   82 (212)
                      .+.+..-+|...-|||||+-+|+-. |.        +...+..-++.                +..+.+.+.-+..+.-.
T Consensus         5 ~lLRfiTcGSVDDGKSTLIGRLL~Dtk~i~eDQla~l~~dS~~~~t~g~~~D~ALLvDGL~AEREQGITIDVAYRyFsT~   84 (431)
T COG2895           5 SLLRFITCGSVDDGKSTLIGRLLYDTKAIYEDQLASLERDSKRKGTQGEKIDLALLVDGLEAEREQGITIDVAYRYFSTE   84 (431)
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEECCCC
T ss_conf             41368975353686023244655310110577999875213123677875452563325688886496599876410366


Q ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-CCCCCCCCCC
Q ss_conf             964999976001011122447898888998777766420000011223578875454554321025753-2212222111
Q gi|254780484|r   83 LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS-YQIVLTKIDK  161 (212)
Q Consensus        83 ~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~  161 (212)
                      ...+.+.||||++.+.       +.      +.....-++..+..+|+..+..+|.....-.....++. +++.+||+|+
T Consensus        85 KRkFIiADTPGHeQYT-------RN------MaTGASTadlAIlLVDAR~Gvl~QTrRHs~I~sLLGIrhvvvAVNKmDL  151 (431)
T COG2895          85 KRKFIIADTPGHEQYT-------RN------MATGASTADLAILLVDARKGVLEQTRRHSFIASLLGIRHVVVAVNKMDL  151 (431)
T ss_pred             CCEEEEECCCCHHHHH-------HH------HHCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCEEEEEEEEECC
T ss_conf             6308984599679876-------42------2236230037999996422167776778999997287679999741012


Q ss_pred             CCHHH--HHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHH
Q ss_conf             10246--8999999999975313689868999888889989
Q gi|254780484|r  162 LSPTT--AQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE  200 (212)
Q Consensus       162 ~~~~~--~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~  200 (212)
                      ++-++  -+.....+.............++|+||..|.|+-
T Consensus       152 vdy~e~~F~~I~~dy~~fa~~L~~~~~~~IPiSAl~GDNV~  192 (431)
T COG2895         152 VDYSEEVFEAIVADYLAFAAQLGLKDVRFIPISALLGDNVV  192 (431)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECHHHCCCCCC
T ss_conf             35678999999999999999769985247743230487533


No 254
>KOG0098 consensus
Probab=99.03  E-value=2.3e-09  Score=72.91  Aligned_cols=158  Identities=11%  Similarity=0.075  Sum_probs=89.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      -+-++.|+|.++||||.|+-.++.... ..+.+     .+.+.-.......+......+.++||+|.+..........  
T Consensus         5 ~~fKyIiiGd~gVGKSclllrf~~krF-~~~hd-----~TiGvefg~r~~~id~k~IKlqiwDtaGqe~frsv~~syY--   76 (216)
T KOG0098           5 YLFKYIIIGDTGVGKSCLLLRFTDKRF-QPVHD-----LTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSVTRSYY--   76 (216)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHCCCC-CCCCC-----CEEEEEECEEEEEECCCEEEEEEEECCCCHHHHHHHHHHH--
T ss_conf             447899987777328899999851576-54534-----3022440236988858168999975578676999888884--


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCC--CCCCHHHHHHHHH--HCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             889987777664200000112235--7887545455432--102575322122221111024689999999999753136
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCR--HGVKQIDQDVFSF--LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT  183 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~--~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~  183 (212)
                                 .-....+++.|..  ..+......+.+.  .......+++..||+|+....++.+.  +-+...++.  
T Consensus        77 -----------r~a~GalLVydit~r~sF~hL~~wL~D~rq~~~~NmvImLiGNKsDL~~rR~Vs~E--EGeaFA~eh--  141 (216)
T KOG0098          77 -----------RGAAGALLVYDITRRESFNHLTSWLEDARQHSNENMVIMLIGNKSDLEARREVSKE--EGEAFAREH--  141 (216)
T ss_pred             -----------CCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCHH--HHHHHHHHC--
T ss_conf             -----------46762389997130666778999999999726788389997441442102346588--899999973--


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             89868999888889989999999987
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                       +-..+.+||+++.|++|........
T Consensus       142 -gLifmETSakt~~~VEEaF~nta~~  166 (216)
T KOG0098         142 -GLIFMETSAKTAENVEEAFINTAKE  166 (216)
T ss_pred             -CCEEEHHHHHHHHHHHHHHHHHHHH
T ss_conf             -9544412445542399999999999


No 255
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]
Probab=99.03  E-value=2.2e-09  Score=73.09  Aligned_cols=166  Identities=19%  Similarity=0.263  Sum_probs=109.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHCC---CCEE------EECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH
Q ss_conf             8999748998898999997389---7379------873888414521202665556785089649999760010111224
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNR---KNLA------RTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~---~~~a------~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~  101 (212)
                      .|+-+|+-|+||+||.-||++-   +-.+      .....|- .+..+.+..............+..+|.||+..+..  
T Consensus        14 NigtiGHvdHGKTTLtaAit~~la~~~~~~~~~y~~id~aPe-Ek~rGITIntahveyet~~rhyahVDcPGHaDYvK--   90 (394)
T COG0050          14 NVGTIGHVDHGKTTLTAAITTVLAKKGGAEAKAYDQIDNAPE-EKARGITINTAHVEYETANRHYAHVDCPGHADYVK--   90 (394)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHCCCH-HHHCCCEECCCEEEEECCCCEEEECCCCCHHHHHH--
T ss_conf             787861424763528999999998632401033344304826-76457254010058863881488616897489999--


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-CCCCCCCCCCCCHHHHHHHH-HHHHHHHH
Q ss_conf             47898888998777766420000011223578875454554321025753-22122221111024689999-99999975
Q gi|254780484|r  102 KNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS-YQIVLTKIDKLSPTTAQETL-EKTKYLIR  179 (212)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~~~~~~~~~~~-~~~~~~~~  179 (212)
                                 ..+......+..+++..+..+...|..+.+-.....+.| +++.+||+|.+++.+..+.. .++++++.
T Consensus        91 -----------NMItgAaqmDgAILVVsA~dGpmPqTrEHiLlarqvGvp~ivvflnK~Dmvdd~ellelVemEvreLLs  159 (394)
T COG0050          91 -----------NMITGAAQMDGAILVVAATDGPMPQTREHILLARQVGVPYIVVFLNKVDMVDDEELLELVEMEVRELLS  159 (394)
T ss_pred             -----------HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             -----------876407753762899984789998605642012342885799997422366868999999999999999


Q ss_pred             HCCCC--CCCEEEEECCCC-CC-------HHHHHHHHHHHH
Q ss_conf             31368--986899988888-99-------899999999872
Q gi|254780484|r  180 NYPTA--HPEVIPTSSVKR-KG-------IEVLRKAILETI  210 (212)
Q Consensus       180 ~~~~~--~~~i~~vSA~~g-~G-------i~eL~~~I~~~l  210 (212)
                      .|...  ..|++.-||..- +|       |.+|.+++.+.+
T Consensus       160 ~y~f~gd~~Pii~gSal~ale~~~~~~~~i~eLm~avd~yi  200 (394)
T COG0050         160 EYGFPGDDTPIIRGSALKALEGDAKWEAKIEELMDAVDSYI  200 (394)
T ss_pred             HCCCCCCCCCEEECHHHHHHCCCCCHHHHHHHHHHHHHHCC
T ss_conf             73999877633411233310377216789999999998548


No 256
>pfam00350 Dynamin_N Dynamin family.
Probab=99.03  E-value=1.1e-09  Score=74.75  Aligned_cols=33  Identities=33%  Similarity=0.478  Sum_probs=26.1

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEE
Q ss_conf             9997489988989999973897379873888414
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT   65 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt   65 (212)
                      |+++|..++|||||+|||+|.+. ..++..|+|.
T Consensus         1 ivvvG~~ssGKSSliNALlG~~i-lP~~~~~~T~   33 (168)
T pfam00350         1 IAVVGDQSAGKSSVLNALLGRDI-LPRGPGPTTR   33 (168)
T ss_pred             CEEECCCCCCHHHHHHHHHCCCC-CCCCCCCCCC
T ss_conf             98991788989999999978873-6889976516


No 257
>KOG1487 consensus
Probab=99.03  E-value=1.4e-10  Score=80.03  Aligned_cols=157  Identities=18%  Similarity=0.172  Sum_probs=89.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      -+|.++|-|.+|||||++.|+|....  +..+-++|-.      ...+.....+..+.+.|.||+..-............
T Consensus        60 a~vg~vgFPSvGksTl~~~l~g~~s~--vasyefttl~------~vpG~~~y~gaKiqlldlpgiiegakdgkgrg~qvi  131 (358)
T KOG1487          60 ARVGFVGFPSVGKSTLLSKLTGTFSE--VAAYEFTTLT------TVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGKQVI  131 (358)
T ss_pred             EEEEEEECCCCCHHHHHHHHCCCCCC--CCCCCCEEEE------EECCEEECCCCCEEEECCCCHHCCCCCCCCCCCEEE
T ss_conf             15537853766624332230188876--5543322689------706667404562343048540014646788760788


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC-------------------------------------------------------
Q ss_conf             9987777664200000112235788-------------------------------------------------------
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV-------------------------------------------------------  134 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~-------------------------------------------------------  134 (212)
                      ...      ..+.+.+.+.|...+.                                                       
T Consensus       132 ava------rtcnli~~vld~~kp~~hk~~ie~eleg~girlnk~pp~i~~kkKdkgGInlt~~~LdlD~~rsil~eyR~  205 (358)
T KOG1487         132 AVA------RTCNLIFIVLDVLKPLSHKKIIEKELEGFGIRLNKQPPNIGTKKKDKGGINLTGTHLDLDLQRSILSEYRI  205 (358)
T ss_pred             EEE------ECCCEEEEEEECCCCCCHHHHHHHHHHCCEEECCCCCCCCCCCCCCCCCEEEECCHHHHHHHHHHHHHHHH
T ss_conf             883------01658998711067521788998763103666148899763012444743001320027889999887643


Q ss_pred             -----------CHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHH
Q ss_conf             -----------754545543210257532212222111102468999999999975313689868999888889989999
Q gi|254780484|r  135 -----------KQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR  203 (212)
Q Consensus       135 -----------~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~  203 (212)
                                 ...++...-.....-.|.+.++||+|-+.-++..            +....+..+|+||.++||+|+|+
T Consensus       206 hsAdi~Lr~DaT~DdLIdvVegnr~yVp~iyvLNkIdsISiEELd------------ii~~iphavpISA~~~wn~d~lL  273 (358)
T KOG1487         206 HSADIALRFDATADDLIDVVEGNRIYVPCIYVLNKIDSISIEELD------------IIYTIPHAVPISAHTGWNFDKLL  273 (358)
T ss_pred             CCHHEEEECCCCHHHHHHHHCCCCEEEEEEEEECCCCEEEEECCC------------EEEECCCEEECCCCCCCCHHHHH
T ss_conf             102305635764222432200573156655562223501210132------------01105632452456665567889


Q ss_pred             HHHHHHHCC
Q ss_conf             999987287
Q gi|254780484|r  204 KAILETINY  212 (212)
Q Consensus       204 ~~I~~~l~~  212 (212)
                      +.+++.|++
T Consensus       274 ~~mweyL~L  282 (358)
T KOG1487         274 EKMWEYLKL  282 (358)
T ss_pred             HHHHHCCHH
T ss_conf             887306002


No 258
>KOG1486 consensus
Probab=99.02  E-value=5.7e-10  Score=76.47  Aligned_cols=164  Identities=20%  Similarity=0.215  Sum_probs=91.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      .--+||++|.|.||||||+.++|+....+..  +.+||..+      ..+.+..++..+.+.|.||+.....-.....+.
T Consensus        61 GdaRValIGfPSVGKStlLs~iT~T~SeaA~--yeFTTLtc------IpGvi~y~ga~IQllDLPGIieGAsqgkGRGRQ  132 (364)
T KOG1486          61 GDARVALIGFPSVGKSTLLSKITSTHSEAAS--YEFTTLTC------IPGVIHYNGANIQLLDLPGIIEGASQGKGRGRQ  132 (364)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHCCHHHHHC--CEEEEEEE------ECCEEEECCCEEEEECCCCCCCCCCCCCCCCCE
T ss_conf             8737999648874478788876411022211--02467873------031687668347996275300021137887726


Q ss_pred             ----------------------HH--HHHHHHHHHHHHCC------------------------------------CCCC
Q ss_conf             ----------------------88--99877776642000------------------------------------0011
Q gi|254780484|r  108 ----------------------GG--LIVRYLSERSTLRC------------------------------------VYLL  127 (212)
Q Consensus       108 ----------------------~~--~~~~~~~~~~~~~~------------------------------------~~~~  127 (212)
                                            +.  +.......-..+..                                    ...+
T Consensus       133 viavArtaDlilMvLDatk~e~qr~~le~ELe~vGiRLNk~~Pniy~k~kk~gGi~f~~T~plT~~~ek~i~~ILheykI  212 (364)
T KOG1486         133 VIAVARTADLILMVLDATKSEDQREILEKELEAVGIRLNKRKPNIYFKKKKTGGISFNTTVPLTHCDEKLIYTILHEYKI  212 (364)
T ss_pred             EEEEEECCCEEEEEECCCCCHHHHHHHHHHHHHHCEECCCCCCCEEEEEECCCCEEEEEEECCCCCCHHHHHHHHHHHEE
T ss_conf             88874036589999517761567899999999741341478997588874368767742404523549999999988744


Q ss_pred             CCCCCCCC--HHHHHHHHHH--CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHH
Q ss_conf             22357887--5454554321--0257532212222111102468999999999975313689868999888889989999
Q gi|254780484|r  128 IDCRHGVK--QIDQDVFSFL--DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR  203 (212)
Q Consensus       128 ~~~~~~~~--~~~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~  203 (212)
                      ..+..-++  -....+++..  ...-.+++-+.||+|.+.-++..       ....     -++-+.+|+..+.|++-|.
T Consensus       213 ~Naevl~Red~t~DdfIDvi~gnr~Y~~ClYvYnKID~vs~eevd-------rlar-----~PnsvViSC~m~lnld~ll  280 (364)
T KOG1486         213 HNAEVLFREDCTVDDFIDVIEGNRVYIKCLYVYNKIDQVSIEEVD-------RLAR-----QPNSVVISCNMKLNLDRLL  280 (364)
T ss_pred             CCCEEEEECCCCHHHHHHHHHCCCEEEEEEEEEECCCEECHHHHH-------HHHC-----CCCCEEEEECCCCCHHHHH
T ss_conf             551389843786687888874563278888995124420388888-------9862-----8985899803446889999


Q ss_pred             HHHHHHHC
Q ss_conf             99998728
Q gi|254780484|r  204 KAILETIN  211 (212)
Q Consensus       204 ~~I~~~l~  211 (212)
                      +.|++.|+
T Consensus       281 e~iWe~l~  288 (364)
T KOG1486         281 ERIWEELN  288 (364)
T ss_pred             HHHHHHHC
T ss_conf             99998741


No 259
>cd04102 RabL3 RabL3 (Rab-like3) subfamily.  RabL3s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL3 lacks a prenylation site at the C-terminus.  The specific function of RabL3 remains unknown.
Probab=99.02  E-value=5.6e-10  Score=76.50  Aligned_cols=166  Identities=12%  Similarity=0.163  Sum_probs=84.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEE--EECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678--5089649999760010111224478988
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNL--KNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~--~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      .+|.++|-++||||||++.++......  ...++-...... ........  ......+.++||+|.+.........   
T Consensus         1 vKIlllGDsgVGKTSL~~~~~~~~f~~--~~~~TiG~~v~~-k~~~~~~~~~~~k~~~l~lWDtaGqery~sl~~~y---   74 (202)
T cd04102           1 VRVLVVGDSGVGKSSLVHLICKNQVLG--RPSWTVGCSVDV-KHHTYKEGTPEEKTFFVELWDVGGSESVKSTRAVF---   74 (202)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCCC--CCCCCEEEEEEE-EEEEECCCCCCCCEEEEEEEECCCCHHHHHHHHHH---
T ss_conf             989999999989999999998398888--888850367899-99993378767838999999899877577678997---


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCC-----CHHHHHH------------------HHHHCCCCCCCCCCCCCCCCCCH
Q ss_conf             889987777664200000112235788-----7545455------------------43210257532212222111102
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGV-----KQIDQDV------------------FSFLDKKAVSYQIVLTKIDKLSP  164 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~------------------~~~~~~~~~~~~~v~nK~D~~~~  164 (212)
                             .   .....++.+.|.....     ..+..+.                  .+.......|+++|.||.|++..
T Consensus        75 -------Y---r~a~gvILVyDvTnr~SF~nL~~Wl~Eil~~~~~~~~~~~~~~~~~~~~~~~~~vPilvVGtK~D~~~~  144 (202)
T cd04102          75 -------Y---NQVNGIILVHDLTNRKSSQNLQRWSLEALNKDTFPTGLLVTNGDYDSEQFGGNQIPLLVIGTKLDQIPE  144 (202)
T ss_pred             -------H---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECHHHCCC
T ss_conf             -------5---889899999989498999869999999975367666545566655533346789758999760652434


Q ss_pred             HHHHHHH-----HHHHHH--HHHC--CCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             4689999-----999999--7531--368986899988888998999999998728
Q gi|254780484|r  165 TTAQETL-----EKTKYL--IRNY--PTAHPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       165 ~~~~~~~-----~~~~~~--~~~~--~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      .......     ..+.++  .++.  .-.....+..||.++.++...++...|..-
T Consensus       145 r~~~~~~~~~~~~~ia~q~~~eei~~~c~~~~~~~~~~~~~~kl~~ff~~vie~~y  200 (202)
T cd04102         145 KESSGNLVLTARGFVAEQGNAEEINLNCTNGRLLAAGSSDAVKLSRFFDKVIEKRY  200 (202)
T ss_pred             CCCCCCHHHHHHHHHHHHCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             35554235553025777516678887456844003467551689999999988882


No 260
>KOG0084 consensus
Probab=99.02  E-value=3.8e-09  Score=71.72  Aligned_cols=157  Identities=14%  Similarity=0.102  Sum_probs=90.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      -+|.|+|-+|||||-|+-++.+..- ..   ....|...  -.....-........+.++||+|.++.+.....      
T Consensus        10 FKiiliGds~VGKtCL~~Rf~~~~f-~e---~~~sTIGV--Df~~rt~e~~gk~iKlQIWDTAGQERFrtit~s------   77 (205)
T KOG0084          10 FKIILIGDSGVGKTCLLLRFKDDTF-TE---SYISTIGV--DFKIRTVELDGKTIKLQIWDTAGQERFRTITSS------   77 (205)
T ss_pred             EEEEEECCCCCCHHHHHHHHCCCCC-CH---HHCCEEEE--EEEEEEEEECCEEEEEEEEECCCCHHHHHHHHH------
T ss_conf             9999987789676355566626985-33---32323126--788987555264888876663653777555476------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCC--CCHH--HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             998777766420000011223578--8754--545543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHG--VKQI--DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~--~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                          +   -.-...++.+.|....  +...  .....+.......|.++|.||+|+.+...+..  +..+.....+   +
T Consensus        78 ----y---YR~ahGii~vyDiT~~~SF~~v~~Wi~Ei~~~~~~~v~~lLVGNK~Dl~~~~~v~~--~~a~~fa~~~---~  145 (205)
T KOG0084          78 ----Y---YRGAHGIIFVYDITKQESFNNVKRWIQEIDRYASENVPKLLVGNKCDLTEKRVVST--EEAQEFADEL---G  145 (205)
T ss_pred             ----H---CCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHCCCCH--HHHHHHHHHC---C
T ss_conf             ----6---16787599999765577765488999986652467787688862455186400179--9999998642---9


Q ss_pred             CC-EEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             86-89998888899899999999872
Q gi|254780484|r  186 PE-VIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~-i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+ ++++||+.+.|+++.+..|...|
T Consensus       146 ~~~f~ETSAK~~~NVe~~F~~la~~l  171 (205)
T KOG0084         146 IPIFLETSAKDSTNVEDAFLTLAKEL  171 (205)
T ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             83035504687547999999999999


No 261
>cd01850 CDC_Septin CDC/Septin.  Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells.  They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis.  In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments.  Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.
Probab=99.02  E-value=7.3e-09  Score=70.07  Aligned_cols=150  Identities=24%  Similarity=0.328  Sum_probs=80.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECC-CCCEEEECCEEEE-EEEEEEEECC--CEEEEEECCHHHHHHH-HHHHH-
Q ss_conf             899974899889899999738973798738-8841452120266-5556785089--6499997600101112-24478-
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSN-APGRTQHLNFFVP-KDFSNLKNNL--PAMALVDMPGYGYARA-PKKNV-  104 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~-~p~tt~~~~~~~~-~~~~~~~~~~--~~~~~~DtpG~~~~~~-~~~~~-  104 (212)
                      .|.+||.++.|||||+|.|++.+....... .+........... ........++  ..+.++||||+..... ..... 
T Consensus         6 nimVvG~sGlGKsTfiNtLf~~~~~~~~~~~~~~~~~~~~t~~i~~~~~~i~e~g~~l~LtviDTpGfGd~i~n~~~~~~   85 (276)
T cd01850           6 NIMVVGESGLGKSTFINTLFNTKLIPSDYPPDPAEEHIDKTVEIKSSKAEIEENGVKLKLTVIDTPGFGDNINNSDCWKP   85 (276)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHCCCCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCCHHHHHHH
T ss_conf             99997689998899999974785778777788132056888258999999963998999999976884122360340999


Q ss_pred             --HHHHHHHHHHHHH-----------HHHHCCCCCCC-CCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             --9888899877776-----------64200000112-235788754545543210257532212222111102468999
Q gi|254780484|r  105 --DSWGGLIVRYLSE-----------RSTLRCVYLLI-DCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQET  170 (212)
Q Consensus       105 --~~~~~~~~~~~~~-----------~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~  170 (212)
                        .........+...           .....++++.. -...+..+.|.+.+..+. ...+++.|+.|+|.+.++++...
T Consensus        86 I~~yI~~qf~~yl~eE~~i~R~~~~~D~RVH~cLYFI~Ptgh~L~~lDi~~mk~Ls-~~vNvIPVIaKADtlT~~El~~~  164 (276)
T cd01850          86 IVDYIDDQFDQYLREESRIKRNPRIPDTRVHACLYFIEPTGHGLKPLDIEFMKRLS-KRVNIIPVIAKADTLTPEELKEF  164 (276)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHC-CCCCEEEEEECCCCCCHHHHHHH
T ss_conf             99999999999999985314578887774489999967888888799999999962-75645667851666999999999


Q ss_pred             HHHHHHHHHHC
Q ss_conf             99999997531
Q gi|254780484|r  171 LEKTKYLIRNY  181 (212)
Q Consensus       171 ~~~~~~~~~~~  181 (212)
                      -..+.+.+..+
T Consensus       165 K~~I~~~l~~~  175 (276)
T cd01850         165 KQRIMEDIEEH  175 (276)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999999985


No 262
>pfam00735 Septin Septin. Members of this family include CDC3, CDC10, CDC11 and CDC12/Septin. Members of this family bind GTP. As regards the septins, these are polypeptides of 30-65kDa with three characteristic GTPase motifs (G-1, G-3 and G-4) that are similar to those of the Ras family. The G-4 motif is strictly conserved with a unique septin consensus of AKAD. Most septins are thought to have at least one coiled-coil region, which in some cases is necessary for intermolecular interactions that allow septins to polymerize to form rod-shaped complexes. In turn, these are arranged into tandem arrays to form filaments. They are multifunctional proteins, with roles in cytokinesis, sporulation, germ cell development, exocytosis and apoptosis.
Probab=99.02  E-value=1.1e-08  Score=69.08  Aligned_cols=149  Identities=22%  Similarity=0.369  Sum_probs=82.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEE--EECCEEEEEEEEEEEECC--CEEEEEECCHHHHHHHHHH-HH-
Q ss_conf             89997489988989999973897379873888414--521202665556785089--6499997600101112244-78-
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT--QHLNFFVPKDFSNLKNNL--PAMALVDMPGYGYARAPKK-NV-  104 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt--~~~~~~~~~~~~~~~~~~--~~~~~~DtpG~~~~~~~~~-~~-  104 (212)
                      .|.+||.++.|||||+|+|++..... ....+..+  .....-..........++  ..+.++||||+........ .. 
T Consensus         6 nimvvG~sGlGKTTfiNtL~~~~~~~-~~~~~~~~~~~~~t~~i~~~~~~iee~g~~l~LtiiDTpGfGd~i~n~~~~~~   84 (280)
T pfam00735         6 TLMVVGESGLGKTTLINTLFLTDLYP-ERGIPGPSEKIKKTVEIKATTVEIEEDGVKLNLTVIDTPGFGDAIDNSNCWKP   84 (280)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCC-CCCCCCCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCHHHHHHH
T ss_conf             99997799997899999985785778-66788843355677534889999988998999999989984233451666999


Q ss_pred             --HHHHHHHHHHHHH----------HHHHCCCCCCCC-CCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             --9888899877776----------642000001122-357887545455432102575322122221111024689999
Q gi|254780484|r  105 --DSWGGLIVRYLSE----------RSTLRCVYLLID-CRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETL  171 (212)
Q Consensus       105 --~~~~~~~~~~~~~----------~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~  171 (212)
                        .........+...          .....++++... ...+..+.+.+.+..+... .+++.|+.|+|.+.++++...-
T Consensus        85 I~~yI~~qf~~yl~eE~~i~R~~~~D~RVH~cLYFI~Ptgh~L~~lDi~~mk~Ls~~-vNvIPVIaKADtLT~~El~~~K  163 (280)
T pfam00735        85 IVEYIDEQFEQYLRDESRLNRTSIVDNRVHCCLYFISPTGHGLKPLDVEFMKKLHEK-VNIIPVIAKADTLTPDELQRFK  163 (280)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHCC-CCEEEEEECCCCCCHHHHHHHH
T ss_conf             999999999999998647566777888437999975688888868899999987144-6536666214558999999999


Q ss_pred             HHHHHHHHHC
Q ss_conf             9999997531
Q gi|254780484|r  172 EKTKYLIRNY  181 (212)
Q Consensus       172 ~~~~~~~~~~  181 (212)
                      ..+.+.+...
T Consensus       164 ~~I~~~l~~~  173 (280)
T pfam00735       164 KRIRAEIERQ  173 (280)
T ss_pred             HHHHHHHHHC
T ss_conf             9999999985


No 263
>pfam03029 ATP_bind_1 Conserved hypothetical ATP binding protein. Members of this family are found in a range of archaea and eukaryotes and have hypothesized ATP binding activity.
Probab=98.98  E-value=1.4e-09  Score=74.25  Aligned_cols=169  Identities=17%  Similarity=0.117  Sum_probs=91.6

Q ss_pred             EECCCCCCHHHHHHHHHC-----CCCEEEECCCCCEEEECC--------------------------------EEEEEE-
Q ss_conf             974899889899999738-----973798738884145212--------------------------------026655-
Q gi|254780484|r   34 FSGRSNVGKSSLINILVN-----RKNLARTSNAPGRTQHLN--------------------------------FFVPKD-   75 (212)
Q Consensus        34 ivG~~NvGKSSLiNaL~g-----~~~~a~~~~~p~tt~~~~--------------------------------~~~~~~-   75 (212)
                      ++|.+++||||+++++..     .+....+.-.|.....+-                                +..... 
T Consensus         1 ViGpaGSGKTT~~~~l~~~l~~~~r~~~vvNLDPA~e~~pY~~~iDIrd~i~~~dvM~~~~LGPNGali~~me~l~~~~d   80 (234)
T pfam03029         1 VVGGAGSGKTTFVGALSEILPLRGRSVYVVNLDPAAENLPYEADIDIRELITVADVMEDYGLGPNGALTVAMDFGRITLD   80 (234)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHHCCHHHHHHHCCCCCCHHHHHHHHHHHHHHH
T ss_conf             98989898899999999999977997599978986658999877717874679999998298973899999999999999


Q ss_pred             --EEEEEECCCEEEEEECCHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC-----CHHHHHHHHHHCC
Q ss_conf             --567850896499997600101112244-78988889987777664200000112235788-----7545455432102
Q gi|254780484|r   76 --FSNLKNNLPAMALVDMPGYGYARAPKK-NVDSWGGLIVRYLSERSTLRCVYLLIDCRHGV-----KQIDQDVFSFLDK  147 (212)
Q Consensus        76 --~~~~~~~~~~~~~~DtpG~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~  147 (212)
                        .... .....+.++||||..+.=.... .......+..    .  . ....+..|...-.     ...-.........
T Consensus        81 ~l~~~l-~~~~~y~l~DtPGQiElf~~~~~~~~i~~~L~~----~--~-~~~v~l~D~~~~~d~~~fis~~L~a~s~m~~  152 (234)
T pfam03029        81 WLLEEL-EYEDDYYLFDTPGQIELFTHWDSLARGVEALEA----S--R-LGAVYLVDTRRLTDPIDFFSGLLYALSIMLR  152 (234)
T ss_pred             HHHHHH-CCCCCEEEEECCCCEEEEECCHHHHHHHHHHHC----C--C-EEEEEEECHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             999985-255776998369835765400269999999712----8--7-3899984257746888899999999999997


Q ss_pred             CCCCCCCCCCCCCCCCHHHH------------------HHHHHHHHHHHHHCCCCCC-CEEEEECCCCCCHHHHHHHHHH
Q ss_conf             57532212222111102468------------------9999999999753136898-6899988888998999999998
Q gi|254780484|r  148 KAVSYQIVLTKIDKLSPTTA------------------QETLEKTKYLIRNYPTAHP-EVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       148 ~~~~~~~v~nK~D~~~~~~~------------------~~~~~~~~~~~~~~~~~~~-~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      .+.|.+.|+||+|+++....                  ....+.+...++.+.  .. .++++|+.+++|++.|...|.+
T Consensus       153 l~lP~vnvlsK~Dl~~~~~~l~~~~d~~~l~~~l~~~~~~L~~~l~~lledf~--lv~~f~~ls~~~~~s~~~ll~~ID~  230 (234)
T pfam03029       153 LGLPFVVALNKFDLLSLEFALKWFTDPDDLQLLLELDYRYLNEAIRLALDLFY--LVPRFLCDARETGESMEDLLTLIDE  230 (234)
T ss_pred             CCCCEEEEECCHHCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCCCEEEECCCHHHHHHHHHHHHH
T ss_conf             48994431000413542445777528788988878879999999999998725--7366146568860279999999887


Q ss_pred             HHCC
Q ss_conf             7287
Q gi|254780484|r  209 TINY  212 (212)
Q Consensus       209 ~l~~  212 (212)
                      .+.|
T Consensus       231 a~~y  234 (234)
T pfam03029       231 ALQY  234 (234)
T ss_pred             HCCC
T ss_conf             7289


No 264
>COG5258 GTPBP1 GTPase [General function prediction only]
Probab=98.97  E-value=3e-09  Score=72.27  Aligned_cols=164  Identities=20%  Similarity=0.246  Sum_probs=105.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCC--------------CEEEECCEEEE--EEEEE---------------E
Q ss_conf             89997489988989999973897379873888--------------41452120266--55567---------------8
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAP--------------GRTQHLNFFVP--KDFSN---------------L   79 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p--------------~tt~~~~~~~~--~~~~~---------------~   79 (212)
                      .|+.+|+.|+|||||+-+|+-.+.  ...+-.              +.+....+...  .....               +
T Consensus       119 ~Vg~aGhVdhGKSTlvG~LvtG~~--DDG~G~tR~~ldv~kHEverGlsa~iS~~v~Gf~dgk~~rlknPld~aE~~~vv  196 (527)
T COG5258         119 LVGVAGHVDHGKSTLVGVLVTGRL--DDGDGATRSYLDVQKHEVERGLSADISLRVYGFDDGKVVRLKNPLDEAEKAAVV  196 (527)
T ss_pred             EEEEECCCCCCCCEEEEEEEECCC--CCCCCCHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCEEEECCCCCHHHHHHHH
T ss_conf             999742445786359878984577--788840211345416777616532226999972499267605852077776766


Q ss_pred             EECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             50896499997600101112244789888899877776642000001122357887545455432102575322122221
Q gi|254780484|r   80 KNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKI  159 (212)
Q Consensus        80 ~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~  159 (212)
                      ...+.-+.|+||.|++.+.-..-           ....-...+....+..+..+......+..........|++++++|+
T Consensus       197 ~~aDklVsfVDtvGHEpwLrTti-----------rGL~gqk~dYglLvVaAddG~~~~tkEHLgi~~a~~lPviVvvTK~  265 (527)
T COG5258         197 KRADKLVSFVDTVGHEPWLRTTI-----------RGLLGQKVDYGLLVVAADDGVTKMTKEHLGIALAMELPVIVVVTKI  265 (527)
T ss_pred             HHCCCEEEEEECCCCCHHHHHHH-----------HHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEEC
T ss_conf             52030899985378627899888-----------8873266662799998167730330676565646169779999952


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHC----------------------CCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             1110246899999999997531----------------------36898689998888899899999999
Q gi|254780484|r  160 DKLSPTTAQETLEKTKYLIRNY----------------------PTAHPEVIPTSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       160 D~~~~~~~~~~~~~~~~~~~~~----------------------~~~~~~i~~vSA~~g~Gi~eL~~~I~  207 (212)
                      |+.+++..+...+++...++..                      ...-.|++.+||.+|.|+|-|.+.+.
T Consensus       266 D~~~ddr~~~v~~ei~~~Lk~v~Rip~~vk~~~d~v~aa~a~k~~~~vvPi~~tSsVTg~GldlL~e~f~  335 (527)
T COG5258         266 DMVPDDRFQGVVEEISALLKRVGRIPLIVKDTDDVVLAAKAMKAGRGVVPIFYTSSVTGEGLDLLDEFFL  335 (527)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHHHHHHH
T ss_conf             5682788999999999999974346535505532677654332378257799982245753899999997


No 265
>PRK07560 elongation factor EF-2; Reviewed
Probab=98.95  E-value=5.2e-09  Score=70.95  Aligned_cols=123  Identities=14%  Similarity=0.153  Sum_probs=77.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCC-CEE-EECCCCCE-EE-----ECCEEEEEEE----EEEEECCCEEEEEECCHH
Q ss_conf             668689997489988989999973897-379-87388841-45-----2120266555----678508964999976001
Q gi|254780484|r   27 AGPPEIAFSGRSNVGKSSLINILVNRK-NLA-RTSNAPGR-TQ-----HLNFFVPKDF----SNLKNNLPAMALVDMPGY   94 (212)
Q Consensus        27 ~~~p~VaivG~~NvGKSSLiNaL~g~~-~~a-~~~~~p~t-t~-----~~~~~~~~~~----~~~~~~~~~~~~~DtpG~   94 (212)
                      +++..|||+|+..+||+||.-+|.-.. .+. .+....+. +.     ..+.+.....    -...+....+.++||||+
T Consensus        18 e~IRNI~IiaHvdaGKTTLtE~lL~~sg~i~~~~~~~~t~~D~~~~E~eRgITI~sa~~sl~~~~~~~~~~INlIDTPGh   97 (730)
T PRK07560         18 EQIRNIGIVAHIDHGKTTLSDNLLAGAGMISEELAGKQLALDYDEEEQARGITIKAANVSMVHEYEGKEYLINLIDTPGH   97 (730)
T ss_pred             HHCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCEECCCHHHHHHCCCCEEECCEEEEEEECCCCEEEEEECCCCC
T ss_conf             63528999937998989999999996499865347986417885999972985752110289875698378999819697


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             01112244789888899877776642000001122357887545455432102575322122221111
Q gi|254780484|r   95 GYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL  162 (212)
Q Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~  162 (212)
                      .++...             ......+++..+.+.++..+...+.............|.++++||+|.+
T Consensus        98 ~DF~~E-------------v~~aLrv~DgAvvVvdav~GV~~qTe~v~rqa~~~~~p~ilfINKmDR~  152 (730)
T PRK07560         98 VDFGGD-------------VTRAMRAVDGAIVVVDAVEGVMPQTETVLRQALEERVRPVLFINKVDRL  152 (730)
T ss_pred             CHHHHH-------------HHHHHHHHCEEEEEEECCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             305999-------------9999988587899997898877318999999987799979998686623


No 266
>KOG0395 consensus
Probab=98.95  E-value=8.2e-10  Score=75.54  Aligned_cols=159  Identities=16%  Similarity=0.197  Sum_probs=85.1

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      ..+|+++|.++||||+|...+.+.... .  .+..|...    ..............+.+.||+|.........      
T Consensus         3 ~~kvvvlG~~gVGKSal~~qf~~~~f~-~--~y~ptied----~y~k~~~v~~~~~~l~ilDt~g~~~~~~~~~------   69 (196)
T KOG0395           3 EYKVVVLGAGGVGKSALTIQFLTGRFV-E--DYDPTIED----SYRKELTVDGEVCMLEILDTAGQEEFSAMRD------   69 (196)
T ss_pred             CEEEEEECCCCCCCCCEEEEECCCCCC-C--CCCCCCCC----CEEEEEEECCEEEEEEEEECCCCCCCHHHHH------
T ss_conf             147999778988853057896357554-4--34797676----3159999899788999982888534768888------


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCC---HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             899877776642000001122357887---54545543210257532212222111102468999999999975313689
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRHGVK---QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                          .+......+.++..+.+ ...+.   ....++.........|++++.||+|+.....+.  .++-..+ ..  .+.
T Consensus        70 ----~~~~~~~gF~lVysitd-~~SF~~~~~l~~~I~r~~~~~~~PivlVGNK~Dl~~~R~V~--~eeg~~l-a~--~~~  139 (196)
T KOG0395          70 ----LYIRNGDGFLLVYSITD-RSSFEEAKQLREQILRVKGRDDVPIILVGNKCDLERERQVS--EEEGKAL-AR--SWG  139 (196)
T ss_pred             ----HHHHCCCEEEEEEECCC-HHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCHHHCCCC--HHHHHHH-HH--HHC
T ss_conf             ----77554868999998988-88999999999999864076778879998855532304243--9999999-99--709


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++.+||+.+.+++++...|...+
T Consensus       140 ~~f~E~Sak~~~~v~~~F~~L~r~~  164 (196)
T KOG0395         140 CAFIETSAKLNYNVDEVFYELVREI  164 (196)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             9679975144758899999999999


No 267
>KOG0080 consensus
Probab=98.95  E-value=3.9e-09  Score=71.67  Aligned_cols=157  Identities=18%  Similarity=0.154  Sum_probs=84.7

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      ..+|-|+|-++||||||+-+++....   ....|+ |..  +-.-.....+......+.++||+|.+.+.....-..+  
T Consensus        11 t~KiLlIGeSGVGKSSLllrFv~~~f---d~~~~~-tIG--vDFkvk~m~vdg~~~KlaiWDTAGqErFRtLTpSyyR--   82 (209)
T KOG0080          11 TFKILLIGESGVGKSSLLLRFVSNTF---DDLHPT-TIG--VDFKVKVMQVDGKRLKLAIWDTAGQERFRTLTPSYYR--   82 (209)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHCCC---CCCCCC-EEE--EEEEEEEEEECCCEEEEEEEECCCHHHHHCCCHHHHC--
T ss_conf             47999981687657899999876436---766773-443--4578899987582678998743452766116876745--


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCC--CCCHHHH---HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             899877776642000001122357--8875454---55432102575322122221111024689999999999753136
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRH--GVKQIDQ---DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT  183 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~---~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~  183 (212)
                                 -...++.+.|...  .+.+.+.   ++..+.....+..++|.||+|+-....+.  .   ++-++....
T Consensus        83 -----------gaqGiIlVYDVT~Rdtf~kLd~W~~Eld~Ystn~diikmlVgNKiDkes~R~V~--r---eEG~kfAr~  146 (209)
T KOG0080          83 -----------GAQGIILVYDVTSRDTFVKLDIWLKELDLYSTNPDIIKMLVGNKIDKESERVVD--R---EEGLKFARK  146 (209)
T ss_pred             -----------CCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHCCCCCCHHCCCCC--H---HHHHHHHHH
T ss_conf             -----------575069999712235677599999988764488137676542544501202134--8---887899986


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             89868999888889989999999987
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      ..--++..||++.+|+...++.+.+-
T Consensus       147 h~~LFiE~SAkt~~~V~~~FeelveK  172 (209)
T KOG0080         147 HRCLFIECSAKTRENVQCCFEELVEK  172 (209)
T ss_pred             HCCEEEECCHHHHCCHHHHHHHHHHH
T ss_conf             08278982543430188899999999


No 268
>KOG2485 consensus
Probab=98.93  E-value=8e-09  Score=69.86  Aligned_cols=68  Identities=34%  Similarity=0.407  Sum_probs=51.1

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCC----CCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH
Q ss_conf             6868999748998898999997389----7379873888414521202665556785089649999760010111224
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNR----KNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~----~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~  101 (212)
                      ..+.|-++|-||||||||+|++-..    +..+.+...||.|+..      .........+++.++||||........
T Consensus       142 ~~~~vmVvGvPNVGKSsLINa~r~~~Lrk~k~a~vG~~pGVT~~V------~~~iri~~rp~vy~iDTPGil~P~I~~  213 (335)
T KOG2485         142 SEYNVMVVGVPNVGKSSLINALRNVHLRKKKAARVGAEPGVTRRV------SERIRISHRPPVYLIDTPGILVPSIVD  213 (335)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCEECCCCCCCEEEE------HHHEEECCCCCEEEECCCCCCCCCCCC
T ss_conf             702699973898880889999998876530000106888852231------212574368965886688757988779


No 269
>KOG0075 consensus
Probab=98.92  E-value=1.6e-09  Score=73.93  Aligned_cols=155  Identities=15%  Similarity=0.196  Sum_probs=90.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .++.++|..|+|||||+|.+....-.  .+-.|  |...+      ......+..++.+.|.||...++.        ..
T Consensus        21 mel~lvGLq~sGKtt~Vnvia~g~~~--edmip--tvGfn------mrkvtkgnvtik~wD~gGq~rfrs--------mW   82 (186)
T KOG0075          21 MELSLVGLQNSGKTTLVNVIARGQYL--EDMIP--TVGFN------MRKVTKGNVTIKLWDLGGQPRFRS--------MW   82 (186)
T ss_pred             EEEEEEEECCCCCCEEEEEEECCCCH--HHHCC--CCCCE------EEEECCCCEEEEEEECCCCCCHHH--------HH
T ss_conf             15888853247852588887506745--66430--24632------688315836999983699760888--------99


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC-----CHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             9987777664200000112235788-----75454554321025753221222211110246899999999997531368
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV-----KQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                      ....     .......++.|+.+..     +.....+.......++|.++..||.|+-+.-.....++.+  .+.....-
T Consensus        83 eryc-----R~v~aivY~VDaad~~k~~~sR~EL~~LL~k~~l~gip~LVLGnK~d~~~AL~~~~li~rm--gL~sitdR  155 (186)
T KOG0075          83 ERYC-----RGVSAIVYVVDAADPDKLEASRSELHDLLDKPSLTGIPLLVLGNKIDLPGALSKIALIERM--GLSSITDR  155 (186)
T ss_pred             HHHH-----CCCCEEEEEEECCCCCCCHHHHHHHHHHHCCHHHCCCCEEEECCCCCCCCCCCHHHHHHHH--CCCCCCCC
T ss_conf             9986-----0386899996167865343129999988503211487179962556675532278999983--84524464


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             9868999888889989999999987
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      ..-++.||++...|||...+.|.++
T Consensus       156 EvcC~siScke~~Nid~~~~Wli~h  180 (186)
T KOG0075         156 EVCCFSISCKEKVNIDITLDWLIEH  180 (186)
T ss_pred             EEEEEEEEECCCCCHHHHHHHHHHH
T ss_conf             5789999876875689999999997


No 270
>KOG0458 consensus
Probab=98.91  E-value=1.3e-08  Score=68.69  Aligned_cols=160  Identities=16%  Similarity=0.187  Sum_probs=95.6

Q ss_pred             CCEEEEECCCCCCHHHHHHHHH---CCC--------------------CEEEECCCCCEEEECCEEEEEEEEEEEECCCE
Q ss_conf             8689997489988989999973---897--------------------37987388841452120266555678508964
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILV---NRK--------------------NLARTSNAPGRTQHLNFFVPKDFSNLKNNLPA   85 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~---g~~--------------------~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~   85 (212)
                      ....+++|+.++|||||+-+|+   |.-                    ..+-+-+.+...+..+.+.......+.-....
T Consensus       177 ~l~lvv~GhVdaGKSTLmG~lLydLg~i~~~~m~kl~~es~~~Gk~Sf~yawiLDeT~eERerGvTm~v~~~~fes~~~~  256 (603)
T KOG0458         177 HLNLVVLGHVDAGKSTLMGHLLYDLGEISSRSMHKLERESKNLGKSSFAYAWILDETKEERERGVTMDVKTTWFESKSKI  256 (603)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHCCEEEEEEEEEEECCCEE
T ss_conf             15899970234541110237888736865788999999987528753025677436312454363677546898468616


Q ss_pred             EEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC-------CCHHHHHHHHHHCCCCCC-CCCCCC
Q ss_conf             999976001011122447898888998777766420000011223578-------875454554321025753-221222
Q gi|254780484|r   86 MALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG-------VKQIDQDVFSFLDKKAVS-YQIVLT  157 (212)
Q Consensus        86 ~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~-~~~v~n  157 (212)
                      +.++|+||+..+....-.             .+..++..+++.++..+       ...+..+....+...++. .++++|
T Consensus       257 ~tliDaPGhkdFi~nmi~-------------g~sqaD~avLvvd~s~~~FE~gfd~~gQtrEha~llr~Lgi~qlivaiN  323 (603)
T KOG0458         257 VTLIDAPGHKDFIPNMIS-------------GASQADVAVLVVDASTGEFESGFDPGGQTREHALLLRSLGISQLIVAIN  323 (603)
T ss_pred             EEEECCCCCCCCCHHHHC-------------CCCCCCEEEEEEECCCCHHHHCCCCCCCHHHHHHHHHHCCCCEEEEEEE
T ss_conf             998607874235523433-------------6221566899998775433313487986589999998749525888863


Q ss_pred             CCCCCCH--HHHHHHHHHHHHHH-HHCC--CCCCCEEEEECCCCCCHHH
Q ss_conf             2111102--46899999999997-5313--6898689998888899899
Q gi|254780484|r  158 KIDKLSP--TTAQETLEKTKYLI-RNYP--TAHPEVIPTSSVKRKGIEV  201 (212)
Q Consensus       158 K~D~~~~--~~~~~~~~~~~~~~-~~~~--~~~~~i~~vSA~~g~Gi~e  201 (212)
                      |+|.+.=  +.-.+....+...+ +...  ......+|+|+.+|+|+-.
T Consensus       324 KmD~V~Wsq~RF~eIk~~l~~fL~~~~gf~es~v~FIPiSGl~GeNL~k  372 (603)
T KOG0458         324 KMDLVSWSQDRFEEIKNKLSSFLKESCGFKESSVKFIPISGLSGENLIK  372 (603)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
T ss_conf             0101275388999999989999998528504776569554656776212


No 271
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=98.91  E-value=6.3e-09  Score=70.46  Aligned_cols=63  Identities=21%  Similarity=0.202  Sum_probs=47.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHH
Q ss_conf             6899974899889899999738973798738884145212026655567850896499997600101112
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARA   99 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~   99 (212)
                      ..|-++|+++|||||-+|.|+|++..+.....|.|++-       .+......+..+.++||||+.....
T Consensus        32 ltILvlGKtGVGKSsTINSifgE~~~~~~aF~~~t~r~-------~~v~~tv~G~kl~iIDTPGL~~~~~   94 (249)
T cd01853          32 LTILVLGKTGVGKSSTINSIFGERKAATSAFQSETLRV-------REVSGTVDGFKLNIIDTPGLLESVM   94 (249)
T ss_pred             EEEEEEECCCCCHHHHHHHHCCCCCCCCCCCCCCCCCE-------EEEEEEECCEEEEEECCCCCCCCCC
T ss_conf             69999806876457767765085413447767788650-------8998753344899860898776654


No 272
>cd01882 BMS1 Bms1.  Bms1 is an essential, evolutionarily conserved, nucleolar protein.  Its depletion interferes with processing of the 35S pre-rRNA at sites A0, A1, and A2, and the formation of 40S subunits.  Bms1, the putative endonuclease Rc11, and the essential U3 small nucleolar RNA form a stable subcomplex that is believed to control an early step in the formation of the 40S subumit.  The C-terminal domain of Bms1 contains a GTPase-activating protein (GAP) that functions intramolecularly.  It is believed that Rc11 activates Bms1 by acting as a guanine-nucleotide exchange factor (GEF) to promote GDP/GTP exchange, and that activated (GTP-bound) Bms1 delivers Rc11 to the preribosomes.
Probab=98.90  E-value=2.3e-08  Score=67.21  Aligned_cols=146  Identities=19%  Similarity=0.247  Sum_probs=94.9

Q ss_pred             HHHCCCCCCC-EEEEECCCCCCHHHHHHHHHCCCCE--EEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHH
Q ss_conf             6758876686-8999748998898999997389737--987388841452120266555678508964999976001011
Q gi|254780484|r   21 IGLLPKAGPP-EIAFSGRSNVGKSSLINILVNRKNL--ARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYA   97 (212)
Q Consensus        21 ~~~~P~~~~p-~VaivG~~NvGKSSLiNaL~g~~~~--a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~   97 (212)
                      .+..|.+.+| -|+++|.|+||||||++.|.....-  ...-..|-             .........+.|++.|.-.  
T Consensus        30 vdr~~~epPP~vVavvGPpgvGKtTLiksLvk~ytk~~l~~i~GPi-------------Tvvs~K~rRiTfiEc~nDi--   94 (225)
T cd01882          30 VDRTPEEPPPLVVAVVGPPGVGKTTLIKSLVKNYTKQNISDIKGPI-------------TVVTGKKRRLTFIECPNDI--   94 (225)
T ss_pred             CCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCCE-------------EEEECCCEEEEEEECCCHH--
T ss_conf             1358789999699998989977889999999998544375578887-------------9994684268999748609--


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-CCCCCCCCCCCCHHHHH-HHHHHHH
Q ss_conf             122447898888998777766420000011223578875454554321025753-22122221111024689-9999999
Q gi|254780484|r   98 RAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS-YQIVLTKIDKLSPTTAQ-ETLEKTK  175 (212)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~~~~~~~~-~~~~~~~  175 (212)
                                    ....+..-.++.++...|...++.....+..+.+...+.| ++-|++..|...+...- +.-+.++
T Consensus        95 --------------~smiD~AKvADlVLl~iD~s~GfEmEtfEfLnilq~hG~PkV~GVltHlD~fk~~k~lrk~KK~lk  160 (225)
T cd01882          95 --------------NAMIDIAKVADLVLLLIDASFGFEMETFEFLNILQVHGFPRVMGVLTHLDLFKKNKTLRKTKKRLK  160 (225)
T ss_pred             --------------HHHHHHHHHHHEEEEEECCCCCEEEEHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             --------------999878876433688861665535208999999997599943788544310155788999999999


Q ss_pred             HHHHHCCCCCCCEEEEECCC
Q ss_conf             99753136898689998888
Q gi|254780484|r  176 YLIRNYPTAHPEVIPTSSVK  195 (212)
Q Consensus       176 ~~~~~~~~~~~~i~~vSA~~  195 (212)
                      ..++..-..+...|..|...
T Consensus       161 ~RFwtE~y~gaKlFylsg~~  180 (225)
T cd01882         161 HRFWTEVYQGAKLFYLSGIV  180 (225)
T ss_pred             HHHHHHHCCCCEEEEECCCC
T ss_conf             99999865995688633532


No 273
>pfam09439 SRPRB Signal recognition particle receptor beta subunit. The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase which anchors the alpha subunit to the endoplasmic reticulum membrane.
Probab=98.90  E-value=3e-08  Score=66.58  Aligned_cols=126  Identities=21%  Similarity=0.323  Sum_probs=67.5

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      ..|.|-|+|..|+||+||++.|...+....     .++..++.    ........+..+.++|+||+...+.        
T Consensus         2 ~~ptvLllGl~~sGKT~Lf~~L~~~~~~~T-----~tS~~~n~----~~~~~~~~~~~~~lvD~PGh~klR~--------   64 (181)
T pfam09439         2 SQPAVIIAGLCDSGKTSLFTLLTTGSVRKT-----VTSQEPSA----AYKYMNNKGNSLTLIDFPGHVKLRY--------   64 (181)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCCCE-----ECCCCCCC----EEEEECCCCCEEEEEECCCCHHHHH--------
T ss_conf             988699986899989999999975994875-----88867864----0687516896689998899689999--------


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCC---CHHHHHHHHHH-----CCCCCCCCCCCCCCCCCC---HHHHHHHHH
Q ss_conf             889987777664200000112235788---75454554321-----025753221222211110---246899999
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGV---KQIDQDVFSFL-----DKKAVSYQIVLTKIDKLS---PTTAQETLE  172 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~-----~~~~~~~~~v~nK~D~~~---~~~~~~~~~  172 (212)
                      ....  ..........+++++|+....   .+.-..+.+.+     .....|+++++||.|+..   ...+...++
T Consensus        65 ~~~~--~~~~~~~~~gIVfVVDS~~~~~~l~~~Ae~Ly~iL~~~~~~~~~vPvLI~cNKqDl~~A~~~~~Ik~~LE  138 (181)
T pfam09439        65 KLLE--TLKDSSSLRGLVFVVDSTAFPKEVTDTAEFLYDILSITELLKNGIDILIACNKQEIFTARPPKKIKQALE  138 (181)
T ss_pred             HHHH--HHHHHCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHCHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHH
T ss_conf             9998--6430026449999997866566799999999999844543368997899973746335779999999999


No 274
>KOG0448 consensus
Probab=98.89  E-value=8.6e-09  Score=69.69  Aligned_cols=156  Identities=17%  Similarity=0.217  Sum_probs=82.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEE---------------------ECCEEEEE------------
Q ss_conf             686899974899889899999738973798738884145---------------------21202665------------
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ---------------------HLNFFVPK------------   74 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~---------------------~~~~~~~~------------   74 (212)
                      .--+|+|.|++|+||||++||+.-++.+. ..-.|+|--                     .+.+....            
T Consensus       108 ~~mKV~ifGrts~GKSt~iNAmL~~klLP-~g~gh~TncF~~VegadG~e~vl~~~~s~ek~d~~ti~~~~haL~~~~~~  186 (749)
T KOG0448         108 RHMKVAIFGRTSAGKSTVINAMLHKKLLP-SGIGHTTNCFLEVEGADGAEAVLATEGSEEKIDMKTINQLAHALKPDKDL  186 (749)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHCCC-CCCCCCCEEEEEECCCCCCCEEECCCCCCCCCCHHHHHHHHHHCCCCCCC
T ss_conf             13479995787776899999999872076-66655312346631467731155168873432188877778751733003


Q ss_pred             ----EEEEEEECC------CEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             ----556785089------6499997600101112244789888899877776642000001122357887545455432
Q gi|254780484|r   75 ----DFSNLKNNL------PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF  144 (212)
Q Consensus        75 ----~~~~~~~~~------~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  144 (212)
                          ...++..++      ..+.++|.||.............       .+   ...++.+++..+.........+++..
T Consensus       187 ~~~sLlrV~~p~~~csLLrnDivliDsPGld~~se~tswid~-------~c---ldaDVfVlV~NaEntlt~sek~Ff~~  256 (749)
T KOG0448         187 GAGSLLRVFWPDDKCSLLRNDIVLIDSPGLDVDSELTSWIDS-------FC---LDADVFVLVVNAENTLTLSEKQFFHK  256 (749)
T ss_pred             CCCEEEEEEECCCCCHHHHCCCEEECCCCCCCCHHHHHHHHH-------HH---HCCCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             765068999428632133055012058888886024599997-------64---40775899961763868989999998


Q ss_pred             HCCCCCCCCCCCCCCCCCCHHH-HH-HHHHHHHHHHHH-CCCCCCCEEEEECC
Q ss_conf             1025753221222211110246-89-999999999753-13689868999888
Q gi|254780484|r  145 LDKKAVSYQIVLTKIDKLSPTT-AQ-ETLEKTKYLIRN-YPTAHPEVIPTSSV  194 (212)
Q Consensus       145 ~~~~~~~~~~v~nK~D~~~~~~-~~-~~~~~~~~~~~~-~~~~~~~i~~vSA~  194 (212)
                      ....+..++++.||+|...++. .. .....+.++-.. +......+++|||+
T Consensus       257 vs~~KpniFIlnnkwDasase~ec~e~V~~Qi~eL~v~~~~eA~DrvfFVS~~  309 (749)
T KOG0448         257 VSEEKPNIFILNNKWDASASEPECKEDVLKQIHELSVVTEKEAADRVFFVSAK  309 (749)
T ss_pred             HHCCCCCEEEEECHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHCCEEEEEECC
T ss_conf             54048847999640122026377899999988751743366636736998453


No 275
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]
Probab=98.89  E-value=2.9e-08  Score=66.68  Aligned_cols=122  Identities=15%  Similarity=0.233  Sum_probs=82.0

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHH--CCC-CE-----EEECCCCCEE------EECCEEEEEEEEEEEECCCEEEEEECCH
Q ss_conf             68689997489988989999973--897-37-----9873888414------5212026655567850896499997600
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILV--NRK-NL-----ARTSNAPGRT------QHLNFFVPKDFSNLKNNLPAMALVDMPG   93 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~--g~~-~~-----a~~~~~p~tt------~~~~~~~~~~~~~~~~~~~~~~~~DtpG   93 (212)
                      .+.+.||+-+|.+||+||--+|+  |.- ..     +.-+..-.+.      ...+.-......+....+..+.+.||||
T Consensus        11 rRRTFAIISHPDAGKTTlTEkLLlfGgaIq~AGtVk~rk~~~~a~SDWM~iEkqRGISVtsSVMqF~Y~~~~iNLLDTPG   90 (528)
T COG4108          11 RRRTFAIISHPDAGKTTLTEKLLLFGGAIQEAGTVKGRKSGKHAKSDWMEIEKQRGISVTSSVMQFDYADCLVNLLDTPG   90 (528)
T ss_pred             HHCCEEEEECCCCCCCCHHHHHHHHCCHHHHCCEEEECCCCCCCCCHHHHHHHHCCCEEEEEEEEEECCCEEEECCCCCC
T ss_conf             43403688568888511889999723034305501222577634227788887568558765787603884886147998


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             101112244789888899877776642000001122357887545455432102575322122221111
Q gi|254780484|r   94 YGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL  162 (212)
Q Consensus        94 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~  162 (212)
                      +..+.....             ......+.+.-++|+-.+...+..++++-+...++|++..+||+|..
T Consensus        91 HeDFSEDTY-------------RtLtAvDsAvMVIDaAKGiE~qT~KLfeVcrlR~iPI~TFiNKlDR~  146 (528)
T COG4108          91 HEDFSEDTY-------------RTLTAVDSAVMVIDAAKGIEPQTLKLFEVCRLRDIPIFTFINKLDRE  146 (528)
T ss_pred             CCCCCHHHH-------------HHHHHHHEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             654323678-------------99986410468986035866889999999850598469975023656


No 276
>KOG0087 consensus
Probab=98.89  E-value=1e-08  Score=69.25  Aligned_cols=157  Identities=16%  Similarity=0.087  Sum_probs=88.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      =+|.++|-|+||||-|+.+++..+... . ..+    ..++........+........++||+|.++++........   
T Consensus        15 FKiVliGDS~VGKsnLlsRftrnEF~~-~-Sks----TIGvef~t~t~~vd~k~vkaqIWDTAGQERyrAitSaYYr---   85 (222)
T KOG0087          15 FKIVLIGDSAVGKSNLLSRFTRNEFSL-E-SKS----TIGVEFATRTVNVDGKTVKAQIWDTAGQERYRAITSAYYR---   85 (222)
T ss_pred             EEEEEECCCCCCHHHHHHHHCCCCCCC-C-CCC----CEEEEEEEEEEEECCCEEEEEEECCCCHHHHCCCCCHHHC---
T ss_conf             899995787655367787743354675-6-666----2468877500235681788765326114565001112213---


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC----CHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9987777664200000112235788----754545543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV----KQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                                -....+.+.|.....    ....+..+.......++++++.||+|+-....+.  .+.-+...+   ..+
T Consensus        86 ----------gAvGAllVYDITr~~Tfenv~rWL~ELRdhad~nIvimLvGNK~DL~~lraV~--te~~k~~Ae---~~~  150 (222)
T KOG0087          86 ----------GAVGALLVYDITRRQTFENVERWLKELRDHADSNIVIMLVGNKSDLNHLRAVP--TEDGKAFAE---KEG  150 (222)
T ss_pred             ----------CCCEEEEEEECHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCHHHHHCCCCC--HHHHHHHHH---HCC
T ss_conf             ----------44036999950467788889999999985588771799961220454334644--566566897---528


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -.++.+||..+.|+++..+.+...+
T Consensus       151 l~f~EtSAl~~tNVe~aF~~~l~~I  175 (222)
T KOG0087         151 LFFLETSALDATNVEKAFERVLTEI  175 (222)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             5478700344432889999999999


No 277
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]
Probab=98.88  E-value=1.5e-08  Score=68.20  Aligned_cols=127  Identities=17%  Similarity=0.236  Sum_probs=88.4

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHH---CCC-CEEEECCCCCE------EEECCEEEEEEEEEEEECC-CEEEEEECC
Q ss_conf             887668689997489988989999973---897-37987388841------4521202665556785089-649999760
Q gi|254780484|r   24 LPKAGPPEIAFSGRSNVGKSSLINILV---NRK-NLARTSNAPGR------TQHLNFFVPKDFSNLKNNL-PAMALVDMP   92 (212)
Q Consensus        24 ~P~~~~p~VaivG~~NvGKSSLiNaL~---g~~-~~a~~~~~p~t------t~~~~~~~~~~~~~~~~~~-~~~~~~Dtp   92 (212)
                      .+..++..|+|+|+..+|||||.-+|.   |.- ....+....++      -+..+.+.........+.+ ..+.++|||
T Consensus         5 ~~~~~~RNigI~aHidaGKTTltE~lL~~tG~i~k~G~v~~g~~~~D~~e~EqeRGITI~saa~s~~~~~~~~iNlIDTP   84 (697)
T COG0480           5 MPLERIRNIGIVAHIDAGKTTLTERILFYTGIISKIGEVHDGAATMDWMEQEQERGITITSAATTLFWKGDYRINLIDTP   84 (697)
T ss_pred             CCCCCCEEEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCEEEEEEEEEEECCCEEEEEECCC
T ss_conf             55445407999960478807788999987597577855667865478878898669778640568997086589995799


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             01011122447898888998777766420000011223578875454554321025753221222211110
Q gi|254780484|r   93 GYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS  163 (212)
Q Consensus        93 G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~  163 (212)
                      |+-++...             .......++..+.+.++..+...|.............|.++++||+|.+.
T Consensus        85 GHVDFt~E-------------V~rslrvlDgavvVvdaveGV~~QTEtv~rqa~~~~vp~i~fiNKmDR~~  142 (697)
T COG0480          85 GHVDFTIE-------------VERSLRVLDGAVVVVDAVEGVEPQTETVWRQADKYGVPRILFVNKMDRLG  142 (697)
T ss_pred             CCCCCHHH-------------HHHHHHHHCCEEEEEECCCCEEECHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             73534778-------------79988861650999988788300379999998655997599997843355


No 278
>TIGR00483 EF-1_alpha translation elongation factor EF-1, subunit alpha; InterPro: IPR004539   Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution.   EF1A (also known as EF-1alpha or EF-Tu) is a G-protein. It forms a ternary complex of EF1A-GTP-aminoacyltRNA. The binding of aminoacyl-tRNA stimulates GTP hydrolysis by EF1A, causing a conformational change in EF1A that causes EF1A-GDP to detach from the ribosome, leaving the aminoacyl-tRNA attached at the A-site. Only the cognate aminoacyl-tRNA can induce the required conformational change in EF1A through its tight anticodon-codon binding , . EF1A-GDP is returned to its active state, EF1A-GTP, through the action of another elongation factor, EF1B (also known as EF-Ts or EF-1beta/gamma/delta).   This entry represents EF1A proteins found primarily in eukaryotic (eEF1A) and archaeal (aEF1A) organisms, these proteins being more closely related to one another than to EF1A (or EF-Tu) found in bacteria (IPR004541 from INTERPRO).   More information about these proteins can be found at Protein of the Month: Elongation Factors . ; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005737 cytoplasm.
Probab=98.85  E-value=1.3e-08  Score=68.71  Aligned_cols=159  Identities=14%  Similarity=0.215  Sum_probs=91.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCC------------CEE-----------EECCCCCEEEECCEEEEEEEEEEEECCCEE
Q ss_conf             689997489988989999973897------------379-----------873888414521202665556785089649
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRK------------NLA-----------RTSNAPGRTQHLNFFVPKDFSNLKNNLPAM   86 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~------------~~a-----------~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~   86 (212)
                      ..|+++|+..+||||++=+|.=+-            ..+           =+.+.--..+..+.+.+.-..-+..+...+
T Consensus         8 ~Nv~~IGHVD~GKST~~G~Lly~~G~I~~~~~eK~~kEa~e~GK~~F~fa~V~D~Lk~ERERGvTID~A~~KFeT~KY~~   87 (445)
T TIGR00483         8 INVAFIGHVDHGKSTLVGRLLYKAGAIDEQLLEKLKKEAQEKGKASFEFAWVMDRLKEERERGVTIDVAHKKFETDKYEV   87 (445)
T ss_pred             EEEEEEEEEECCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCHHHHHHHHCCCCCEEE
T ss_conf             44899825408850266777754289658999999875755187303676543110000015622433445417885169


Q ss_pred             EEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC---C----CCCCCHHHHHHHHHHCCCCCC-CCCCCCC
Q ss_conf             9997600101112244789888899877776642000001122---3----578875454554321025753-2212222
Q gi|254780484|r   87 ALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLID---C----RHGVKQIDQDVFSFLDKKAVS-YQIVLTK  158 (212)
Q Consensus        87 ~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~----~~~~~~~~~~~~~~~~~~~~~-~~~v~nK  158 (212)
                      .++|.||++++-...             ......++..+++.+   .    ......|..+..-+..-.++. .++++||
T Consensus        88 TivDcPGHRDFiKNM-------------ITGaSQADaAvLv~~v~~~~~~ag~~~~pQTrEH~~La~TLGi~QliVAiNK  154 (445)
T TIGR00483        88 TIVDCPGHRDFIKNM-------------ITGASQADAAVLVVAVDDGEFEAGISVQPQTREHVFLARTLGINQLIVAINK  154 (445)
T ss_pred             EEEECCCCCHHHHHC-------------CCCCCCCCEEEEEEECCCCCCCCCEEECCCCHHHHHHHHHHCCEEEEEEECC
T ss_conf             998469870134311-------------2667512427999952544102401217860577888775032045333102


Q ss_pred             CCCCCHH--HHHHHHHHHHH-HHHH--CCCCCCCEEEEECCCCCCHHH
Q ss_conf             1111024--68999999999-9753--136898689998888899899
Q gi|254780484|r  159 IDKLSPT--TAQETLEKTKY-LIRN--YPTAHPEVIPTSSVKRKGIEV  201 (212)
Q Consensus       159 ~D~~~~~--~~~~~~~~~~~-~~~~--~~~~~~~i~~vSA~~g~Gi~e  201 (212)
                      +|.++-+  +-+...+.+.. +++.  |.....+++|+||..|.|+-+
T Consensus       155 MD~V~yd~~~f~~~~~~~s~~l~K~vGY~p~~v~FiP~s~~~GDN~~~  202 (445)
T TIGR00483       155 MDSVNYDEEEFEALKKEVSEQLLKKVGYKPDEVPFIPISAFEGDNVIK  202 (445)
T ss_pred             CCCEECCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCHHH
T ss_conf             461002778999999999998998748875612325403546761343


No 279
>KOG2484 consensus
Probab=98.84  E-value=1.5e-09  Score=74.08  Aligned_cols=62  Identities=32%  Similarity=0.410  Sum_probs=48.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH
Q ss_conf             689997489988989999973897379873888414521202665556785089649999760010111224
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~  101 (212)
                      .+|+|+|+|||||||+||+|..++. ..+...||.|+..         +....+..+.++|.||+.......
T Consensus       253 IrvGViG~PNVGKSSvINsL~~~k~-C~vg~~pGvT~sm---------qeV~Ldk~i~llDsPgiv~~~~~~  314 (435)
T KOG2484         253 IRVGIIGYPNVGKSSVINSLKRRKA-CNVGNVPGVTRSM---------QEVKLDKKIRLLDSPGIVPPSIDE  314 (435)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHCC-CCCCCCCCCHHHH---------HHEECCCCCEECCCCCEEECCCCC
T ss_conf             6864324888771699999877404-6677875500354---------530056773230478632067786


No 280
>PRK01889 ribosome-associated GTPase; Reviewed
Probab=98.81  E-value=1.1e-08  Score=69.16  Aligned_cols=69  Identities=23%  Similarity=0.290  Sum_probs=40.8

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCE--EEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHH
Q ss_conf             68999748998898999997389737--987388841452120266555678508964999976001011122447
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNL--ARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKN  103 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~--a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~  103 (212)
                      -.++++|.++||||||+|+|.|....  ..++...++-+.+  ++   ...+..-.....++||||+.........
T Consensus       195 kT~vl~G~SGVGKSTLiN~L~g~~~~~t~~is~~~~kGRHT--Tt---~reL~~lp~Gg~lIDTPG~Re~~l~~~~  265 (353)
T PRK01889        195 KTVALLGSSGVGKSTLVNALLGEEVQKTGAVREDDSKGRHT--TT---HRELHPLPSGGLLIDTPGMRELQLWDCE  265 (353)
T ss_pred             CEEEEECCCCCCHHHHHHHHCCHHHHHHHCCCCCCCCCEEC--CC---EEEEEECCCCCEEEECCCCCCCCCCCCH
T ss_conf             78999778886699999875653453441500036995001--24---0689994899589737986546777848


No 281
>KOG0467 consensus
Probab=98.79  E-value=4.7e-08  Score=65.43  Aligned_cols=168  Identities=23%  Similarity=0.248  Sum_probs=108.6

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEE---------EECCCEEEEEECCHH
Q ss_conf             88766868999748998898999997389737987388841452120266555678---------508964999976001
Q gi|254780484|r   24 LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNL---------KNNLPAMALVDMPGY   94 (212)
Q Consensus        24 ~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~---------~~~~~~~~~~DtpG~   94 (212)
                      -|.+++..|+|+.+..+||+||...|....- .+.+.-.|+-+-..+..++.....         ...+.-+.++|+||+
T Consensus         4 ~~~~~irn~~~vahvdhgktsladsl~asng-vis~rlagkirfld~redeq~rgitmkss~is~~~~~~~~nlidspgh   82 (887)
T KOG0467           4 KGSEGIRNICLVAHVDHGKTSLADSLVASNG-VISSRLAGKIRFLDTREDEQTRGITMKSSAISLLHKDYLINLIDSPGH   82 (887)
T ss_pred             CCCCCEEEEEEEEEECCCCCCHHHHHHHHCC-EECHHHCCCEEECCCCCHHHHHCEEEECCCCCCCCCCEEEEEECCCCC
T ss_conf             7877505899999964885325777875066-741533560662104625666162443131110137658998558986


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC------CHHHHH
Q ss_conf             01112244789888899877776642000001122357887545455432102575322122221111------024689
Q gi|254780484|r   95 GYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL------SPTTAQ  168 (212)
Q Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~------~~~~~~  168 (212)
                      .++...             ...+....+...+.+|...+...+........+..+...++|+||+|.+      .+.+.-
T Consensus        83 vdf~se-------------vssas~l~d~alvlvdvvegv~~qt~~vlrq~~~~~~~~~lvinkidrl~~el~lsp~ea~  149 (887)
T KOG0467          83 VDFSSE-------------VSSASRLSDGALVLVDVVEGVCSQTYAVLRQAWIEGLKPILVINKIDRLITELKLSPQEAY  149 (887)
T ss_pred             CCHHHH-------------HHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEHHHHHHHHHHCCHHHHH
T ss_conf             450655-------------3266650477189996002545538999999997167459997316667888716969999


Q ss_pred             H----HHHHHHHHH---------------------HHCCCCCCCEEEEECCCCCCH--HHHHHH
Q ss_conf             9----999999997---------------------531368986899988888998--999999
Q gi|254780484|r  169 E----TLEKTKYLI---------------------RNYPTAHPEVIPTSSVKRKGI--EVLRKA  205 (212)
Q Consensus       169 ~----~~~~~~~~~---------------------~~~~~~~~~i~~vSA~~g~Gi--~eL~~~  205 (212)
                      .    .++.++..+                     ..+.....++++.||..|+|+  +++-+.
T Consensus       150 ~~l~r~i~~vn~~i~~~~~~~v~l~~~~~~i~d~~~~F~p~kgNVif~~A~~~~~f~~~~fak~  213 (887)
T KOG0467         150 EHLLRVIEQVNGVIGQFLGGIVELDDNWENIEDEEITFGPEDGNVIFASALDGWGFGIEQFAKF  213 (887)
T ss_pred             HHHHHHHHHHHHHHHHHHCCHHHCCCHHHHHHHCCEEECCCCCCEEEEEECCCCCCCHHHHHHH
T ss_conf             9999999986668887641111102103221010004367788489987101562019999999


No 282
>KOG0073 consensus
Probab=98.79  E-value=8.2e-08  Score=64.04  Aligned_cols=154  Identities=12%  Similarity=0.152  Sum_probs=88.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|-|+|.-|+||+|++++|.|.... .++  |+.  .     . .-......+.++.+.|..|...      ....+..
T Consensus        17 ~riLiLGLdNsGKTti~~kl~~~~~~-~i~--pt~--g-----f-~Iktl~~~~~~L~iwDvGGq~~------lr~~W~n   79 (185)
T KOG0073          17 VRILILGLDNSGKTTIVKKLLGEDTD-TIS--PTL--G-----F-QIKTLEYKGYTLNIWDVGGQKT------LRSYWKN   79 (185)
T ss_pred             EEEEEEECCCCCCHHHHHHHCCCCCC-CCC--CCC--C-----E-EEEEEEECCEEEEEEECCCCCH------HHHHHHH
T ss_conf             47999912789824489885389822-328--721--1-----3-5578774242899997488533------6878877


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHH-----HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC-CC
Q ss_conf             998777766420000011223578875454-----554321025753221222211110246899999999997531-36
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQ-----DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY-PT  183 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~-~~  183 (212)
                      -.       ...+..+++.|.....+-++.     .........+.|.+++.||.|....-... .+...-. +.++ ..
T Consensus        80 Yf-------estdglIwvvDssD~~r~~e~~~~L~~lL~eerlaG~~~Lvlank~dl~~~l~~~-~i~~~~~-L~~l~ks  150 (185)
T KOG0073          80 YF-------ESTDGLIWVVDSSDRMRMQECKQELTELLVEERLAGAPLLVLANKQDLPGALSLE-EISKALD-LEELAKS  150 (185)
T ss_pred             HH-------HCCCEEEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHH-HHHHHHC-HHHHCCC
T ss_conf             66-------5047289999772088899999999999756543488439997347685524787-8887647-7876133


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             89868999888889989999999987
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      ...+++-+||.+|+++.+=.+.|++.
T Consensus       151 ~~~~l~~cs~~tge~l~~gidWL~~~  176 (185)
T KOG0073         151 HHWRLVKCSAVTGEDLLEGIDWLCDD  176 (185)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHH
T ss_conf             67228998545456478888999999


No 283
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]
Probab=98.79  E-value=2.9e-07  Score=60.86  Aligned_cols=155  Identities=23%  Similarity=0.351  Sum_probs=86.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEEC---CCCCEEEECCEEEEEEEEEEEECCC--EEEEEECCHHHHHHHHH---
Q ss_conf             689997489988989999973897379873---8884145212026655567850896--49999760010111224---
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTS---NAPGRTQHLNFFVPKDFSNLKNNLP--AMALVDMPGYGYARAPK---  101 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~---~~p~tt~~~~~~~~~~~~~~~~~~~--~~~~~DtpG~~~~~~~~---  101 (212)
                      -.|.++|..+.||||++|.|+++. +....   +..+....+.............++.  .+.++||||++......   
T Consensus        24 f~im~~G~sG~GKttfiNtL~~~~-l~~~~~~~~~~~~~~~~~~~i~~~~~~l~e~~~~~~l~vIDtpGfGD~idNs~~w  102 (373)
T COG5019          24 FTIMVVGESGLGKTTFINTLFGTS-LVDETEIDDIRAEGTSPTLEIKITKAELEEDGFHLNLTVIDTPGFGDFIDNSKCW  102 (373)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHH-CCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCEEEEEEEECCCCCCCCCCCCCCH
T ss_conf             389996278875557887656765-2577775576666677625888643166048748988886158865654641017


Q ss_pred             -HHHHHHHHHHHHHHH------------HHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             -478988889987777------------6642000001122357887545455432102575322122221111024689
Q gi|254780484|r  102 -KNVDSWGGLIVRYLS------------ERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQ  168 (212)
Q Consensus       102 -~~~~~~~~~~~~~~~------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~  168 (212)
                       ............+..            +..+-++..++.....+....+...+..+.. ....+.|+.|+|.+..+++.
T Consensus       103 e~I~~yI~~q~d~yl~~E~~~~R~~~~~D~RVH~cLYFI~Ptgh~l~~~DIe~Mk~ls~-~vNlIPVI~KaD~lT~~El~  181 (373)
T COG5019         103 EPIVDYIDDQFDQYLDEEQKIKRNPKFKDTRVHACLYFIRPTGHGLKPLDIEAMKRLSK-RVNLIPVIAKADTLTDDELA  181 (373)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHC-CCCEEEEEECCCCCCHHHHH
T ss_conf             99999999999999998643455665446824899998468988787888999999853-36756566246658999999


Q ss_pred             HHHHHHHHHHHHCCCCCCCEE
Q ss_conf             999999999753136898689
Q gi|254780484|r  169 ETLEKTKYLIRNYPTAHPEVI  189 (212)
Q Consensus       169 ~~~~~~~~~~~~~~~~~~~i~  189 (212)
                      ..-+.+.+.+..+   ..+++
T Consensus       182 ~~K~~I~~~i~~~---nI~vf  199 (373)
T COG5019         182 EFKERIREDLEQY---NIPVF  199 (373)
T ss_pred             HHHHHHHHHHHHH---CCCEE
T ss_conf             9999999999981---87622


No 284
>KOG0095 consensus
Probab=98.75  E-value=9.7e-08  Score=63.63  Aligned_cols=161  Identities=13%  Similarity=0.045  Sum_probs=94.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      -+|.+||.-+|||+-|+.+++-. .     .-||.....+.........+..+...+.++||+|.+++....+...+..+
T Consensus         8 fkivlvgnagvgktclvrrftqg-l-----fppgqgatigvdfmiktvev~gekiklqiwdtagqerfrsitqsyyrsah   81 (213)
T KOG0095           8 FKIVLVGNAGVGKTCLVRRFTQG-L-----FPPGQGATIGVDFMIKTVEVNGEKIKLQIWDTAGQERFRSITQSYYRSAH   81 (213)
T ss_pred             EEEEEECCCCCCCCHHHHHHHCC-C-----CCCCCCCEEEEEEEEEEEEECCEEEEEEEEECCCHHHHHHHHHHHHHHCC
T ss_conf             78999735776733004455226-7-----89998766423379999998780899998413256888888998864116


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEE
Q ss_conf             99877776642000001122357887545455432102575322122221111024689999999999753136898689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVI  189 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~  189 (212)
                              ...+..++...... ......+..++.......-.++|.||+|+.+..++...+.   +.+.+.  .+.-++
T Consensus        82 --------alilvydiscqpsf-dclpewlreie~yan~kvlkilvgnk~d~~drrevp~qig---eefs~~--qdmyfl  147 (213)
T KOG0095          82 --------ALILVYDISCQPSF-DCLPEWLREIEQYANNKVLKILVGNKIDLADRREVPQQIG---EEFSEA--QDMYFL  147 (213)
T ss_pred             --------EEEEEEECCCCCCH-HHHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHH---HHHHHH--HHHHHH
T ss_conf             --------48999853457431-0139999999998506427876146656123333058887---888775--556653


Q ss_pred             EEECCCCCCHHHHHHHHHHHH
Q ss_conf             998888899899999999872
Q gi|254780484|r  190 PTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       190 ~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+||+...|++.|...+.-.|
T Consensus       148 etsakea~nve~lf~~~a~rl  168 (213)
T KOG0095         148 ETSAKEADNVEKLFLDLACRL  168 (213)
T ss_pred             HHCCCCHHHHHHHHHHHHHHH
T ss_conf             202000103999999999999


No 285
>TIGR00650 MG442 GTP-binding conserved hypothetical protein; InterPro: IPR005289   This is a GTP-binding domain, that was found in proteins from various families (Ras GTPase superfamily, HSR1-related GTP-binding protein), which perform different functions.; GO: 0005525 GTP binding.
Probab=98.74  E-value=1.2e-08  Score=68.90  Aligned_cols=31  Identities=52%  Similarity=0.757  Sum_probs=28.1

Q ss_pred             ECCCCCCHH-------------HHHHHHHCCC-----------------------------CEEEECCCCCEE
Q ss_conf             748998898-------------9999973897-----------------------------379873888414
Q gi|254780484|r   35 SGRSNVGKS-------------SLINILVNRK-----------------------------NLARTSNAPGRT   65 (212)
Q Consensus        35 vG~~NvGKS-------------SLiNaL~g~~-----------------------------~~a~~~~~p~tt   65 (212)
                      +|.||||||             ||||+|.+++                             ..+.+++.||.|
T Consensus         1 ~G~PNVGKSkieYktaievaaGsliN~L~~kr~d~avRaikYLkeRkLGRatFLPLDRieG~~a~~~~~aG~T   73 (123)
T TIGR00650         1 IGVPNVGKSKIEYKTAIEVAAGSLINLLLNKRMDDAVRAIKYLKERKLGRATFLPLDRIEGNEAKVADRAGVT   73 (123)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCEECCCCCCCCCCEEEECCCCCCC
T ss_conf             9868987642102345567778899998621234278888876520245200164421257466651789840


No 286
>cd01854 YjeQ_engC YjeQ/EngC.  YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.
Probab=98.70  E-value=2.1e-08  Score=67.47  Aligned_cols=67  Identities=31%  Similarity=0.353  Sum_probs=39.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEE--EECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH
Q ss_conf             689997489988989999973897379--873888414521202665556785089649999760010111224
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLA--RTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a--~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~  101 (212)
                      -..+++|.++||||||+|+|.+.....  .++...++-+.  +++.   ..+..-.....++||||+.......
T Consensus       162 k~~v~~G~SGvGKSSLiN~L~~~~~~~t~~vs~~~~rGrH--TTt~---~~L~~l~~gg~iiDTPG~r~~~l~~  230 (287)
T cd01854         162 KTSVLVGQSGVGKSTLINALLPDLDLATGEISEKLGRGRH--TTTH---RELFPLPGGGLLIDTPGFREFGLLH  230 (287)
T ss_pred             CEEEEECCCCCCHHHHHHHHCCHHHHHHHHHHHHHCCCCE--EEEE---EEEEECCCCCEEEECCCCCCCCCCC
T ss_conf             8899988998888999987462121256666776089850--1415---7999928995898689876356777


No 287
>KOG0090 consensus
Probab=98.69  E-value=1e-07  Score=63.53  Aligned_cols=163  Identities=15%  Similarity=0.193  Sum_probs=85.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             76686899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      +...+.|-++|..|+||+|||-.|.-...     ..+.|...++      .+..........++|.||+.+.+..-    
T Consensus        35 rs~~~~Vll~Gl~dSGKT~LF~qL~~gs~-----~~TvtSiepn------~a~~r~gs~~~~LVD~PGH~rlR~kl----   99 (238)
T KOG0090          35 RSKQNAVLLVGLSDSGKTSLFTQLITGSH-----RGTVTSIEPN------EATYRLGSENVTLVDLPGHSRLRRKL----   99 (238)
T ss_pred             HCCCCCEEEEECCCCCCEEEEEEHHCCCC-----CCEEEEECCC------EEEEEECCCCEEEEECCCCHHHHHHH----
T ss_conf             32688689993278983355420013873-----6703210466------13576368623887579958899999----


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHH---HHHHHH---HH--CCCCCCCCCCCCCCCCCCH---HHHH----HH
Q ss_conf             88889987777664200000112235788754---545543---21--0257532212222111102---4689----99
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI---DQDVFS---FL--DKKAVSYQIVLTKIDKLSP---TTAQ----ET  170 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~---~~--~~~~~~~~~v~nK~D~~~~---~~~~----~~  170 (212)
                           .+.... ......+.++.|.....++.   -.-++.   ..  .....|+++.+||-|+...   +.++    ..
T Consensus       100 -----~e~~~~-~~~akaiVFVVDSa~f~k~vrdvaefLydil~~~~~~~~~~~vLIaCNKqDl~tAkt~~~Ir~~LEkE  173 (238)
T KOG0090         100 -----LEYLKH-NYSAKAIVFVVDSATFLKNVRDVAEFLYDILLDSRVKKNKPPVLIACNKQDLFTAKTAEKIRQQLEKE  173 (238)
T ss_pred             -----HHHCCC-CCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCHHHHHCCCHHHHHHHHHHH
T ss_conf             -----987346-55221599998332246006799999999998601234799889995552232138599999999999


Q ss_pred             HHHHHHHHH--------------------------HCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             999999975--------------------------3136898689998888899899999999872
Q gi|254780484|r  171 LEKTKYLIR--------------------------NYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       171 ~~~~~~~~~--------------------------~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +..+++...                          ........+.+.|+++| +++++.++|.+.|
T Consensus       174 i~~lr~sRsa~~~~~~ed~~~~~tlg~~g~dF~fs~l~~~~V~F~e~S~~~~-~i~~~~~wi~~~l  238 (238)
T KOG0090         174 IHKLRESRSALRSISDEDIAKDFTLGKEGEDFKFSHLEDQKVTFAEASAKTG-EIDQWESWIREAL  238 (238)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHCCCCEEEEEECCCCCC-CHHHHHHHHHHHC
T ss_conf             9999987765302563001354313643310102015623257865146767-7589999999759


No 288
>KOG1532 consensus
Probab=98.68  E-value=3.2e-08  Score=66.39  Aligned_cols=177  Identities=20%  Similarity=0.165  Sum_probs=91.8

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCC---CC--EEEECCCCCEE--------------------------------EECCE
Q ss_conf             6868999748998898999997389---73--79873888414--------------------------------52120
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNR---KN--LARTSNAPGRT--------------------------------QHLNF   70 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~---~~--~a~~~~~p~tt--------------------------------~~~~~   70 (212)
                      .++-|.++|--++||+|++.+|...   +.  .-.+.-.|-..                                ...|.
T Consensus        18 ~p~~ilVvGMAGSGKTTF~QrL~~hl~~~~~ppYviNLDPAv~~vpy~aniDIRDtVkYkEvMkqY~LGPNGgI~TsLNL   97 (366)
T KOG1532          18 RPVIILVVGMAGSGKTTFMQRLNSHLHAKKTPPYVINLDPAVRNVPYPANIDIRDTVKYKEVMKQYQLGPNGGIVTSLNL   97 (366)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEECCHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             87079999447788413999999998623699808867888854888667756654309999998388998640335899


Q ss_pred             EEEEEEE-----EEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC-----HHHHH
Q ss_conf             2665556-----7850896499997600101112244789888899877776642000001122357887-----54545
Q gi|254780484|r   71 FVPKDFS-----NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVK-----QIDQD  140 (212)
Q Consensus        71 ~~~~~~~-----~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~  140 (212)
                      +......     ....+...+.++||||....=.+..-..   ++.+...  ..-..++.++.|....-.     ..-+-
T Consensus        98 F~tk~dqv~~~iek~~~~~~~~liDTPGQIE~FtWSAsGs---IIte~la--ss~ptvv~YvvDt~rs~~p~tFMSNMlY  172 (366)
T KOG1532          98 FATKFDQVIELIEKRAEEFDYVLIDTPGQIEAFTWSASGS---IITETLA--SSFPTVVVYVVDTPRSTSPTTFMSNMLY  172 (366)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCCEEEEEECCCCC---CHHHHHH--HCCCEEEEEEECCCCCCCCHHHHHHHHH
T ss_conf             9987899999999742204779974888068998427850---1586676--1398599999447767884169988999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCHHHHHH---HHHHHHHH-------------------HHHCCCCCCCEEEEECCCCCC
Q ss_conf             54321025753221222211110246899---99999999-------------------753136898689998888899
Q gi|254780484|r  141 VFSFLDKKAVSYQIVLTKIDKLSPTTAQE---TLEKTKYL-------------------IRNYPTAHPEVIPTSSVKRKG  198 (212)
Q Consensus       141 ~~~~~~~~~~~~~~v~nK~D~~~~~~~~~---~~~~~~~~-------------------~~~~~~~~~~i~~vSA~~g~G  198 (212)
                      ....+.....|.++++||+|..+.....+   ..+..++.                   +.+ +......+.|||.+|.|
T Consensus       173 AcSilyktklp~ivvfNK~Dv~d~~fa~eWm~DfE~FqeAl~~~~~~y~s~l~~SmSL~lee-FY~~lrtv~VSs~tG~G  251 (366)
T KOG1532         173 ACSILYKTKLPFIVVFNKTDVSDSEFALEWMTDFEAFQEALNEAESSYMSNLTRSMSLMLEE-FYRSLRTVGVSSVTGEG  251 (366)
T ss_pred             HHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH-HHHHCCEEEEECCCCCC
T ss_conf             99999862687699971434456188999999999999999763032667766547989999-98317557774045786


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             899999999872
Q gi|254780484|r  199 IEVLRKAILETI  210 (212)
Q Consensus       199 i~eL~~~I~~~l  210 (212)
                      ++++..++.+.+
T Consensus       252 ~ddf~~av~~~v  263 (366)
T KOG1532         252 FDDFFTAVDESV  263 (366)
T ss_pred             HHHHHHHHHHHH
T ss_conf             788999999999


No 289
>KOG0466 consensus
Probab=98.67  E-value=9.8e-08  Score=63.59  Aligned_cols=161  Identities=19%  Similarity=0.247  Sum_probs=94.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCC----------EE--------EEC-------CCCCEEEECCEEEEEEEEEEEEC--
Q ss_conf             6899974899889899999738973----------79--------873-------88841452120266555678508--
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKN----------LA--------RTS-------NAPGRTQHLNFFVPKDFSNLKNN--   82 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~----------~a--------~~~-------~~p~tt~~~~~~~~~~~~~~~~~--   82 (212)
                      ..|+-+|+.-+||||++.|++|-..          +.        ..+       +.|...+.        .+....+  
T Consensus        39 iNIGTIGHVAHGKSTvVkAiSGv~TvrFK~ELERNITIKLGYANAKIYkc~~~kCprP~cy~s--------~gS~k~d~~  110 (466)
T KOG0466          39 INIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKCDDPKCPRPGCYRS--------FGSSKEDRP  110 (466)
T ss_pred             EEECCEECCCCCCCEEEEEECCCEEEEEHHHHHCCEEEEECCCCCEEEECCCCCCCCCCHHHC--------CCCCCCCCC
T ss_conf             430211100257402445404614887133442152688513544578558988999663020--------478999999


Q ss_pred             -------------CCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHH-HHHHHCCC
Q ss_conf             -------------9649999760010111224478988889987777664200000112235788754545-54321025
Q gi|254780484|r   83 -------------LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQD-VFSFLDKK  148 (212)
Q Consensus        83 -------------~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~  148 (212)
                                   -..+.|+|.||+...-...            .......+...+.+.....-...|..+ +....-..
T Consensus       111 ~c~~~g~~~~~klvRHVSfVDCPGHDiLMaTM------------LnGaAvmDaalLlIA~NEsCPQPQTsEHLaaveiM~  178 (466)
T KOG0466         111 PCDRPGCEGKMKLVRHVSFVDCPGHDILMATM------------LNGAAVMDAALLLIAGNESCPQPQTSEHLAAVEIMK  178 (466)
T ss_pred             CCCCCCCCCCEEEEEEEEECCCCCHHHHHHHH------------HCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             86568998745899987751479618899887------------432677543341010488898985066788877863


Q ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             75322122221111024689999999999753136898689998888899899999999872
Q gi|254780484|r  149 AVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       149 ~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ...++++.||+|++..++-.+.-+.+...+...-..+.|++|+||.-++|||.+-++|.+.+
T Consensus       179 LkhiiilQNKiDli~e~~A~eq~e~I~kFi~~t~ae~aPiiPisAQlkyNId~v~eyivkkI  240 (466)
T KOG0466         179 LKHIIILQNKIDLIKESQALEQHEQIQKFIQGTVAEGAPIIPISAQLKYNIDVVCEYIVKKI  240 (466)
T ss_pred             HCEEEEEECHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEHHHHCCCHHHHHHHHHHCC
T ss_conf             14189982123354377889889999999745655799521013643367679999998618


No 290
>PRK12289 ribosome-associated GTPase; Reviewed
Probab=98.66  E-value=4.5e-08  Score=65.57  Aligned_cols=102  Identities=21%  Similarity=0.093  Sum_probs=49.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCE--EEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             8999748998898999997389737--98738884145212026655567850896499997600101112244789888
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNL--ARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~--a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      ..+++|.++||||||+|+|.....+  ..++...++-++  +++..   .+..-.....++||||+..............
T Consensus       173 ~tv~~G~SGVGKSSLIN~L~p~~~l~TgeVS~k~~rGrH--TTr~~---eL~~L~~Gg~iiDTPGf~~~~l~~~~~eL~~  247 (351)
T PRK12289        173 ITVVAGPSGVGKSSLINRLIPDVELRVGEVSGKLQRGRH--TTRHV---ELFELPNGGLLADTPGFNQPDLDCSPEELAH  247 (351)
T ss_pred             EEEEECCCCCCHHHHHHHHCCCHHHHHHHHCCCCCCCCC--CCCEE---EEEECCCCCEEEECCCCCCCCCCCCHHHHHH
T ss_conf             699981798878898876374123456654064899878--35516---8999489958997979887888779789988


Q ss_pred             HHHHHHH---HHHHHHCCCCCCCCCCCCCCHH
Q ss_conf             8998777---7664200000112235788754
Q gi|254780484|r  109 GLIVRYL---SERSTLRCVYLLIDCRHGVKQI  137 (212)
Q Consensus       109 ~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~  137 (212)
                      ...+...   .....+..+.+.......++..
T Consensus       248 ~FpE~~~~l~~~~CkF~dC~H~~EPgCaVk~a  279 (351)
T PRK12289        248 YFPEARQRLAQGNCQFNDCLHRDEPNCVVRGD  279 (351)
T ss_pred             HCHHHHHHCCCCCCCCCCCCCCCCCCCCCCHH
T ss_conf             46678844278996791998999999731378


No 291
>pfam03193 DUF258 Protein of unknown function, DUF258.
Probab=98.66  E-value=3.5e-08  Score=66.18  Aligned_cols=66  Identities=29%  Similarity=0.344  Sum_probs=38.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCE--EEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH
Q ss_conf             8999748998898999997389737--9873888414521202665556785089649999760010111224
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNL--ARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~--a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~  101 (212)
                      ..+++|.++||||||+|+|.+....  ..++...++-+.  +++..   .+..-.....++||||+.......
T Consensus        37 ~sv~~G~SGVGKSTLiN~L~~~~~~~t~~iS~~~~rGkH--TTt~~---~l~~l~~gg~iiDTPG~r~f~l~~  104 (161)
T pfam03193        37 TSVLAGQSGVGKSTLLNALLPELDLRTGEISEKLGRGRH--TTTHV---ELFPLPGGGLLIDTPGFRELGLWH  104 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHCCHHHHHHHHHHHHHCCCCC--EEEEE---EEEEECCCCEEEECCCCCCCCCCC
T ss_conf             599988999889999988563443577753588638851--12113---799807995898589876257777


No 292
>KOG2423 consensus
Probab=98.65  E-value=1.1e-08  Score=69.06  Aligned_cols=59  Identities=34%  Similarity=0.600  Sum_probs=44.8

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHH
Q ss_conf             689997489988989999973897379873888414521202665556785089649999760010111
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYAR   98 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~   98 (212)
                      .-|+++|+|||||||++|+|-..+ +..|.+.||-|.-..+..         -...+.++|.||.-...
T Consensus       308 ISVGfiGYPNvGKSSiINTLR~Kk-VCkvAPIpGETKVWQYIt---------LmkrIfLIDcPGvVyps  366 (572)
T KOG2423         308 ISVGFIGYPNVGKSSIINTLRKKK-VCKVAPIPGETKVWQYIT---------LMKRIFLIDCPGVVYPS  366 (572)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCC-CCCCCCCCCCCHHHHHHH---------HHHCEEEECCCCCCCCC
T ss_conf             256662488875588888875345-311258888403889998---------87213674479724888


No 293
>pfam08477 Miro Miro-like protein. Mitochondrial Rho proteins (Miro-1 and Miro-2), are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (pfam00036), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis.
Probab=98.64  E-value=4.8e-08  Score=65.41  Aligned_cols=112  Identities=17%  Similarity=0.151  Sum_probs=55.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +|+++|-++||||||+.++.+.+.... ...+  +...  ...............+.++||+|........         
T Consensus         1 KivvvG~~~vGKTSLi~r~~~~~f~~~-~~~~--~~~~--~~~~~~~~~~~~~~~l~i~Dt~g~~~~~~~~---------   66 (118)
T pfam08477         1 KVVVIGDKGSGKSSLLSQLVGGEFPPE-IPEE--IQGD--TLAVDTLEVDGDTELLHIWDFGGREELKFEH---------   66 (118)
T ss_pred             CEEEECCCCCCHHHHHHHHHHCCCCCC-CCCC--CCCC--EEEEEEEEECCCEEEEEEEECCCCHHHHHHH---------
T ss_conf             999999899789999999983988876-6678--7777--6888999999928999999899967776666---------


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHH-----HHHHHHH-CCCCCCCCCCCCCCC
Q ss_conf             9877776642000001122357887545-----4554321-025753221222211
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHGVKQID-----QDVFSFL-DKKAVSYQIVLTKID  160 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~-~~~~~~~~~v~nK~D  160 (212)
                       ....   ...+..+.+.+......-..     .++.+.. .....|++++.||+|
T Consensus        67 -~~~~---~~~d~~ilvydit~~~Sf~~~~~~~~~i~~~~~~~~~~piilVGnK~D  118 (118)
T pfam08477        67 -IIFM---KTADAILLVYDLTDRESLNRVSRLIAWLPHLRKLGKKIPVILVGNKFD  118 (118)
T ss_pred             -HHHC---CCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC
T ss_conf             -5422---587467899979987899999999999999982099998899996859


No 294
>smart00053 DYNc Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and  plasma membrane following an exocytic event.
Probab=98.64  E-value=2.7e-07  Score=61.09  Aligned_cols=137  Identities=19%  Similarity=0.157  Sum_probs=74.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEE--------------------------------
Q ss_conf             686899974899889899999738973798738884145212026655--------------------------------
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKD--------------------------------   75 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~--------------------------------   75 (212)
                      ++|+|+++|-..+||||++.+|+|-..+...+..  +|+.+-......                                
T Consensus        25 ~LPqiVVvGdQSsGKSSvLEaitGi~FlPr~~g~--cTR~p~~i~l~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~  102 (240)
T smart00053       25 DLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGI--VTRRPLILQLINSSTEYAEFLHCKGKKFTDFDEVRNEIEAETDR  102 (240)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCC--EECCEEEEEEECCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHH
T ss_conf             8984899888787589999998788755568972--76440699973388651247743786348989999999998875


Q ss_pred             -----------E---EEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCCCCCCCC-CCHHHH
Q ss_conf             -----------5---6785089649999760010111224478988889987777664200-00011223578-875454
Q gi|254780484|r   76 -----------F---SNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLR-CVYLLIDCRHG-VKQIDQ  139 (212)
Q Consensus        76 -----------~---~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~-~~~~~~  139 (212)
                                 .   .....+.+.+.++|.||+.......+..........+....+.... ..+.+..+... -.....
T Consensus       103 ~~g~~~~~s~~~l~lei~gP~~p~LTlvDLPGl~~~~~~~q~~~~~~~v~~lv~~Yi~~p~tIILaVv~a~~D~anq~~l  182 (240)
T smart00053      103 VTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVAVGDQPPDIEEQIKDMIKQFISKEECLILAVTPANVDLANSDAL  182 (240)
T ss_pred             HCCCCCCCCCCCEEEEEECCCCCCCEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHH
T ss_conf             32678876788559999479998854414754124678998567999999999998479880699984078567661999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             554321025753221222211110246
Q gi|254780484|r  140 DVFSFLDKKAVSYQIVLTKIDKLSPTT  166 (212)
Q Consensus       140 ~~~~~~~~~~~~~~~v~nK~D~~~~~~  166 (212)
                      .+.......+...+-|++|+|++++..
T Consensus       183 ~lAr~~Dp~g~RTiGVlTKpDl~~~gs  209 (240)
T smart00053      183 KLAKEVDPQGERTIGVITKLDLMDEGT  209 (240)
T ss_pred             HHHHHHCCCCCEEEEEECCCCCCCCCC
T ss_conf             999971999982899973533457770


No 295
>PRK00098 ribosome-associated GTPase; Reviewed
Probab=98.63  E-value=4.8e-08  Score=65.40  Aligned_cols=65  Identities=31%  Similarity=0.404  Sum_probs=37.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCE--EEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH
Q ss_conf             8999748998898999997389737--9873888414521202665556785089649999760010111224
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNL--ARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~--a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~  101 (212)
                      ..+++|.++||||||+|+|.+....  ..++...++-+.  +++...  .....  ...++||||+.......
T Consensus       166 ~sv~~G~SGVGKSSLiN~L~~~~~~~t~~is~~~~rGrH--TTt~~~--l~~l~--~G~iiDTPG~r~~~l~~  232 (298)
T PRK00098        166 VTVLAGQSGVGKSTLLNALVPELELKTGEISEALGRGKH--TTTHVE--LYDLP--GGLLIDTPGFSSFGLEH  232 (298)
T ss_pred             EEEEECCCCCCHHHHHHHHCCHHHHHHHHHHHHCCCCCE--EEEEEE--EEECC--CCEEEECCCCCCCCCCC
T ss_conf             699987898878888876071444566755665189721--330468--99869--97598189877556677


No 296
>KOG1547 consensus
Probab=98.63  E-value=2.3e-07  Score=61.48  Aligned_cols=146  Identities=19%  Similarity=0.287  Sum_probs=83.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEEC-------CCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHH----
Q ss_conf             89997489988989999973897379873-------8884145212026655567850896499997600101112----
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTS-------NAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARA----   99 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~-------~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~----   99 (212)
                      .|.+||.++.|||||+|.|+..+.. ..+       +.|-|+..-..+.+..+..+   ...+.++||||+...-.    
T Consensus        48 NIMVVgqSglgkstlinTlf~s~v~-~~s~~~~~~~p~pkT~eik~~thvieE~gV---klkltviDTPGfGDqInN~nc  123 (336)
T KOG1547          48 NIMVVGQSGLGKSTLINTLFKSHVS-DSSSSDNSAEPIPKTTEIKSITHVIEEKGV---KLKLTVIDTPGFGDQINNDNC  123 (336)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHH-HCCCCCCCCCCCCCEEEEEEEEEEEEECCE---EEEEEEECCCCCCCCCCCCCH
T ss_conf             7999806877711567888888876-125897656755642788753445330665---899888348985333375320


Q ss_pred             HHHHHHHHHHHHHHH------------HHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             244789888899877------------77664200000112235788754545543210257532212222111102468
Q gi|254780484|r  100 PKKNVDSWGGLIVRY------------LSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTA  167 (212)
Q Consensus       100 ~~~~~~~~~~~~~~~------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~  167 (212)
                      ++..........+.+            ..+..+-++..++.......+..+.+....+.+ ...++.|+-|.|.+.-++.
T Consensus       124 WePI~kyIneQye~yL~eElni~R~kripDTRVHcclyFi~ptGhsLrplDieflkrLt~-vvNvvPVIakaDtlTleEr  202 (336)
T KOG1547         124 WEPIEKYINEQYEQYLREELNIAREKRIPDTRVHCCLYFIPPTGHSLRPLDIEFLKRLTE-VVNVVPVIAKADTLTLEER  202 (336)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCCCCHHHHHHHHH-HHEEEEEEEECCCCCHHHH
T ss_conf             677999999999999999986776513887547899999679887567044999998865-5204335750664427779


Q ss_pred             HHHHHHHHHHHHHC
Q ss_conf             99999999997531
Q gi|254780484|r  168 QETLEKTKYLIRNY  181 (212)
Q Consensus       168 ~~~~~~~~~~~~~~  181 (212)
                      ...-+.+++.+..+
T Consensus       203 ~~FkqrI~~el~~~  216 (336)
T KOG1547         203 SAFKQRIRKELEKH  216 (336)
T ss_pred             HHHHHHHHHHHHHC
T ss_conf             99999999999965


No 297
>KOG0076 consensus
Probab=98.63  E-value=1.8e-07  Score=62.07  Aligned_cols=160  Identities=16%  Similarity=0.175  Sum_probs=94.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEE-EEC--CCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379-873--888414521202665556785089649999760010111224478988
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLA-RTS--NAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a-~~~--~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      -|.|.|.-|+||+||+-++-.....+ ...  ...++|...+      .+.......++.++|..|....+.      .+
T Consensus        19 ~vlIlgldnAGKttfLe~~Kt~~~~~~~~l~~~ki~~tvgLn------ig~i~v~~~~l~fwdlgGQe~lrS------lw   86 (197)
T KOG0076          19 SVLILGLDNAGKTTFLEALKTDFSKAYGGLNPSKITPTVGLN------IGTIEVCNAPLSFWDLGGQESLRS------LW   86 (197)
T ss_pred             HHEEECCCCCCCHHHHHHHHHHHHHHHCCCCHHHEECCCCEE------ECCEEECCCEEEEEECCCHHHHHH------HH
T ss_conf             100242445785208988777887651688888810122403------131641254167788678087899------99


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHH-----HHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             8899877776642000001122357887545-----45543210257532212222111102468999999999975313
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVKQID-----QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP  182 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~  182 (212)
                      ...       -..+...++++|+....+-++     ......-...+.|.+...||-|+-+.-+.++. +.+-...+...
T Consensus        87 ~~y-------Y~~~H~ii~viDa~~~eR~~~~~t~~~~v~~~E~leg~p~L~lankqd~q~~~~~~El-~~~~~~~e~~~  158 (197)
T KOG0076          87 KKY-------YWLAHGIIYVIDATDRERFEESKTAFEKVVENEKLEGAPVLVLANKQDLQNAMEAAEL-DGVFGLAELIP  158 (197)
T ss_pred             HHH-------HHHHCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHCCHHHHHHHHHHHHH-HHHHHHHHHCC
T ss_conf             999-------9972634776417777888887999999998787628715434004330305668989-87742665368


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             6898689998888899899999999872
Q gi|254780484|r  183 TAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       183 ~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ....++.||||.+|+|+++-.+++.+.+
T Consensus       159 ~rd~~~~pvSal~gegv~egi~w~v~~~  186 (197)
T KOG0076         159 RRDNPFQPVSALTGEGVKEGIEWLVKKL  186 (197)
T ss_pred             CCCCCCCCCHHHHCCCHHHHHHHHHHHH
T ss_conf             8657644214540556778899999998


No 298
>COG1162 Predicted GTPases [General function prediction only]
Probab=98.61  E-value=7.6e-08  Score=64.22  Aligned_cols=64  Identities=28%  Similarity=0.283  Sum_probs=37.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCE--EEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHH
Q ss_conf             8999748998898999997389737--98738884145212026655567850896499997600101112
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNL--ARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARA   99 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~--a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~   99 (212)
                      ..+++|.++||||||+|+|.++...  ..++..-++  ..++++.   ..+........++||||+.....
T Consensus       166 ~svl~GqSGVGKSSLiN~L~p~~~~~t~eIS~~~~r--GkHTTt~---~~l~~l~~gG~iiDTPGf~~~~l  231 (301)
T COG1162         166 ITVLLGQSGVGKSTLINALLPELNQKTGEISEKLGR--GRHTTTH---VELFPLPGGGWIIDTPGFRSLGL  231 (301)
T ss_pred             EEEEECCCCCCHHHHHHHHCCHHHHHHHHHCCCCCC--CCCCCCE---EEEEECCCCCEEEECCCCCCCCC
T ss_conf             499988887769998874172121134421044789--8876324---89998389988972899771474


No 299
>PTZ00099 rab6; Provisional
Probab=98.61  E-value=2.7e-07  Score=61.07  Aligned_cols=113  Identities=19%  Similarity=0.139  Sum_probs=62.8

Q ss_pred             EECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHH--HHCCCCCCCCCC
Q ss_conf             508964999976001011122447898888998777766420000011223578--8754545543--210257532212
Q gi|254780484|r   80 KNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG--VKQIDQDVFS--FLDKKAVSYQIV  155 (212)
Q Consensus        80 ~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~--~~~~~~~~~~~v  155 (212)
                      ......+.++||+|.+.+......          +.   .-...++++.+....  +......+.+  .......|+++|
T Consensus        25 ~~~~v~l~IWDTAGqE~f~sl~~~----------y~---r~a~~~ilVyDit~~~SF~~l~~W~~~i~~~~~~~~~iiLV   91 (176)
T PTZ00099         25 DEGPVRLQLWDTAGQERFRSLIPS----------YI---RDSAAAIVVYDITNRQSFENTTKWIQDILNERGKDVIIALV   91 (176)
T ss_pred             CCEEEEEEEEECCCCCCHHHHHHH----------HH---CCCCEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             999999999979986341357688----------70---79867999850420778999999999999853887743999


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             2221111024689999999999753136898689998888899899999999872
Q gi|254780484|r  156 LTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       156 ~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .||+|+.....+  ..++..+....+   +-+++.+||++|.||+++++.|.+.|
T Consensus        92 GNK~DL~~~r~V--~~ee~~~~A~~~---~~~f~EtSAktg~nV~e~F~~la~~i  141 (176)
T PTZ00099         92 GNKTDLGDLRKV--TYEEGMQKAQEY---NTMFHETSAKAGHNIKVLFKKIAAKL  141 (176)
T ss_pred             EECCCHHHHCCC--CHHHHHHHHHHC---CCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             855655861685--999999999985---99999984899949899999999986


No 300
>KOG0079 consensus
Probab=98.60  E-value=2.6e-07  Score=61.19  Aligned_cols=156  Identities=15%  Similarity=0.149  Sum_probs=85.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +..|+|-|+||||||+-.+...- ..  ..+.+|+   ++-.......+..+...+.++||+|.+.+.......-     
T Consensus        10 kllIigDsgVGKssLl~rF~ddt-Fs--~sYitTi---GvDfkirTv~i~G~~VkLqIwDtAGqErFrtitstyy-----   78 (198)
T KOG0079          10 KLLIIGDSGVGKSSLLLRFADDT-FS--GSYITTI---GVDFKIRTVDINGDRVKLQIWDTAGQERFRTITSTYY-----   78 (198)
T ss_pred             HHHEECCCCCCHHHHHHHHHHCC-CC--CCEEEEE---EEEEEEEEEECCCCEEEEEEEECCCHHHHHHHHHHHC-----
T ss_conf             88832687645789999985255-56--5148875---3357999860488689999861405799999988770-----


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHHH-HCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             98777766420000011223578--87545455432-1025753221222211110246899999999997531368986
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHG--VKQIDQDVFSF-LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE  187 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~-~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~  187 (212)
                              .-...++++.|...+  +......+.+. ......|.++|.||.|......+...  ..+   ......+.+
T Consensus        79 --------rgthgv~vVYDVTn~ESF~Nv~rWLeei~~ncdsv~~vLVGNK~d~~~RrvV~t~--dAr---~~A~~mgie  145 (198)
T KOG0079          79 --------RGTHGVIVVYDVTNGESFNNVKRWLEEIRNNCDSVPKVLVGNKNDDPERRVVDTE--DAR---AFALQMGIE  145 (198)
T ss_pred             --------CCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCEECCCCCCCCCCEEEEHH--HHH---HHHHHCCCH
T ss_conf             --------3886699999776636567599999999854964352210467887543343038--899---999866920


Q ss_pred             EEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             89998888899899999999872
Q gi|254780484|r  188 VIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       188 i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .+.+||+...|+++....|.+.+
T Consensus       146 ~FETSaKe~~NvE~mF~cit~qv  168 (198)
T KOG0079         146 LFETSAKENENVEAMFHCITKQV  168 (198)
T ss_pred             HEEHHHHHCCCCHHHHHHHHHHH
T ss_conf             10000233024167899999999


No 301
>KOG0093 consensus
Probab=98.60  E-value=4.3e-07  Score=59.91  Aligned_cols=155  Identities=15%  Similarity=0.086  Sum_probs=85.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEE-ECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785-08964999976001011122447898888
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK-NNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~-~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      ++.|+|...|||+||+-+-.+.....   .+ -.|-...   .....+.. .....+.++||+|.+.........     
T Consensus        23 KlliiGnssvGKTSfl~ry~ddSFt~---af-vsTvGid---FKvKTvyr~~kRiklQiwDTagqEryrtiTTay-----   90 (193)
T KOG0093          23 KLLIIGNSSVGKTSFLFRYADDSFTS---AF-VSTVGID---FKVKTVYRSDKRIKLQIWDTAGQERYRTITTAY-----   90 (193)
T ss_pred             EEEEECCCCCCCHHHHHHHHCCCCCC---CE-EEEEEEE---EEEEEEEECCCEEEEEEEECCCCHHHHHHHHHH-----
T ss_conf             68997268766213557760655440---00-4663113---788676514647788987166510356777887-----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--C--HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9987777664200000112235788--7--54545543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--K--QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~--~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                           .   .-....+...+.....  .  ......+........+++++.||||+-+  ++....+..+.+....   +
T Consensus        91 -----y---RgamgfiLmyDitNeeSf~svqdw~tqIktysw~naqvilvgnKCDmd~--eRvis~e~g~~l~~~L---G  157 (193)
T KOG0093          91 -----Y---RGAMGFILMYDITNEESFNSVQDWITQIKTYSWDNAQVILVGNKCDMDS--ERVISHERGRQLADQL---G  157 (193)
T ss_pred             -----H---HCCCEEEEEEECCCHHHHHHHHHHHHHHEEEECCCCEEEEEECCCCCCC--CEEEEHHHHHHHHHHH---C
T ss_conf             -----6---1464599998547878889899898875034316861899804557743--2001278888999984---8


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -+++..||+.+.|++++.+++.+.+
T Consensus       158 fefFEtSaK~NinVk~~Fe~lv~~I  182 (193)
T KOG0093         158 FEFFETSAKENINVKQVFERLVDII  182 (193)
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             4775513302666999999999999


No 302
>KOG0091 consensus
Probab=98.60  E-value=2.7e-07  Score=61.08  Aligned_cols=157  Identities=20%  Similarity=0.138  Sum_probs=84.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      +..++|.+-||||||+..+|..+.....  .|+...+.-.-..+   ........+.++||+|.+..........     
T Consensus        10 rlivigdstvgkssll~~ft~gkfaels--dptvgvdffarlie---~~pg~riklqlwdtagqerfrsitksyy-----   79 (213)
T KOG0091          10 RLIVIGDSTVGKSSLLRYFTEGKFAELS--DPTVGVDFFARLIE---LRPGYRIKLQLWDTAGQERFRSITKSYY-----   79 (213)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCC--CCCCCHHHHHHHHH---CCCCCEEEEEEEECCCHHHHHHHHHHHH-----
T ss_conf             9999837752488899998337665567--98533678989873---4788678998730205688888789986-----


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHH---HHC-CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             98777766420000011223578--8754545543---210-25753221222211110246899999999997531368
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRHG--VKQIDQDVFS---FLD-KKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~---~~~-~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                              ...+.+..+.|....  +........+   ... .....+++|..|+|+..  .++-..++.++..+..   
T Consensus        80 --------rnsvgvllvyditnr~sfehv~~w~~ea~m~~q~P~k~VFlLVGhKsDL~S--qRqVt~EEaEklAa~h---  146 (213)
T KOG0091          80 --------RNSVGVLLVYDITNRESFEHVENWVKEAAMATQGPDKVVFLLVGHKSDLQS--QRQVTAEEAEKLAASH---  146 (213)
T ss_pred             --------HCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCHHH--HCCCCHHHHHHHHHHC---
T ss_conf             --------546416999963544667778999999998538997059998524310122--1111399999999965---


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             98689998888899899999999872
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +--++.+||++|.|+++-...|.+.+
T Consensus       147 gM~FVETSak~g~NVeEAF~mlaqeI  172 (213)
T KOG0091         147 GMAFVETSAKNGCNVEEAFDMLAQEI  172 (213)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             94589831457876899999999999


No 303
>KOG2655 consensus
Probab=98.57  E-value=1.1e-06  Score=57.48  Aligned_cols=150  Identities=23%  Similarity=0.343  Sum_probs=80.4

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCE--EEECCEEEEEEEEEEEECCC--EEEEEECCHHHHHHHHH----
Q ss_conf             68999748998898999997389737987388841--45212026655567850896--49999760010111224----
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGR--TQHLNFFVPKDFSNLKNNLP--AMALVDMPGYGYARAPK----  101 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~t--t~~~~~~~~~~~~~~~~~~~--~~~~~DtpG~~~~~~~~----  101 (212)
                      -.+-++|..+.|||||+|.|+++.. ......++.  .................++.  .+.++||||+.......    
T Consensus        22 ftlmvvG~sGlGKsTfiNsLf~~~l-~~~~~~~~~~~~~~~t~~i~~~~~~iee~g~~l~LtvidtPGfGD~vdns~~w~  100 (366)
T KOG2655          22 FTLMVVGESGLGKSTFINSLFLTDL-SGNREVPGASERIKETVEIESTKVEIEENGVKLNLTVIDTPGFGDAVDNSNCWR  100 (366)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHC-CCCCCCCCCCCCCCCCCEEEEEEEEECCCCEEEEEEEECCCCCCCCCCCCCCCH
T ss_conf             3899855887638899988886532-577666775567655311322323763797488767843699865446512432


Q ss_pred             HHHHHHHHHHHHHHHHH-----------HHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             47898888998777766-----------4200000112235788754545543210257532212222111102468999
Q gi|254780484|r  102 KNVDSWGGLIVRYLSER-----------STLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQET  170 (212)
Q Consensus       102 ~~~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~  170 (212)
                      ............+....           .+-++..++.-...+....+...+..+. ...+.+.|+-|.|.+.+.++...
T Consensus       101 pi~~yi~~q~~~yl~~E~~~~R~~~~D~RVH~cLYFI~P~ghgL~p~Di~~Mk~l~-~~vNiIPVI~KaD~lT~~El~~~  179 (366)
T KOG2655         101 PIVNYIDSQFDQYLDEESRLNRSKIKDNRVHCCLYFISPTGHGLKPLDIEFMKKLS-KKVNLIPVIAKADTLTKDELNQF  179 (366)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHH-CCCCCCCEEECCCCCCHHHHHHH
T ss_conf             35678999999998602368865566884489999837888888686699999773-25661031640566898999999


Q ss_pred             HHHHHHHHHHC
Q ss_conf             99999997531
Q gi|254780484|r  171 LEKTKYLIRNY  181 (212)
Q Consensus       171 ~~~~~~~~~~~  181 (212)
                      -+.+.+.+..+
T Consensus       180 K~~I~~~i~~~  190 (366)
T KOG2655         180 KKRIRQDIEEH  190 (366)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999998873


No 304
>pfam04670 Gtr1_RagA Gtr1/RagA G protein conserved region. GTR1 was first identified in S. cerevisiae as a suppressor of a mutation in RCC1. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1. Included in this family is the human Rag C, a novel protein that has been shown to interact with RagA/B.
Probab=98.56  E-value=2.4e-06  Score=55.59  Aligned_cols=162  Identities=17%  Similarity=0.124  Sum_probs=87.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEE-EECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             8999748998898999997389737987388841452120266555678-508964999976001011122447898888
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNL-KNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~-~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      +|-++|++++||||.-.-++.... +..      |...+.+........ ..+...+.++|.||....-...-..   + 
T Consensus         1 KiLLMG~~~sGKTSi~~vIF~~~~-p~d------T~~L~~T~~ve~~~v~~~~~l~l~iwD~pGq~~f~e~~~~~---~-   69 (230)
T pfam04670         1 KVLLMGLRGSGKSSMRSIIFSNYS-PRD------TLRLGATIDVEQSHVRFLGNLTLNLWDCPGQDDFMENYLTR---Q-   69 (230)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCC-HHH------HCCCCCCCCEEEEEEECCCCCEEEEEECCCCHHHHHHHCCC---C-
T ss_conf             978756899987776999867998-214------12025777767787741687368999769835354412002---2-


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHH------HHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC-
Q ss_conf             9987777664200000112235788754545543------210257532212222111102468999999999975313-
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS------FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP-  182 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~-  182 (212)
                          ....-......+++.|........+...+.      ........+.+.+.|+|.+.++...+....+.+.+.... 
T Consensus        70 ----~e~if~~v~~lIyV~D~q~~~~~~~l~~~~~~l~~~~~~sp~~~v~vfiHK~D~l~~d~r~~~~~~~~~~i~~~~~  145 (230)
T pfam04670        70 ----KEHIFSNVGVLIYVFDVESREYEEDLATLVKIIEALYQYSPNAKVFVLIHKMDLLSEDERKEIFEDRKEEIIEEIE  145 (230)
T ss_pred             ----HHHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             ----3547644788999996888609999999999999999839998899999603588866789999999999999876


Q ss_pred             ---CCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             ---68986899988888998999999998
Q gi|254780484|r  183 ---TAHPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       183 ---~~~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                         .....++++|.-... +=+-+..|.+
T Consensus       146 ~~~~~~i~~~~TSI~D~S-ly~A~S~IVq  173 (230)
T pfam04670       146 DFGIEDLTFFLTSIWDHS-LYKAWSKIVQ  173 (230)
T ss_pred             HCCCCCEEEEEEECCHHH-HHHHHHHHHH
T ss_conf             568875388851012116-9999999999


No 305
>PRK12288 ribosome-associated GTPase; Reviewed
Probab=98.51  E-value=1.3e-07  Score=62.92  Aligned_cols=65  Identities=32%  Similarity=0.326  Sum_probs=36.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCE--EEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHH
Q ss_conf             8999748998898999997389737--987388841452120266555678508964999976001011122
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNL--ARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAP  100 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~--a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~  100 (212)
                      ..+++|.++||||||+|+|.....+  ..++...++-+.  +++..   ....-.....++||||+..+...
T Consensus       209 tsvf~GqSGVGKSSLiN~L~p~~~~~tgeIS~~~~~GrH--TTt~~---~L~~l~~gG~lIDTPG~ref~L~  275 (344)
T PRK12288        209 ISIFVGQSGVGKSSLINALLPEAEILVGDVSENSGLGQH--TTTTA---RLYHFPHGGDLIDSPGVREFGLW  275 (344)
T ss_pred             EEEEEECCCCCHHHHHHHCCCHHHHHHHHHHHHCCCCCC--EEEEE---EEEECCCCCEEEECCCCCCCCCC
T ss_conf             599980687678888761075334223201433388664--01168---99992899879738987655777


No 306
>KOG0460 consensus
Probab=98.48  E-value=1.6e-06  Score=56.59  Aligned_cols=149  Identities=15%  Similarity=0.219  Sum_probs=93.6

Q ss_pred             EEEECCCCCCHHHHHHHHHCC---CCEE------EECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHH
Q ss_conf             999748998898999997389---7379------8738884145212026655567850896499997600101112244
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNR---KNLA------RTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKK  102 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~---~~~a------~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~  102 (212)
                      |+-+|+..+||+||--|+|.-   +-.|      .....|- .+..+.+...-..........+.-+|.||+..+.    
T Consensus        57 VGTIGHVDHGKTTLTaAITkila~~g~A~~~kydeID~APE-EkaRGITIn~aHveYeTa~RhYaH~DCPGHADYI----  131 (449)
T KOG0460          57 VGTIGHVDHGKTTLTAAITKILAEKGGAKFKKYDEIDKAPE-EKARGITINAAHVEYETAKRHYAHTDCPGHADYI----  131 (449)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHCCHH-HHHCCCEEEEEEEEEECCCCCCCCCCCCCHHHHH----
T ss_conf             03300335772008999999997516501054766533826-6535616764356642244300147899638899----


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-CCCCCCCCCCCCHHHHHHHHH-HHHHHHHH
Q ss_conf             7898888998777766420000011223578875454554321025753-221222211110246899999-99999753
Q gi|254780484|r  103 NVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS-YQIVLTKIDKLSPTTAQETLE-KTKYLIRN  180 (212)
Q Consensus       103 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~~~~~~~~~~~~-~~~~~~~~  180 (212)
                               ...+......+..+.+..+.++...|..+.+-.....+.+ +++.+||.|.+++.+.-+..+ ++++++.+
T Consensus       132 ---------KNMItGaaqMDGaILVVaatDG~MPQTrEHlLLArQVGV~~ivvfiNKvD~V~d~e~leLVEmE~RElLse  202 (449)
T KOG0460         132 ---------KNMITGAAQMDGAILVVAATDGPMPQTREHLLLARQVGVKHIVVFINKVDLVDDPEMLELVEMEIRELLSE  202 (449)
T ss_pred             ---------HHHHCCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             ---------87532732367349999747898840688888898728764999971202468889999999999999997


Q ss_pred             CCCCC--CCEEEEECC
Q ss_conf             13689--868999888
Q gi|254780484|r  181 YPTAH--PEVIPTSSV  194 (212)
Q Consensus       181 ~~~~~--~~i~~vSA~  194 (212)
                      +...+  .|++.=||.
T Consensus       203 ~gf~Gd~~PvI~GSAL  218 (449)
T KOG0460         203 FGFDGDNTPVIRGSAL  218 (449)
T ss_pred             CCCCCCCCCEEECCHH
T ss_conf             2999887876632012


No 307
>TIGR00503 prfC peptide chain release factor 3; InterPro: IPR004548   Peptide chain release factor 3 increases the formation of ribosomal termination complexes and stimulates activity of RF-1 and RF-2. It binds to guanine nucleotides and has a strong preference for UGA stop codons. This translation releasing factor, RF-3 (prfC) was originally described as stop codon-independent, in contrast to peptide chain release factor 1 (RF-1, prfA) and RF-2 (prfB). RF-1 and RF-2 are closely related to each other, while RF-3 is similar to elongation factors EF-Tu and EF-G; RF-1 is active at UAA and UAG and RF-2 is active at UAA and UGA. All bacteria and organelles have RF-1. The Mycoplasmas and organelles, which translate UGA as Trp rather than as a stop codon, lack RF-2. RF-3, in contrast, seems to be rare among bacteria and is found so far only in Escherichia coli and some other gamma subdivision Proteobacteria, in Synechocystis sp. (strain PCC 6803), and in Staphylococcus aureus.; GO: 0005525 GTP binding, 0016149 translation release factor activity codon specific, 0006415 translational termination, 0005737 cytoplasm.
Probab=98.48  E-value=1.3e-06  Score=57.07  Aligned_cols=121  Identities=13%  Similarity=0.214  Sum_probs=80.6

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHH--CCC------CEEEECCCCCEE------EECCEEEEEEEEEEEECCCEEEEEECCH
Q ss_conf             68689997489988989999973--897------379873888414------5212026655567850896499997600
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILV--NRK------NLARTSNAPGRT------QHLNFFVPKDFSNLKNNLPAMALVDMPG   93 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~--g~~------~~a~~~~~p~tt------~~~~~~~~~~~~~~~~~~~~~~~~DtpG   93 (212)
                      .+...||+-||.|||+||--+++  |+-      +-+.-+...-+.      ...+.-....-.++...+.-+.+.||||
T Consensus        10 ~RR~FAIISHPDAGKTT~TEK~LLyG~AIQ~AG~VK~r~S~~~A~SDWM~ME~QRGISIT~~VlQF~Y~~~l~NLLDTPG   89 (530)
T TIGR00503        10 KRRTFAIISHPDAGKTTLTEKVLLYGGAIQTAGAVKGRGSQRHAKSDWMEMEKQRGISITTSVLQFPYRDCLVNLLDTPG   89 (530)
T ss_pred             HCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEEEEEECCCCCEEECCCCCC
T ss_conf             02554366168887424678888742566522441220012212213788750588144412774145774562036858


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             10111224478988889987777664200000112235788754545543210257532212222111
Q gi|254780484|r   94 YGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDK  161 (212)
Q Consensus        94 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~  161 (212)
                      +..+...             ........+.++-++|+-.+...+...+++-......|++..+||.|.
T Consensus        90 H~DFSED-------------TYRTL~A~D~~~M~IDaAKG~E~~T~KL~EV~RLR~~PI~TF~NKLDR  144 (530)
T TIGR00503        90 HEDFSED-------------TYRTLTAVDNCLMVIDAAKGVETRTRKLMEVTRLRDLPILTFINKLDR  144 (530)
T ss_pred             CCCCCCH-------------HHHHHHHHHHHEEEHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHCCC
T ss_conf             8876404-------------679999851230011112561234244542010004744335232065


No 308
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]
Probab=98.45  E-value=2.8e-06  Score=55.23  Aligned_cols=57  Identities=18%  Similarity=0.123  Sum_probs=38.6

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             322122221111024689999999999753136898689998888899899999999872
Q gi|254780484|r  151 SYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       151 ~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .-++++||.|+++.-+.  .++...+.... -.+..+++++|+++|+|++++.+++....
T Consensus       144 aDllVInK~DLa~~v~~--dlevm~~da~~-~np~~~ii~~n~ktg~G~~~~~~~i~~~~  200 (202)
T COG0378         144 ADLLVINKTDLAPYVGA--DLEVMARDAKE-VNPEAPIIFTNLKTGEGLDEWLRFIEPQA  200 (202)
T ss_pred             EEEEEEEHHHHHHHHCC--CHHHHHHHHHH-HCCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             41899856773877286--69999999998-49999889984787868999999987640


No 309
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH. This family describes YqeH, a member of a larger family of GTPases involved in ribosome biogenesis. Like YqlF, it shows a cyclical permutation relative to GTPases EngA (in which the GTPase domain is duplicated), Era, and others. Members of this protein family are found in a relatively small number of bacterial species, including Bacillus subtilis but not Escherichia coli.
Probab=98.40  E-value=2.2e-06  Score=55.84  Aligned_cols=88  Identities=18%  Similarity=0.155  Sum_probs=64.0

Q ss_pred             HHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHH-HHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCC
Q ss_conf             2000001122357887545455432102575322122221111024-689999999999753136898689998888899
Q gi|254780484|r  120 TLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPT-TAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG  198 (212)
Q Consensus       120 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~-~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~G  198 (212)
                      ....++++.|..+........+.+...  ..|+++|+||+|++++. ......+.+++.+........+++.+||++|+|
T Consensus        63 ~~~lVv~VvDi~Df~gS~~~~l~~~~~--~~~v~lV~NK~DLLP~~~~~~~i~~wv~~~~~~~gl~~~~V~lvSa~~g~g  140 (360)
T TIGR03597        63 SNALIVYVVDIFDFEGSLIPELKRFVG--GNPVLLVGNKIDLLPKSVNLSKIKEWMKKRAKELGLKPVDIILVSAKKGNG  140 (360)
T ss_pred             CCCEEEEEEECCCCCCCHHHHHHHHHC--CCCEEEEEEHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCC
T ss_conf             683799998641477653464999838--985899998054288767879999999999998599836689996888989


Q ss_pred             HHHHHHHHHHH
Q ss_conf             89999999987
Q gi|254780484|r  199 IEVLRKAILET  209 (212)
Q Consensus       199 i~eL~~~I~~~  209 (212)
                      +++|.+.|.+.
T Consensus       141 i~~l~~~i~~~  151 (360)
T TIGR03597       141 IDELLDKIKKA  151 (360)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999987


No 310
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional
Probab=98.40  E-value=3.3e-07  Score=60.56  Aligned_cols=61  Identities=15%  Similarity=0.192  Sum_probs=42.3

Q ss_pred             HHCCCCCCCCCCCCCCCCCCH--HHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             210257532212222111102--468999999999975313689868999888889989999999987
Q gi|254780484|r  144 FLDKKAVSYQIVLTKIDKLSP--TTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       144 ~~~~~~~~~~~v~nK~D~~~~--~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      +.......-++++||+|+++.  -+.+...+.++..     ....+++++||++|+|+++..++|.+.
T Consensus       225 YP~mF~~ad~vlinKiDLlp~~dFD~~~~~~~~~~v-----Np~~~v~~vSa~tGeGld~W~~WL~~~  287 (290)
T PRK10463        225 YPHMFAAASLMLLNKVDLLPYLNFDVEKCIACAREV-----NPEIEIILISATSGEGMDQWLNWLETQ  287 (290)
T ss_pred             CHHHHHHCCEEEEEHHHHHHHCCCCHHHHHHHHHHH-----CCCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             766764257899865651220288999999999986-----989858997568887899999999997


No 311
>cd01859 MJ1464 MJ1464.  This family represents archaeal GTPase typified by the protein MJ1464 from Methanococcus jannaschii. The members of this family show a circular permutation of the GTPase signature motifs so that C-terminal strands 5, 6, and 7 (strands 6 contain the NKxD motif) are relocated to the N terminus.
Probab=98.38  E-value=1.4e-06  Score=56.92  Aligned_cols=87  Identities=21%  Similarity=0.198  Sum_probs=69.1

Q ss_pred             HHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCC
Q ss_conf             66420000011223578875454554321025753221222211110246899999999997531368986899988888
Q gi|254780484|r  117 ERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKR  196 (212)
Q Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g  196 (212)
                      .....++++.+.|+..+....+..+.+++...++|+++++||+|++++...+    .+....   ...+.+++++||.++
T Consensus         9 ~i~~~D~il~VvDar~p~~~~~~~l~~~l~~~~K~~ilvlNK~Dl~~~~~~~----~~~~~~---~~~g~~~i~iSa~~~   81 (156)
T cd01859           9 IIKESDVVLEVLDARDPELTRSRKLERYVLELGKKLLIVLNKADLVPKEVLE----KWKSIK---ESEGIPVVYVSAKER   81 (156)
T ss_pred             HHHHCCEEEEEEECCCCCCCCCHHHHHHHHHCCCCEEEEEECCCCCCHHHHH----HHHHHH---HCCCCCEEEEECCCC
T ss_conf             9987999999998788999869899999975699399997755558989999----999998---289997378701267


Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             99899999999872
Q gi|254780484|r  197 KGIEVLRKAILETI  210 (212)
Q Consensus       197 ~Gi~eL~~~I~~~l  210 (212)
                      .|+++|.+.+.+..
T Consensus        82 ~g~~~L~~~i~~~~   95 (156)
T cd01859          82 LGTKILRRTIKELA   95 (156)
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             57999999999860


No 312
>PRK13796 GTP-binding protein YqeH; Provisional
Probab=98.37  E-value=2.7e-06  Score=55.27  Aligned_cols=87  Identities=17%  Similarity=0.085  Sum_probs=60.1

Q ss_pred             HCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHH-HHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCH
Q ss_conf             000001122357887545455432102575322122221111024-6899999999997531368986899988888998
Q gi|254780484|r  121 LRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPT-TAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI  199 (212)
Q Consensus       121 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~-~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi  199 (212)
                      ...++++.|..+-.......+.+...  ..|+++|+||+|+++++ ......+++.+.+........+++.+||++|+|+
T Consensus        72 ~~lvv~VvDi~Df~gS~~~~l~~~ig--~~~vilV~NKvDLLP~~~~~~~~~~wv~~~~~~~gl~~~dV~lvSak~g~gv  149 (367)
T PRK13796         72 DALVVNVVDIFDFNGSWIPGLHRFVG--NNPVLLVGNKADLLPKSVKKNKVKNWLRQEAKELGLRPVDVVLISAQKGQGI  149 (367)
T ss_pred             CCEEEEEEECCCCCCCHHHHHHHHHC--CCCEEEEEECHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCH
T ss_conf             70899999744577651350898718--9848999982333887678789999999999975998552899946578899


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999987
Q gi|254780484|r  200 EVLRKAILET  209 (212)
Q Consensus       200 ~eL~~~I~~~  209 (212)
                      ++|.+.|.+.
T Consensus       150 ~~L~~~i~~~  159 (367)
T PRK13796        150 DELLDAIEKY  159 (367)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999986


No 313
>KOG1143 consensus
Probab=98.36  E-value=1.6e-06  Score=56.70  Aligned_cols=176  Identities=17%  Similarity=0.269  Sum_probs=100.1

Q ss_pred             HHHCCCCCC---CEEEEECCCCCCHHHHHHHHHCCCC-----EEEEC-------CCCCEEEECCE---EEEEEEEEE---
Q ss_conf             675887668---6899974899889899999738973-----79873-------88841452120---266555678---
Q gi|254780484|r   21 IGLLPKAGP---PEIAFSGRSNVGKSSLINILVNRKN-----LARTS-------NAPGRTQHLNF---FVPKDFSNL---   79 (212)
Q Consensus        21 ~~~~P~~~~---p~VaivG~~NvGKSSLiNaL~g~~~-----~a~~~-------~~p~tt~~~~~---~~~~~~~~~---   79 (212)
                      .+..|++.-   .+||++|--.+|||||+--|+-...     -|.-.       -..++|.....   ..+......   
T Consensus       156 VRKvPd~QqfievRvAVlGg~D~GKSTLlGVLTQgeLDnG~GrARln~FRh~HEiqsGrTSsis~evlGFd~~g~vVNY~  235 (591)
T KOG1143         156 VRKVPDSQQFIEVRVAVLGGCDVGKSTLLGVLTQGELDNGNGRARLNIFRHPHEIQSGRTSSISNEVLGFDNRGKVVNYA  235 (591)
T ss_pred             HHHCCCCCCCEEEEEEEECCCCCCCCEEEEEEECCCCCCCCCEEEEEHHCCHHHHCCCCCCCCCHHCCCCCCCCCCCCHH
T ss_conf             31288742304899998527656722366554105314788706630110636540576320010100536534300223


Q ss_pred             ---------EECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             ---------50896499997600101112244789888899877776642000001122357887545455432102575
Q gi|254780484|r   80 ---------KNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAV  150 (212)
Q Consensus        80 ---------~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  150 (212)
                               .....-+.++|.+|...+....-.           ............+..+..+..-...+........+.
T Consensus       236 ~~~taEEi~e~SSKlvTfiDLAGh~kY~~TTi~-----------gLtgY~Ph~A~LvVsA~~Gi~~tTrEHLgl~~AL~i  304 (591)
T KOG1143         236 QNMTAEEIVEKSSKLVTFIDLAGHAKYQKTTIH-----------GLTGYTPHFACLVVSADRGITWTTREHLGLIAALNI  304 (591)
T ss_pred             HCCCHHHHHHHHCCEEEEEECCCCHHHHEEEEE-----------ECCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHCC
T ss_conf             204599987410233887650442231304522-----------003679862799998688876540888889997178


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC-----------------------CCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             3221222211110246899999999997531-----------------------36898689998888899899999999
Q gi|254780484|r  151 SYQIVLTKIDKLSPTTAQETLEKTKYLIRNY-----------------------PTAHPEVIPTSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       151 ~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~-----------------------~~~~~~i~~vSA~~g~Gi~eL~~~I~  207 (212)
                      |++++++|+|++++...+..++.+...+...                       .....|++.+|+.+|+|++-|+..+.
T Consensus       305 PfFvlvtK~Dl~~~~~~~~tv~~l~nll~~~Gc~kvp~~Vt~~ddAv~Aaq~~~s~nivPif~vSsVsGegl~ll~~fLn  384 (591)
T KOG1143         305 PFFVLVTKMDLVDRQGLKKTVKDLSNLLAKAGCTKVPKRVTTKDDAVKAAQELCSGNIVPIFAVSSVSGEGLRLLRTFLN  384 (591)
T ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEECHHHHHHHHHHHCCCCCEEEEEEEECCCCCHHHHHHHHH
T ss_conf             76999984012363217899999998874237632634850507887888875368811489985047632669999986


No 314
>KOG1954 consensus
Probab=98.35  E-value=2.8e-06  Score=55.20  Aligned_cols=142  Identities=17%  Similarity=0.239  Sum_probs=86.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCE-EEECCCCCEEEECCEEEEEEEEEEEECC-----------------------
Q ss_conf             6868999748998898999997389737-9873888414521202665556785089-----------------------
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNL-ARTSNAPGRTQHLNFFVPKDFSNLKNNL-----------------------   83 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~-a~~~~~p~tt~~~~~~~~~~~~~~~~~~-----------------------   83 (212)
                      +-|.|-++|.=..||||++|.|++++-- ..+.+.|+|.+-...+....++.....-                       
T Consensus        57 ~KPmill~GqyStGKTtfi~yLle~dypg~riGpEPTtd~Fi~vM~G~~e~~ipGnal~vd~~~pF~gL~~FG~aflnRf  136 (532)
T KOG1954          57 AKPMILLVGQYSTGKTTFIRYLLEQDYPGLRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKKPFRGLNKFGNAFLNRF  136 (532)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             68448997246666039999987177875546899975306899855865666786256468775165666679999988


Q ss_pred             ----------CEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC-CCCCHHHHHHHHHHCCCCCCC
Q ss_conf             ----------649999760010111224478988889987777664200000112235-788754545543210257532
Q gi|254780484|r   84 ----------PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR-HGVKQIDQDVFSFLDKKAVSY  152 (212)
Q Consensus        84 ----------~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~  152 (212)
                                ..+.++||||+..-.  .+...+...........+..++..+...|.- -.........++.+......+
T Consensus       137 ~csqmp~~vLe~vtiVdtPGILsge--KQrisR~ydF~~v~~WFaeR~D~IiLlfD~hKLDIsdEf~~vi~aLkG~Edki  214 (532)
T KOG1954         137 MCSQLPNQVLESVTIVDTPGILSGE--KQRISRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFKRVIDALKGHEDKI  214 (532)
T ss_pred             HHHCCCHHHHHHEEEECCCCCCCCC--HHCCCCCCCHHHHHHHHHHHCCEEEEEECHHHCCCCHHHHHHHHHHHCCCCEE
T ss_conf             7733875655004442367532012--22012367808899999974568999724664566678999999861886406


Q ss_pred             CCCCCCCCCCCHHHHHHHH
Q ss_conf             2122221111024689999
Q gi|254780484|r  153 QIVLTKIDKLSPTTAQETL  171 (212)
Q Consensus       153 ~~v~nK~D~~~~~~~~~~~  171 (212)
                      -+|+||.|.++..+.....
T Consensus       215 RVVLNKADqVdtqqLmRVy  233 (532)
T KOG1954         215 RVVLNKADQVDTQQLMRVY  233 (532)
T ss_pred             EEEECCCCCCCHHHHHHHH
T ss_conf             8883032443799999999


No 315
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]
Probab=98.35  E-value=4.9e-06  Score=53.82  Aligned_cols=149  Identities=20%  Similarity=0.251  Sum_probs=90.0

Q ss_pred             CHHHCCCCCCCE--EEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHH
Q ss_conf             567588766868--999748998898999997389737987388841452120266555678508964999976001011
Q gi|254780484|r   20 EIGLLPKAGPPE--IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYA   97 (212)
Q Consensus        20 ~~~~~P~~~~p~--VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~   97 (212)
                      -.+.+|++.+|-  ||+||.|+.|||||+..|..+-.. .+-+.+   +.+       -.........+.+...|.-   
T Consensus        58 mvdrtp~d~PPPfIvavvGPpGtGKsTLirSlVrr~tk-~ti~~i---~GP-------iTvvsgK~RRiTflEcp~D---  123 (1077)
T COG5192          58 MVDRTPKDLPPPFIVAVVGPPGTGKSTLIRSLVRRFTK-QTIDEI---RGP-------ITVVSGKTRRITFLECPSD---  123 (1077)
T ss_pred             CCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHH-HHHHCC---CCC-------EEEEECCEEEEEEEECHHH---
T ss_conf             22578555899758996369988746899999999877-542036---786-------4786156357898867178---


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCC-CCCCCCCCCCCCH-HHHHHHHHHHH
Q ss_conf             122447898888998777766420000011223578875454554321025753-2212222111102-46899999999
Q gi|254780484|r   98 RAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS-YQIVLTKIDKLSP-TTAQETLEKTK  175 (212)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~v~nK~D~~~~-~~~~~~~~~~~  175 (212)
                                   ........-..+++++.++...++.-...++.+.+..++.| ++.|++..|+... ......-+.++
T Consensus       124 -------------l~~miDvaKIaDLVlLlIdgnfGfEMETmEFLnil~~HGmPrvlgV~ThlDlfk~~stLr~~KKrlk  190 (1077)
T COG5192         124 -------------LHQMIDVAKIADLVLLLIDGNFGFEMETMEFLNILISHGMPRVLGVVTHLDLFKNPSTLRSIKKRLK  190 (1077)
T ss_pred             -------------HHHHHHHHHHHHEEEEEECCCCCCEEHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             -------------8888768875213578863666704248899999866489724788862113358378999998876


Q ss_pred             HHHHHCCCCCCCEEEEECCC
Q ss_conf             99753136898689998888
Q gi|254780484|r  176 YLIRNYPTAHPEVIPTSSVK  195 (212)
Q Consensus       176 ~~~~~~~~~~~~i~~vSA~~  195 (212)
                      ..++..-..+...|.+|..-
T Consensus       191 hRfWtEiyqGaKlFylsgV~  210 (1077)
T COG5192         191 HRFWTEIYQGAKLFYLSGVE  210 (1077)
T ss_pred             HHHHHHHCCCCEEEEECCCC
T ss_conf             66799873774489860201


No 316
>KOG0088 consensus
Probab=98.35  E-value=2e-07  Score=61.86  Aligned_cols=151  Identities=21%  Similarity=0.165  Sum_probs=85.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEE---ECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             899974899889899999738973798---73888414521202665556785089649999760010111224478988
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLAR---TSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~---~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      +|.+.|---||||||+=+.+..+.-+.   +-...+.+..         .........+.++||+|.+.+........+ 
T Consensus        15 K~VLLGEGCVGKtSLVLRy~EnkFn~kHlsTlQASF~~kk---------~n~ed~ra~L~IWDTAGQErfHALGPIYYR-   84 (218)
T KOG0088          15 KIVLLGEGCVGKTSLVLRYVENKFNCKHLSTLQASFQNKK---------VNVEDCRADLHIWDTAGQERFHALGPIYYR-   84 (218)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHCC---------CCCCCCEEEEEEEECCCHHHHHCCCCEEEE-
T ss_conf             8999748755606899999872323046789998876330---------462111311432124445765235753770-


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCC-----CCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             8899877776642000001122357-----88754545543210257532212222111102468999999999975313
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRH-----GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP  182 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~  182 (212)
                                  -....+.+.|..+     .++.+..++ ..+.-..+..++|.||+|+-..  +....++.......  
T Consensus        85 ------------gSnGalLVyDITDrdSFqKVKnWV~El-r~mlGnei~l~IVGNKiDLEee--R~Vt~qeAe~YAes--  147 (218)
T KOG0088          85 ------------GSNGALLVYDITDRDSFQKVKNWVLEL-RTMLGNEIELLIVGNKIDLEEE--RQVTRQEAEAYAES--  147 (218)
T ss_pred             ------------CCCCEEEEEECCCHHHHHHHHHHHHHH-HHHHCCEEEEEEECCCCCHHHH--HHHHHHHHHHHHHH--
T ss_conf             ------------799628998644468899999999999-9871883599995374467886--42029889999986--


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             689868999888889989999999987
Q gi|254780484|r  183 TAHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       183 ~~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                       -+...+.+||+.+.||.+|++.|...
T Consensus       148 -vGA~y~eTSAk~N~Gi~elFe~Lt~~  173 (218)
T KOG0088         148 -VGALYMETSAKDNVGISELFESLTAK  173 (218)
T ss_pred             -HCHHHEECCCCCCCCHHHHHHHHHHH
T ss_conf             -33343111110243799999999999


No 317
>cd01856 YlqF YlqF.  Proteins of the YlqF family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. The YlqF subfamily is represented in a phylogenetically diverse array of bacteria (including gram-positive bacteria, proteobacteria, Synechocystis, Borrelia, and Thermotoga) and in all eukaryotes.
Probab=98.32  E-value=4.5e-06  Score=54.03  Aligned_cols=85  Identities=20%  Similarity=0.206  Sum_probs=65.5

Q ss_pred             HHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCC
Q ss_conf             66420000011223578875454554321025753221222211110246899999999997531368986899988888
Q gi|254780484|r  117 ERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKR  196 (212)
Q Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g  196 (212)
                      .....++++.+.|+..+....+..+.+.+.  ..|.++|+||+|++++...+.....       +...+.+++++||+++
T Consensus        16 ~l~~sDlIl~V~DaR~pl~~~~~~l~~~~~--~K~~ilV~NK~DL~~~~~~~~~~~~-------~~~~~~~~~~~sa~~~   86 (171)
T cd01856          16 KLKLVDLVIEVRDARIPLSSRNPLLEKILG--NKPRIIVLNKADLADPKKTKKWLKY-------FESKGEKVLFVNAKSG   86 (171)
T ss_pred             HHHHCCEEEEEEECCCCCCCCCHHHHHHHC--CCCEEEEEECCCCCCHHHHHHHHHH-------HHCCCCCEEEEECCCC
T ss_conf             998699999999898888765289999976--8988999855555897899999999-------9807996799842266


Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             99899999999872
Q gi|254780484|r  197 KGIEVLRKAILETI  210 (212)
Q Consensus       197 ~Gi~eL~~~I~~~l  210 (212)
                      .|+++|.+.+.+.+
T Consensus        87 ~g~~~l~~~i~~~~  100 (171)
T cd01856          87 KGVKKLLKAAKKLL  100 (171)
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             57899999999973


No 318
>KOG0081 consensus
Probab=98.31  E-value=1.5e-06  Score=56.72  Aligned_cols=161  Identities=14%  Similarity=0.049  Sum_probs=81.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEE-EECCEEEEEEEEEE-----EECCCEEEEEECCHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414-52120266555678-----5089649999760010111224478
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT-QHLNFFVPKDFSNL-----KNNLPAMALVDMPGYGYARAPKKNV  104 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt-~~~~~~~~~~~~~~-----~~~~~~~~~~DtpG~~~~~~~~~~~  104 (212)
                      +.-..|.++|||+|++-..|..+.-..   ..+|. .+....++......     .....-+.++||+|.+.........
T Consensus        11 kfLaLGDSGVGKTs~Ly~YTD~~F~~q---FIsTVGIDFreKrvvY~s~gp~g~gr~~rihLQlWDTAGQERFRSLTTAF   87 (219)
T KOG0081          11 KFLALGDSGVGKTSFLYQYTDGKFNTQ---FISTVGIDFREKRVVYNSSGPGGGGRGQRIHLQLWDTAGQERFRSLTTAF   87 (219)
T ss_pred             HHHHHCCCCCCCEEEEEEECCCCCCCE---EEEEEECCCCCCEEEEECCCCCCCCCCEEEEEEEECCCCHHHHHHHHHHH
T ss_conf             887404677773478987327853343---57774013440047883468998875228987520010478888889999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCC---CCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             98888998777766420000011223578---875454554321025753221222211110246899999999997531
Q gi|254780484|r  105 DSWGGLIVRYLSERSTLRCVYLLIDCRHG---VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY  181 (212)
Q Consensus       105 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~  181 (212)
                      .+.          ..- .+.++.......   ...+..++..........+++..||+|+.+...+.+  +...++.+.|
T Consensus        88 fRD----------AMG-FlLiFDlT~eqSFLnvrnWlSQL~~hAYcE~PDivlcGNK~DL~~~R~Vs~--~qa~~La~ky  154 (219)
T KOG0081          88 FRD----------AMG-FLLIFDLTSEQSFLNVRNWLSQLQTHAYCENPDIVLCGNKADLEDQRVVSE--DQAAALADKY  154 (219)
T ss_pred             HHH----------HCC-CEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHH--HHHHHHHHHH
T ss_conf             985----------011-158886253377887998999987740137999899867123166655239--9999999973


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             36898689998888899899999999872
Q gi|254780484|r  182 PTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       182 ~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                         +.|++.+||-+|.|+++-.+.+++.+
T Consensus       155 ---glPYfETSA~tg~Nv~kave~Lldlv  180 (219)
T KOG0081         155 ---GLPYFETSACTGTNVEKAVELLLDLV  180 (219)
T ss_pred             ---CCCEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             ---99826602455768999999999999


No 319
>KOG1707 consensus
Probab=98.28  E-value=1.2e-06  Score=57.31  Aligned_cols=158  Identities=16%  Similarity=0.099  Sum_probs=80.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|.++|-.++|||||+-+|+..+-.   ...|.+-.     ++........+..+..++||.--....     ..    
T Consensus        10 VRIvliGD~G~GKtSLImSL~~eef~---~~VP~rl~-----~i~IPadvtPe~vpt~ivD~ss~~~~~-----~~----   72 (625)
T KOG1707          10 VRIVLIGDEGVGKTSLIMSLLEEEFV---DAVPRRLP-----RILIPADVTPENVPTSIVDTSSDSDDR-----LC----   72 (625)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHCC---CCCCCCCC-----CCCCCCCCCCCCCCEEEEECCCCCCHH-----HH----
T ss_conf             59999778886689999998763354---53455577-----611587567676721887436664256-----88----


Q ss_pred             HHHHHHHHHHHHCCCCCCCC--CCCCCCHHHHHHHHHH--CCCCCCCCCCCCCCCCCCHHHH--HHHHHHHHHHHHHCCC
Q ss_conf             99877776642000001122--3578875454554321--0257532212222111102468--9999999999753136
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLID--CRHGVKQIDQDVFSFL--DKKAVSYQIVLTKIDKLSPTTA--QETLEKTKYLIRNYPT  183 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~--~~~~~~~~~v~nK~D~~~~~~~--~~~~~~~~~~~~~~~~  183 (212)
                      +...... +........+.+  .........+-++...  .....|++++.||+|.......  +....-+.....+   
T Consensus        73 l~~Eirk-A~vi~lvyavd~~~T~D~ist~WLPlir~~~~~~~~~PVILvGNK~d~~~~~~~s~e~~~~pim~~f~E---  148 (625)
T KOG1707          73 LRKEIRK-ADVICLVYAVDDESTVDRISTKWLPLIRQLFGDYHETPVILVGNKSDNGDNENNSDEVNTLPIMIAFAE---  148 (625)
T ss_pred             HHHHHHH-CCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHH---
T ss_conf             9999864-588999985387687654443223656441577766877998303577554556415777899987577---


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             89868999888889989999999987
Q gi|254780484|r  184 AHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       184 ~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                       .+..+.+||++-.++.++.-.--+.
T Consensus       149 -iEtciecSA~~~~n~~e~fYyaqKa  173 (625)
T KOG1707         149 -IETCIECSALTLANVSELFYYAQKA  173 (625)
T ss_pred             -HHHHHHHHHHHHHHHHHHHHHHHHE
T ss_conf             -7788765465441137765454420


No 320
>KOG0070 consensus
Probab=98.27  E-value=1.1e-06  Score=57.62  Aligned_cols=162  Identities=12%  Similarity=0.154  Sum_probs=92.6

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHH
Q ss_conf             88766868999748998898999997389737987388841452120266555678508964999976001011122447
Q gi|254780484|r   24 LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKN  103 (212)
Q Consensus        24 ~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~  103 (212)
                      ++.-.-.+|.++|-=||||||++++|--.+.   +...||--      ...+  ........+.++|..|.......   
T Consensus        12 ~~~~~e~~IlmvGLD~AGKTTILyklk~~E~---vttvPTiG------fnVE--~v~ykn~~f~vWDvGGq~k~R~l---   77 (181)
T KOG0070          12 LFGKKEMRILMVGLDAAGKTTILYKLKLGEI---VTTVPTIG------FNVE--TVEYKNISFTVWDVGGQEKLRPL---   77 (181)
T ss_pred             CCCCCEEEEEEEECCCCCCCEEEEECCCCCC---CCCCCCCC------CCEE--EEEECCEEEEEEECCCCCCCCCC---
T ss_conf             3686467999996168986015675025874---14778645------3136--99986618999815887354531---


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHH--HHHHHHHC---CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             89888899877776642000001122357887545--45543210---25753221222211110246899999999997
Q gi|254780484|r  104 VDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQID--QDVFSFLD---KKAVSYQIVLTKIDKLSPTTAQETLEKTKYLI  178 (212)
Q Consensus       104 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~---~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~  178 (212)
                         +..  +     .......+++.|..+..+..+  .++...+.   ....|.++..||.|.-..-...+..+.+.-  
T Consensus        78 ---W~~--Y-----~~nt~~lIfVvDS~Dr~Ri~eak~eL~~~l~~~~l~~~~llv~aNKqD~~~als~~ei~~~L~l--  145 (181)
T KOG0070          78 ---WKH--Y-----FQNTQGLIFVVDSSDRERIEEAKEELHRMLAEPELRNAPLLVFANKQDLPGALSAAEITNKLGL--  145 (181)
T ss_pred             ---HHH--H-----CCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEECHHHCCCCCCHHHHHHHHHH--
T ss_conf             ---353--2-----0377279999817738889999999999976834477369998421204245788898867433--


Q ss_pred             HHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             531368986899988888998999999998728
Q gi|254780484|r  179 RNYPTAHPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       179 ~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      ..+.....-+..++|.+|+|+.|-.+.|.+.+.
T Consensus       146 ~~l~~~~w~iq~~~a~~G~GL~egl~wl~~~~~  178 (181)
T KOG0070         146 HSLRSRNWHIQSTCAISGEGLYEGLDWLSNNLK  178 (181)
T ss_pred             HCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             014688728953013565448999999999863


No 321
>KOG0463 consensus
Probab=98.24  E-value=4.4e-06  Score=54.12  Aligned_cols=167  Identities=17%  Similarity=0.189  Sum_probs=96.5

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCE-----E-------EECCCCCEEEECCEE-------------------EEEEEEE
Q ss_conf             68999748998898999997389737-----9-------873888414521202-------------------6655567
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNL-----A-------RTSNAPGRTQHLNFF-------------------VPKDFSN   78 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~-----a-------~~~~~p~tt~~~~~~-------------------~~~~~~~   78 (212)
                      .+||+||...+|||||+--||..+.-     |       ...-..++|...+--                   ......+
T Consensus       134 ~RVAVVGNVDAGKSTLLGVLTHgeLDnGRG~ARqkLFRHKHEiESGRTSSVGNDILGFD~~GNvVNKPD~Hg~~LdWvkI  213 (641)
T KOG0463         134 ARVAVVGNVDAGKSTLLGVLTHGELDNGRGAARQKLFRHKHEIESGRTSSVGNDILGFDVHGNVVNKPDPHGHNLDWVKI  213 (641)
T ss_pred             EEEEEEECCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCEEE
T ss_conf             79899712247722167665304434672277887765223103675445566202002546421588988886431343


Q ss_pred             EEECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             85089649999760010111224478988889987777664200000112235788754545543210257532212222
Q gi|254780484|r   79 LKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTK  158 (212)
Q Consensus        79 ~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK  158 (212)
                      ....-.-+.|+|.+|++.+....-        ..+..   ...+.....+.+..+..--..+..........|+.+|++|
T Consensus       214 ce~saKviTFIDLAGHEkYLKTTv--------FGMTG---H~PDf~MLMiGaNaGIiGmTKEHLgLALaL~VPVfvVVTK  282 (641)
T KOG0463         214 CEDSAKVITFIDLAGHEKYLKTTV--------FGMTG---HMPDFTMLMIGANAGIIGMTKEHLGLALALHVPVFVVVTK  282 (641)
T ss_pred             CCCCCEEEEEEECCCHHHHHHEEE--------ECCCC---CCCCCEEEEECCCCCCEECCHHHHHHHHHHCCCEEEEEEE
T ss_conf             136422689886154155231144--------10336---7887258985166651114477654556426857999985


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCC-----------------------CCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             111102468999999999975313-----------------------6898689998888899899999999
Q gi|254780484|r  159 IDKLSPTTAQETLEKTKYLIRNYP-----------------------TAHPEVIPTSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       159 ~D~~~~~~~~~~~~~~~~~~~~~~-----------------------~~~~~i~~vSA~~g~Gi~eL~~~I~  207 (212)
                      +|.+..+-.++..+.+..+++...                       ..--|+|-||-.+|.|++.|+..|.
T Consensus       283 IDMCPANiLqEtmKll~rllkS~gcrK~PvlVrs~DDVv~~A~NF~Ser~CPIFQvSNVtG~NL~LLkmFLN  354 (641)
T KOG0463         283 IDMCPANILQETMKLLTRLLKSPGCRKLPVLVRSMDDVVHAAVNFPSERVCPIFQVSNVTGTNLPLLKMFLN  354 (641)
T ss_pred             ECCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCEEEEECCCCCCCCCCEEEECCCCCCCHHHHHHHHH
T ss_conf             055817899999999999862877650757885156447861358621235407861566778389999986


No 322
>KOG0086 consensus
Probab=98.22  E-value=9.3e-06  Score=52.22  Aligned_cols=155  Identities=14%  Similarity=0.110  Sum_probs=81.7

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
                      +-++.++|..+.|||-|+..+...+-.-.++.+.|..      ....-..+......+.++||+|.+.+........+  
T Consensus         9 LfKfl~iG~aGtGKSCLLh~Fie~kfkDdssHTiGve------FgSrIinVGgK~vKLQIWDTAGQErFRSVtRsYYR--   80 (214)
T KOG0086           9 LFKFLVIGSAGTGKSCLLHQFIENKFKDDSSHTIGVE------FGSRIVNVGGKTVKLQIWDTAGQERFRSVTRSYYR--   80 (214)
T ss_pred             HHEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEE------ECCCEEEECCCEEEEEEEECCCHHHHHHHHHHHHC--
T ss_conf             3026886468886327999999864136546442022------01102540571899998634257889999998753--


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCC--CCCHHHH--HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             899877776642000001122357--8875454--554321025753221222211110246899999999997531368
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRH--GVKQIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~--~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                                 -......+.|...  .+.....  .....+....+.+++..||.|+-+..++  ...+......+   .
T Consensus        81 -----------GAAGAlLVYD~TsrdsfnaLtnWL~DaR~lAs~nIvviL~GnKkDL~~~R~V--tflEAs~FaqE---n  144 (214)
T KOG0086          81 -----------GAAGALLVYDITSRDSFNALTNWLTDARTLASPNIVVILCGNKKDLDPEREV--TFLEASRFAQE---N  144 (214)
T ss_pred             -----------CCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHCCHHHHH--HHHHHHHHHCC---C
T ss_conf             -----------6564279985245556999999888777647996799993771214412100--38998866330---3


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             98689998888899899999999
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~  207 (212)
                      ..-++.+||++|+|++|-.-...
T Consensus       145 el~flETSa~TGeNVEEaFl~c~  167 (214)
T KOG0086         145 ELMFLETSALTGENVEEAFLKCA  167 (214)
T ss_pred             CEEEEEECCCCCCCHHHHHHHHH
T ss_conf             11112202323556899999999


No 323
>KOG0097 consensus
Probab=98.22  E-value=1e-05  Score=51.95  Aligned_cols=150  Identities=15%  Similarity=0.052  Sum_probs=79.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      -+-.|+|.-+||||-|+..++.++.++.   -|.|..-..-++..   .+......+.++||+|.+++........+   
T Consensus        12 fkyiiigdmgvgkscllhqftekkfmad---cphtigvefgtrii---evsgqkiklqiwdtagqerfravtrsyyr---   82 (215)
T KOG0097          12 FKYIIIGDMGVGKSCLLHQFTEKKFMAD---CPHTIGVEFGTRII---EVSGQKIKLQIWDTAGQERFRAVTRSYYR---   82 (215)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHC---CCCCCCEECCEEEE---EEECCEEEEEEEECCCHHHHHHHHHHHHC---
T ss_conf             7788872465547788888877677505---98524031230699---96074899997313257989998898860---


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCC----CCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             99877776642000001122357----88754545543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRH----GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                             .   ....+.+.+...    ......+.....+......++++.||.|+-...++.  .++.++...+   .+
T Consensus        83 -------g---aagalmvyditrrstynhlsswl~dar~ltnpnt~i~lignkadle~qrdv~--yeeak~faee---ng  147 (215)
T KOG0097          83 -------G---AAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLIGNKADLESQRDVT--YEEAKEFAEE---NG  147 (215)
T ss_pred             -------C---CCCEEEEEEEHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHCCCC--HHHHHHHHHH---CC
T ss_conf             -------6---6650689974113346668888865341489971899965611144503786--8999988875---59


Q ss_pred             CCEEEEECCCCCCHHHHH
Q ss_conf             868999888889989999
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLR  203 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~  203 (212)
                      --++..||++|++++.-.
T Consensus       148 l~fle~saktg~nvedaf  165 (215)
T KOG0097         148 LMFLEASAKTGQNVEDAF  165 (215)
T ss_pred             EEEEEECCCCCCCHHHHH
T ss_conf             089981232367668999


No 324
>cd01855 YqeH YqeH.  YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts.  Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.
Probab=98.21  E-value=5.8e-06  Score=53.40  Aligned_cols=90  Identities=19%  Similarity=0.046  Sum_probs=58.6

Q ss_pred             HHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH-H-HHHCCCCCCCEEEEECCCC
Q ss_conf             4200000112235788754545543210257532212222111102468999999999-9-7531368986899988888
Q gi|254780484|r  119 STLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKY-L-IRNYPTAHPEVIPTSSVKR  196 (212)
Q Consensus       119 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~-~-~~~~~~~~~~i~~vSA~~g  196 (212)
                      .....++++.|..+........+....  ...++++|+||+|++.+......+..+.. . .........+++.+||++|
T Consensus        33 ~~~~lVv~VvDi~Df~~S~~~~l~~~~--~~~~v~lV~NK~DLLp~~~~~~~~~~~~~~~~~~~~~~~~~~v~lvSa~~~  110 (190)
T cd01855          33 PKKALVVHVVDIFDFPGSLIPRLRLFG--GNNPVILVGNKIDLLPKDKNLVRIKNWLRAKAAAGLGLKPKDVILISAKKG  110 (190)
T ss_pred             CCCCEEEEEEECCCCCCCCCHHHHHHC--CCCCEEEEEEHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCC
T ss_conf             678459999754357644465579861--798689999815517887658888989999975015998431799766578


Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             99899999999872
Q gi|254780484|r  197 KGIEVLRKAILETI  210 (212)
Q Consensus       197 ~Gi~eL~~~I~~~l  210 (212)
                      +|+++|.+.|.+..
T Consensus       111 ~gi~~L~~~i~~~~  124 (190)
T cd01855         111 WGVEELINAIKKLA  124 (190)
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             69899999999974


No 325
>KOG0468 consensus
Probab=98.19  E-value=8.7e-06  Score=52.41  Aligned_cols=154  Identities=18%  Similarity=0.253  Sum_probs=89.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEEC---C----CCCEE---EECCEEEEEE-----EEEEEECCCEEEEEECCHH
Q ss_conf             689997489988989999973897379873---8----88414---5212026655-----5678508964999976001
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTS---N----APGRT---QHLNFFVPKD-----FSNLKNNLPAMALVDMPGY   94 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~---~----~p~tt---~~~~~~~~~~-----~~~~~~~~~~~~~~DtpG~   94 (212)
                      ..|+++|+-.+||++|+.-|.++.. ...+   .    ++.+.   ...++..-..     .........-+.+.||||+
T Consensus       129 rnV~l~GhLhhGKT~l~D~Lv~~tH-p~~~~~~e~~lrytD~l~~E~eRg~sIK~~p~Tl~l~D~~~KS~l~nilDTPGH  207 (971)
T KOG0468         129 RNVGLVGHLHHGKTALMDLLVEQTH-PDFSKNTEADLRYTDTLFYEQERGCSIKSTPVTLVLSDSKGKSYLMNILDTPGH  207 (971)
T ss_pred             EEEEEEECCCCCHHHHHHHHCEECC-CCCCCCCCCCCCCCCCCHHHHHCCCEEEECCEEEEEECCCCCEEEEEEECCCCC
T ss_conf             9998861145671578776313134-655554235631366424567548567613228998567672433555258875


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCC------HHH--
Q ss_conf             011122447898888998777766420000011223578875454554321025753221222211110------246--
Q gi|254780484|r   95 GYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS------PTT--  166 (212)
Q Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~------~~~--  166 (212)
                      -.+..             ...+.....+.+..+.|...+..-+...+++..-....|+.+++||+|.+-      +.+  
T Consensus       208 VnF~D-------------E~ta~l~~sDgvVlvvDv~EGVmlntEr~ikhaiq~~~~i~vviNKiDRLilELkLPP~DAY  274 (971)
T KOG0468         208 VNFSD-------------ETTASLRLSDGVVLVVDVAEGVMLNTERIIKHAIQNRLPIVVVINKVDRLILELKLPPMDAY  274 (971)
T ss_pred             CCCHH-------------HHHHHHHHCCEEEEEEECCCCCEEEHHHHHHHHHHCCCCEEEEEEHHHHHHHHHCCCHHHHH
T ss_conf             55068-------------88888652363799998225705209999999874267679997416789998169838899


Q ss_pred             --HHHHHHHHHHHHHHCCC--------CCCCEEEEECCCCC
Q ss_conf             --89999999999753136--------89868999888889
Q gi|254780484|r  167 --AQETLEKTKYLIRNYPT--------AHPEVIPTSSVKRK  197 (212)
Q Consensus       167 --~~~~~~~~~~~~~~~~~--------~~~~i~~vSA~~g~  197 (212)
                        ....++.+...+..+..        ...++++-|.+-|.
T Consensus       275 ~KLrHii~~iN~~is~~s~~~~~~~sP~~gNvcFaS~~~g~  315 (971)
T KOG0468         275 YKLRHIIDEINNLISTFSKDDNPVVSPILGNVCFASGKLGF  315 (971)
T ss_pred             HHHHHHHHHHCCHHHHCCCCCCCCCCCCCCCEEEECCCCCE
T ss_conf             99878999862412210256664126444763442155441


No 326
>TIGR00484 EF-G translation elongation factor G; InterPro: IPR004540   Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution.   EF-G is a large, five-domain GTPase that promotes the directional movement of mRNA and tRNAs on the ribosome in a GTP-dependent manner. Unlike other GTPases, but by analogy to the myosin motor, EF-G performs its function of powering translocation in the GDP-bound form; that is, in a kinetically stable ribosome-EF-G(GDP) complex formed by GTP hydrolysis on the ribosome. The complex undergoes an extensive structural rearrangement, in particular affecting the small ribosomal subunit, which leads to mRNA-tRNA movement. Domain 4, which extends from the 'body' of the EF-G molecule much like a lever arm, appears to be essential for the structural transition to take place. In a hypothetical model, GTP hydrolysis induces a conformational change in the G domain of EF-G, which affects the interactions with neighbouring domains within EF-G. The resulting rearrangement of the domains relative to each other generates conformational strain in the ribosome to which EF-G is fixed. Because of structural features of the tRNA-ribosome complex, this conformational strain results in directional tRNA-mRNA movement. The functional parallels between EF-G and motor proteins suggest that EF-G differs from classical G-proteins in that it functions as a force-generating mechanochemical device rather than a conformational switch .   Every completed bacterial genome has at least one copy, but some species have additional EF-G-like proteins. The closest homolog to canonical (e.g. Escherichia coli) EF-G in the spirochetes clusters as if it is derived from mitochondrial forms, while a more distant second copy is also present. Synechocystis sp. (strain PCC 6803) has a few proteins more closely related to EF-G than to any other characterised protein. Two of these resemble E. coli EF-G more closely than does the best match from the spirochetes; it may be that both function as authentic EF-G.   More information about these proteins can be found at Protein of the Month: Elongation Factors . ; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005622 intracellular.
Probab=98.19  E-value=3e-06  Score=55.06  Aligned_cols=129  Identities=16%  Similarity=0.209  Sum_probs=86.2

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHH---CCCC-EEEECCCCCE-E-------EECCEEEEEEEEEEEEC------CC
Q ss_conf             5887668689997489988989999973---8973-7987388841-4-------52120266555678508------96
Q gi|254780484|r   23 LLPKAGPPEIAFSGRSNVGKSSLINILV---NRKN-LARTSNAPGR-T-------QHLNFFVPKDFSNLKNN------LP   84 (212)
Q Consensus        23 ~~P~~~~p~VaivG~~NvGKSSLiNaL~---g~~~-~a~~~~~p~t-t-------~~~~~~~~~~~~~~~~~------~~   84 (212)
                      .+|-.....|+|.-|-.+||+|+--+++   |+.. +..+...-|. +       ...+.+...-.....|.      ..
T Consensus         4 ~~~~~~~RNiGI~AHIDaGKTT~~ERILFy~g~~HkIgE~~g~dG~a~MDwME~E~ERGITItSAAT~~~Wk~~~~~~~~   83 (705)
T TIGR00484         4 TTDLEKLRNIGISAHIDAGKTTTTERILFYTGRIHKIGEVHGKDGAATMDWMEQEKERGITITSAATTVEWKGMAKQYDH   83 (705)
T ss_pred             CCCHHHCCCCCEEEEECCCCCCCHHEEEECCCCCCCEEECCCCCCCEECCHHHHCCCCCEEEECHHCCHHHHHHHHCCCC
T ss_conf             56523305543278633887320101000137501000001678851123123003587142100110102101000140


Q ss_pred             EEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCH
Q ss_conf             49999760010111224478988889987777664200000112235788754545543210257532212222111102
Q gi|254780484|r   85 AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSP  164 (212)
Q Consensus        85 ~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~  164 (212)
                      .+.++||||+-++...-+..             ..+++..+.+.++..++..|....-.....-..|.+..+||+|+...
T Consensus        84 ~~N~IDTPGHVDFT~EVERS-------------lRVLDGAv~V~~a~~GV~pQ~~TVwRQa~~Y~VPRi~FVNK~Dk~GA  150 (705)
T TIGR00484        84 RINIIDTPGHVDFTVEVERS-------------LRVLDGAVAVLDAVGGVQPQSETVWRQANKYEVPRIVFVNKMDKTGA  150 (705)
T ss_pred             EEEEEECCCCEEEEEEEEEH-------------HHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCC
T ss_conf             37887378941257885201-------------22564566533302686641156776543268862899715564578


No 327
>TIGR00073 hypB hydrogenase accessory protein HypB; InterPro: IPR004392 The hydrogenase accessory protein HypB is a GTP hydrolase for assembly of nickel metallocentre of hydrogenase. A similar protein, ureG, is an accessory protein for urease, which also uses nickel.; GO: 0016151 nickel ion binding, 0006461 protein complex assembly.
Probab=98.17  E-value=9.8e-07  Score=57.84  Aligned_cols=167  Identities=16%  Similarity=0.160  Sum_probs=79.5

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHCCC-----CEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHH
Q ss_conf             5887668689997489988989999973897-----37987388841452120266555678508964999976001011
Q gi|254780484|r   23 LLPKAGPPEIAFSGRSNVGKSSLINILVNRK-----NLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYA   97 (212)
Q Consensus        23 ~~P~~~~p~VaivG~~NvGKSSLiNaL~g~~-----~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~   97 (212)
                      .|-+.+..-+=|+|-|++||++|+-.+..+.     ..++..+..+.- +-        ..+...+.+..-+-|...   
T Consensus        28 ~~~~~g~~~lNfmsspGSGKT~LiEk~~~~~~~~~K~Avi~GD~~t~~-DA--------~RlR~~G~~a~~~nTGk~---   95 (225)
T TIGR00073        28 RFDKEGLLVLNFMSSPGSGKTTLIEKLIERLDDEVKIAVIEGDVQTKN-DA--------DRLRKYGVPAIQINTGKE---   95 (225)
T ss_pred             HHHHCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCCEEEEECCHHHHH-HH--------HHHHHCCCEEEEECCCCC---
T ss_conf             998659789980258861158999999998457897899975532255-69--------999864986886368864---


Q ss_pred             HHHHHHHHHHHHH-HHHHHHHHHHHCC-CCCCC-CCCCCCCHHH------------------HHHHHHHCCCCCCCCCCC
Q ss_conf             1224478988889-9877776642000-00112-2357887545------------------455432102575322122
Q gi|254780484|r   98 RAPKKNVDSWGGL-IVRYLSERSTLRC-VYLLI-DCRHGVKQID------------------QDVFSFLDKKAVSYQIVL  156 (212)
Q Consensus        98 ~~~~~~~~~~~~~-~~~~~~~~~~~~~-~~~~~-~~~~~~~~~~------------------~~~~~~~~~~~~~~~~v~  156 (212)
                          ......... ............. +++.+ ....-..+.+                  -...++......--++++
T Consensus        96 ----CHLdA~mv~G~~~~L~~~~ld~~~DlL~IENVGNLvCP~~FdLGe~~rVvllSVTEGdDk~lKyP~~F~~Ad~~~i  171 (225)
T TIGR00073        96 ----CHLDAHMVAGAIHALKDLPLDDISDLLLIENVGNLVCPADFDLGEHMRVVLLSVTEGDDKVLKYPAMFKEADLILI  171 (225)
T ss_pred             ----CCCHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCEECCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHH
T ss_conf             ----4401667865875542168887146268864476100673112356307999865899965466158874445621


Q ss_pred             CCCCCCCH--HHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             22111102--4689999999999753136898689998888899899999999872
Q gi|254780484|r  157 TKIDKLSP--TTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       157 nK~D~~~~--~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      ||.|+++-  -++++-.+.+++.     .+..+|+.+||++|+|+|+..++|.+..
T Consensus       172 nK~DL~~~v~~D~ek~~~d~~~~-----nP~a~Ii~~S~ktg~Gl~~w~~~l~~~~  222 (225)
T TIGR00073       172 NKVDLAEAVGFDVEKMKADARKI-----NPEAEIILVSAKTGKGLDEWLEFLEGKK  222 (225)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHH-----CCCEEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             47889977073678999999862-----8950799863689734789999999864


No 328
>KOG4252 consensus
Probab=98.14  E-value=2.7e-07  Score=61.04  Aligned_cols=160  Identities=14%  Similarity=0.107  Sum_probs=85.2

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHH
Q ss_conf             68689997489988989999973897379873888414521202665556785089649999760010111224478988
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSW  107 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~  107 (212)
                      --.++.|+|.-.|||||++.+.+..= ....+.   .|....  ..+....+.+.+...+++||+|........      
T Consensus        19 ~aiK~vivGng~VGKssmiqryCkgi-fTkdyk---ktIgvd--flerqi~v~~Edvr~mlWdtagqeEfDaIt------   86 (246)
T KOG4252          19 RAIKFVIVGNGSVGKSSMIQRYCKGI-FTKDYK---KTIGVD--FLERQIKVLIEDVRSMLWDTAGQEEFDAIT------   86 (246)
T ss_pred             HHEEEEEECCCCCCHHHHHHHHHCCC-CCCCCC---CCCCHH--HHHHHHHHHHHHHHHHHHHHCCCHHHHHHH------
T ss_conf             53789998788624689999985244-556654---000323--526777740899999998722316677899------


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHH--HHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             889987777664200000112235788754545543--210257532212222111102468999999999975313689
Q gi|254780484|r  108 GGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS--FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
                          ..+........++..-.|...  .+......+  ......+|.+++.||+|++++....+..-+-..  +.   ..
T Consensus        87 ----kAyyrgaqa~vLVFSTTDr~S--Fea~~~w~~kv~~e~~~IPtV~vqNKIDlveds~~~~~evE~la--k~---l~  155 (246)
T KOG4252          87 ----KAYYRGAQASVLVFSTTDRYS--FEATLEWYNKVQKETERIPTVFVQNKIDLVEDSQMDKGEVEGLA--KK---LH  155 (246)
T ss_pred             ----HHHHCCCCCEEEEEECCCHHH--HHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCHHHHHHHH--HH---HH
T ss_conf             ----987425640489985451777--89999999999987556875876422005676521358889999--98---64


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      -..+.+|++...|+.+.+..|.+-+
T Consensus       156 ~RlyRtSvked~NV~~vF~YLaeK~  180 (246)
T KOG4252         156 KRLYRTSVKEDFNVMHVFAYLAEKL  180 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             3432166665400677999999999


No 329
>KOG0465 consensus
Probab=98.10  E-value=8e-06  Score=52.59  Aligned_cols=138  Identities=16%  Similarity=0.228  Sum_probs=87.8

Q ss_pred             EEEEEEC-CCHHHCCCCCCCEEEEECCCCCCHHHHHHHHH---CCC-CEEEECCCCCEE-------EECCEEEEEEEEEE
Q ss_conf             0478623-65675887668689997489988989999973---897-379873888414-------52120266555678
Q gi|254780484|r   12 WIFLRGV-PEIGLLPKAGPPEIAFSGRSNVGKSSLINILV---NRK-NLARTSNAPGRT-------QHLNFFVPKDFSNL   79 (212)
Q Consensus        12 ~~~~~~~-~~~~~~P~~~~p~VaivG~~NvGKSSLiNaL~---g~~-~~a~~~~~p~tt-------~~~~~~~~~~~~~~   79 (212)
                      .++..+. .+....|.+.+..|+|+-+-.+||+|+-+++.   |+- ..-.+... +++       +..+.+.-......
T Consensus        21 ~~~~~~~~~~~~~~~~~k~RNIgi~AhidsgKTT~tEr~Lyy~G~~~~i~ev~~~-~a~md~m~~er~rgITiqSAAt~~   99 (721)
T KOG0465          21 VIEAKSRYESNARIPLNKIRNIGISAHIDAGKTTLTERMLYYTGRIKHIGEVRGG-GATMDSMELERQRGITIQSAATYF   99 (721)
T ss_pred             HHHCCCCCCCCCCCCHHHHCCCCEEEEEECCCCEEEHEEEEECCEEEECCCCCCC-CEEEEHHHHHHHCCCEEEECEEEE
T ss_conf             2210210044555745451003169998269851102001302201002320267-604642777865384464121566


Q ss_pred             EECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             50896499997600101112244789888899877776642000001122357887545455432102575322122221
Q gi|254780484|r   80 KNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKI  159 (212)
Q Consensus        80 ~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~  159 (212)
                      .+....+.++||||+..+...-+.             ...+++....+.++..+...|....-..+..-+.|.+..+||+
T Consensus       100 ~w~~~~iNiIDTPGHvDFT~EVeR-------------ALrVlDGaVlvl~aV~GVqsQt~tV~rQ~~ry~vP~i~FiNKm  166 (721)
T KOG0465         100 TWRDYRINIIDTPGHVDFTFEVER-------------ALRVLDGAVLVLDAVAGVESQTETVWRQMKRYNVPRICFINKM  166 (721)
T ss_pred             EECCCEEEEECCCCCEEEEEEEHH-------------HHHHCCCEEEEEECCCCEEHHHHHHHHHHHHCCCCEEEEEEHH
T ss_conf             404520678548972157977200-------------2520567289997036511135689888876189759998616


Q ss_pred             CCCC
Q ss_conf             1110
Q gi|254780484|r  160 DKLS  163 (212)
Q Consensus       160 D~~~  163 (212)
                      |.+.
T Consensus       167 DRmG  170 (721)
T KOG0465         167 DRMG  170 (721)
T ss_pred             HHCC
T ss_conf             6447


No 330
>pfam05783 DLIC Dynein light intermediate chain (DLIC). This family consists of several eukaryotic dynein light intermediate chain proteins. The light intermediate chains (LICs) of cytoplasmic dynein consist of multiple isoforms, which undergo post-translational modification to produce a large number of species. DLIC1 is known to be involved in assembly, organisation, and function of centrosomes and mitotic spindles when bound to pericentrin. DLIC2 is a subunit of cytoplasmic dynein 2 that may play a role in maintaining Golgi organisation by binding cytoplasmic dynein 2 to its Golgi-associated cargo.
Probab=98.07  E-value=6.3e-05  Score=47.46  Aligned_cols=67  Identities=22%  Similarity=0.282  Sum_probs=50.4

Q ss_pred             HHCCCCCCCCCCCCCCCCCCH-----HHHHHHHHHHHHHHHHCCCC-CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             210257532212222111102-----46899999999997531368-98689998888899899999999872
Q gi|254780484|r  144 FLDKKAVSYQIVLTKIDKLSP-----TTAQETLEKTKYLIRNYPTA-HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       144 ~~~~~~~~~~~v~nK~D~~~~-----~~~~~~~~~~~~~~~~~~~~-~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      +....++|+++|++|+|.+..     .-..+..+.+.+.+..+.+. +-..|++|++...|+|-|.++|.-+|
T Consensus       210 Lt~NLGiPIvVV~tKsD~me~LEKe~dy~dEhFDfIqq~LR~fCLqyGAALiYTSvKe~kN~dlLykYl~HRi  282 (490)
T pfam05783       210 LTHNLGIPVVVVCTKCDAMSVLEKEHDYRDEHFDFIQSHIRRFCLQYGAALIYTSVKEEKNLDLLYKYLVHKI  282 (490)
T ss_pred             CCCCCCCCEEEEEECCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             0004798779999464188887651262067789999999999986196578852354501899999999886


No 331
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF. Members of this protein family are GTP-binding proteins involved in ribosome biogenesis, including the essential YlqF protein of Bacillus subtilis, which is an essential protein. They are related to Era, EngA, and other GTPases of ribosome biogenesis, but are circularly permuted. This family is not universal, and is not present in Escherichia coli, and so is not as well studied as some other GTPases. This model is built for bacterial members.
Probab=98.02  E-value=4e-05  Score=48.59  Aligned_cols=85  Identities=18%  Similarity=0.180  Sum_probs=62.7

Q ss_pred             HHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCC
Q ss_conf             66420000011223578875454554321025753221222211110246899999999997531368986899988888
Q gi|254780484|r  117 ERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKR  196 (212)
Q Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g  196 (212)
                      .....++++.+.|+..+.......+.+..  .++|.++++||+|+++++..+.-.+..+.       .+.+++++||+++
T Consensus        18 ~l~~~DvileV~DAR~Pl~~~n~~l~~~~--~~K~~ilvlNK~DL~~~~~~~~w~~~~~~-------~~~~~~~~sa~~~   88 (276)
T TIGR03596        18 KLKLVDVVIEVLDARIPLSSRNPMIDEIR--GNKPRLIVLNKADLADPAVTKQWLKYFEQ-------KGIKALAINAKKG   88 (276)
T ss_pred             HHHHCCEEEEEEECCCCCCCCCHHHHHHH--CCCCEEEEEECCCCCCHHHHHHHHHHHHH-------CCCCEEEEHHCCC
T ss_conf             98759999999867788786897599986--69967999734345999999999999984-------3991898643074


Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             99899999999872
Q gi|254780484|r  197 KGIEVLRKAILETI  210 (212)
Q Consensus       197 ~Gi~eL~~~I~~~l  210 (212)
                      .|+.+|.+.+.+.+
T Consensus        89 ~~~~~l~~~~~~~~  102 (276)
T TIGR03596        89 KGVKKIIKAAKKLL  102 (276)
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             53899999999999


No 332
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains; InterPro: IPR005690    Two integral outer envelope GTPases, Toc34 and Toc86, are proposed to regulate the recognition and translocation of nuclear-encoded preproteins during the early stages of protein import into chloroplasts. The long precursor of the 86K protein is proposed to have three domains. The N-terminal A-domain is acidic, repetitive, weakly conserved, readily removed by proteolysis during chloroplast isolation, and not required for protein translocation . The other domains are designated G (GTPase) and M (membrane anchor); this family includes most of the G domain and all of M.; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0006886 intracellular protein transport, 0009707 chloroplast outer membrane.
Probab=98.01  E-value=2.2e-05  Score=50.10  Aligned_cols=69  Identities=20%  Similarity=0.219  Sum_probs=49.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             6899974899889899999738973798738884145212026655567850896499997600101112244789
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      ..|-+.|+++||||.=||.++|....+...-.++|++-       .+.....++..++++||||+......+....
T Consensus       125 l~IlVLGK~GVGKSATINSI~~e~~~s~dAf~~~T~~V-------~~i~G~V~Gv~i~viDTPGL~~s~~dQs~N~  193 (772)
T TIGR00993       125 LNILVLGKSGVGKSATINSIFGEVKASIDAFGLGTTSV-------QEIEGLVDGVKIRVIDTPGLKSSASDQSKNE  193 (772)
T ss_pred             EEEEEECCCCCCCCHHHHHHHCCEEEEEECCCCCCCEE-------EEEEEEEEEEEEEEEECCCCCHHHHHHHHCH
T ss_conf             14345515687720101111235001201014666447-------7666677107999975788755554333020


No 333
>KOG0464 consensus
Probab=97.96  E-value=8.2e-06  Score=52.54  Aligned_cols=138  Identities=15%  Similarity=0.188  Sum_probs=94.5

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHH---CCC-CEEEECCCCCEE------EECCEEEEEEEEEEEECCCEEEEEECCHHHHH
Q ss_conf             68689997489988989999973---897-379873888414------52120266555678508964999976001011
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILV---NRK-NLARTSNAPGRT------QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYA   97 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~---g~~-~~a~~~~~p~tt------~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~   97 (212)
                      .+..|+|+.+..+||+|---++.   |.- ....+.+..+.|      +..+.+.-.-.....+.+..+.++||||+-.+
T Consensus        36 kirnigiiahidagktttterily~ag~~~s~g~vddgdtvtdfla~erergitiqsaav~fdwkg~rinlidtpghvdf  115 (753)
T KOG0464          36 KIRNIGIIAHIDAGKTTTTERILYLAGAIHSAGDVDDGDTVTDFLAIERERGITIQSAAVNFDWKGHRINLIDTPGHVDF  115 (753)
T ss_pred             HHHCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCEEEEEEEECCCCCCEEEEECCCCCCEE
T ss_conf             64113069985178740678899774022104656788537788888886483665404421235616765248884037


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             12244789888899877776642000001122357887545455432102575322122221111024689999999999
Q gi|254780484|r   98 RAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYL  177 (212)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~  177 (212)
                      ...-+.-             ..+++....+.+...++..+.+..-.......+|....+||+|++..+. +...+.+++.
T Consensus       116 ~leverc-------------lrvldgavav~dasagve~qtltvwrqadk~~ip~~~finkmdk~~anf-e~avdsi~ek  181 (753)
T KOG0464         116 RLEVERC-------------LRVLDGAVAVFDASAGVEAQTLTVWRQADKFKIPAHCFINKMDKLAANF-ENAVDSIEEK  181 (753)
T ss_pred             EEEHHHH-------------HHHHCCEEEEEECCCCCCCCEEEEEHHCCCCCCCHHHHHHHHHHHHHHH-HHHHHHHHHH
T ss_conf             9878988-------------8775073899845677664122100030135784533023466655546-6688999987


Q ss_pred             HH
Q ss_conf             75
Q gi|254780484|r  178 IR  179 (212)
Q Consensus       178 ~~  179 (212)
                      +.
T Consensus       182 l~  183 (753)
T KOG0464         182 LG  183 (753)
T ss_pred             HC
T ss_conf             38


No 334
>PRK09563 rbgA ribosomal biogenesis GTPase; Reviewed
Probab=97.95  E-value=7.9e-05  Score=46.89  Aligned_cols=85  Identities=13%  Similarity=0.135  Sum_probs=62.3

Q ss_pred             HHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCC
Q ss_conf             66420000011223578875454554321025753221222211110246899999999997531368986899988888
Q gi|254780484|r  117 ERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKR  196 (212)
Q Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g  196 (212)
                      .....++++.+.|+..+.......+.+..  ..+|.++++||+|+++++..+.-    .+.+.   ..+.+++++||+++
T Consensus        21 ~l~~~DvileV~DAR~Pl~~~n~~l~~~~--~~K~~ilvlNK~DL~~~~~~~~w----~~~~~---~~~~~~~~~sa~~~   91 (282)
T PRK09563         21 NLKKVDVVIEVLDARIPLSSENPMIDKII--GNKPRLLVLNKSDLADPEVTKKW----IEYFE---EQGVKALAINAKEG   91 (282)
T ss_pred             HHHHCCEEEEEEECCCCCCCCCHHHHHHH--CCCCEEEEEECCCCCCHHHHHHH----HHHHH---HCCCCEEEEECCCC
T ss_conf             98769999999765477675887599997--68976999755548899999999----99997---04995699746674


Q ss_pred             CCHHHHHHHHHHHH
Q ss_conf             99899999999872
Q gi|254780484|r  197 KGIEVLRKAILETI  210 (212)
Q Consensus       197 ~Gi~eL~~~I~~~l  210 (212)
                      .|+.++.+.+.+.+
T Consensus        92 ~~~~~l~~~~~~~~  105 (282)
T PRK09563         92 QGVKKILKAAKKLG  105 (282)
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             33889999999999


No 335
>PRK12288 ribosome-associated GTPase; Reviewed
Probab=97.94  E-value=2.5e-05  Score=49.79  Aligned_cols=69  Identities=23%  Similarity=0.201  Sum_probs=51.5

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             4545543210257532212222111102468999999999975313689868999888889989999999987
Q gi|254780484|r  137 IDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       137 ~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      ....+.-.....+++.++++||+|++++++..    .+.+.+..|...+-+++.+||+++.|+++|++.|...
T Consensus       140 liDRyLv~ae~~~I~pvIvlNK~DL~~~~~~~----~~~~~l~~Y~~lGY~v~~~Sa~~~~gl~~L~~~L~~k  208 (344)
T PRK12288        140 IIDRYLVACETLGIEPLIVLNKIDLLDDEERP----FVNEQLDIYRNIGYRVLMVSSHTGEGLEPLEAALTGR  208 (344)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECHHCCCHHHHH----HHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHCCC
T ss_conf             99999999998699779997314408977899----9999999998679739997368862899999987678


No 336
>cd01849 YlqF_related_GTPase YlqF-related GTPases.  These proteins are found in bacteria, eukaryotes, and archaea.  They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.
Probab=97.93  E-value=2.7e-05  Score=49.53  Aligned_cols=83  Identities=20%  Similarity=0.221  Sum_probs=59.9

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHCC-CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHH
Q ss_conf             00001122357887545455432102-57532212222111102468999999999975313689868999888889989
Q gi|254780484|r  122 RCVYLLIDCRHGVKQIDQDVFSFLDK-KAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE  200 (212)
Q Consensus       122 ~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~  200 (212)
                      ++++.+.|+..+....+..+.+.+.. ..+|.++++||+|+++++..++-.    ..+.  ...+..++++||.++.|++
T Consensus         1 D~il~VvDaR~pl~~~~~~~~~~l~~~~~K~~ilvlNK~Dl~~~~~~~~w~----~~~~--~~~~~~~~~~S~~~~~~~~   74 (155)
T cd01849           1 DVILEVLDARDPLGTRSPDIERVLIKEKGKKLILVLNKADLVPKEVLRKWL----AYLR--HSYPTIPFKISATNGQGIE   74 (155)
T ss_pred             CEEEEEEECCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHH----HHHH--HCCCCCEEEHHHCCCCCHH
T ss_conf             989999968799998899999999865899489997673458989999999----9999--6299851671102674568


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999999872
Q gi|254780484|r  201 VLRKAILETI  210 (212)
Q Consensus       201 eL~~~I~~~l  210 (212)
                      ++.+.+.+.+
T Consensus        75 ~~~~~~~~~~   84 (155)
T cd01849          75 KKESAFTKQT   84 (155)
T ss_pred             HHHHHHHHHH
T ss_conf             8999999871


No 337
>TIGR00485 EF-Tu translation elongation factor Tu; InterPro: IPR004541   Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution.   EF1A (also known as EF-1alpha or EF-Tu) is a G-protein. It forms a ternary complex of EF1A-GTP-aminoacyltRNA. The binding of aminoacyl-tRNA stimulates GTP hydrolysis by EF1A, causing a conformational change in EF1A that causes EF1A-GDP to detach from the ribosome, leaving the aminoacyl-tRNA attached at the A-site. Only the cognate aminoacyl-tRNA can induce the required conformational change in EF1A through its tight anticodon-codon binding , . EF1A-GDP is returned to its active state, EF1A-GTP, through the action of another elongation factor, EF1B (also known as EF-Ts or EF-1beta/gamma/delta).   This entry represents EF1A (or EF-Tu) proteins found primarily in bacteria, mitochondria and chloroplasts. Eukaryotic and archaeal EF1A (IPR004539 from INTERPRO) are excluded from this entry. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors .   More information about these proteins can be found at Protein of the Month: Elongation Factors .; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005622 intracellular.
Probab=97.83  E-value=0.00021  Score=44.40  Aligned_cols=165  Identities=18%  Similarity=0.247  Sum_probs=108.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHCC---CCEE------EECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHH
Q ss_conf             8999748998898999997389---7379------873888414521202665556785089649999760010111224
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNR---KNLA------RTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK  101 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~---~~~a------~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~  101 (212)
                      .|+-+|+-.+||+||--|++..   +..+      .....|- ....+.+..............+.-+|.||+..+..  
T Consensus        14 n~GtiGhvdhGkttl~aa~~~~l~~~~~~~~~~y~~id~aPe-e~~rGiti~~~~vey~~~~rhyahvdCPGhadyvk--   90 (394)
T TIGR00485        14 NIGTIGHVDHGKTTLTAAITTVLAKEGKAAAKKYDEIDKAPE-EKARGITINTAHVEYETEKRHYAHVDCPGHADYVK--   90 (394)
T ss_pred             EEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-HHHCCEEEEEEEEEECCCCCCEEEECCCCHHHHHH--
T ss_conf             330121001550578999999987510035676776523721-13345156533554214675157631886267888--


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCC-CCCCCCCCCCCHHHHHHHHH-HHHHHHH
Q ss_conf             478988889987777664200000112235788754545543210257532-21222211110246899999-9999975
Q gi|254780484|r  102 KNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSY-QIVLTKIDKLSPTTAQETLE-KTKYLIR  179 (212)
Q Consensus       102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~v~nK~D~~~~~~~~~~~~-~~~~~~~  179 (212)
                                 .........+..+.+....+....+..+..-.....+.|. ++.+||+|.+++.+..+..+ ++++++.
T Consensus        91 -----------nmitGaaqmdGailvv~~~d~~mPqt~ehill~~~vGvP~~vvflnk~d~~~~~el~~lv~~e~~~ll~  159 (394)
T TIGR00485        91 -----------NMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPKIVVFLNKVDMVDDEELLELVELEVRELLS  159 (394)
T ss_pred             -----------HHHHHHHHCCCEEEEEECCCCCCCCCHHHEEEECCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             -----------764101111760799952788887411210010026876578764023322427899999999999987


Q ss_pred             HCCCC--CCCEEEEECCCCC-CHHHHHHHHHHH
Q ss_conf             31368--9868999888889-989999999987
Q gi|254780484|r  180 NYPTA--HPEVIPTSSVKRK-GIEVLRKAILET  209 (212)
Q Consensus       180 ~~~~~--~~~i~~vSA~~g~-Gi~eL~~~I~~~  209 (212)
                      .+...  ..|++.-||.+.. |-.+..+.|.+.
T Consensus       160 ~~~f~G~~~Pi~~Gsal~al~~~~~~~~~~~~l  192 (394)
T TIGR00485       160 EYDFPGDDVPIVRGSALKALEGDAEWEEKILEL  192 (394)
T ss_pred             HCCCCCCCCCEEECHHHHHHHHHHHHHHHHHHH
T ss_conf             407898652256114565420036799999999


No 338
>KOG0054 consensus
Probab=97.82  E-value=1.6e-05  Score=50.94  Aligned_cols=20  Identities=45%  Similarity=0.677  Sum_probs=12.5

Q ss_pred             EEEEECCCCCCHHHHHHHHH
Q ss_conf             89997489988989999973
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILV   50 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~   50 (212)
                      +|+|||||++|||||++||+
T Consensus      1168 KVGIVGRTGaGKSSL~~aLF 1187 (1381)
T KOG0054        1168 KVGIVGRTGAGKSSLILALF 1187 (1381)
T ss_pred             EEEEECCCCCCHHHHHHHHH
T ss_conf             68886898998899999999


No 339
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein; InterPro: IPR005285   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This family includes transporters, whose physiological function is not yet established. These proteins are thought to confer resistance to the chemicals cycloheximide and sulphomethuron methyl, BFA, azole antifungal agents, other antifungal agents: amorolfine and terbinafine. Some of them could serve as an efflux pump of various antibiotics..
Probab=97.75  E-value=1e-04  Score=46.31  Aligned_cols=23  Identities=39%  Similarity=0.668  Sum_probs=20.8

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             99974899889899999738973
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRKN   54 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~~   54 (212)
                      =||||.++|||+||+|.|.++..
T Consensus       856 TALMG~SGAGKTTLLn~La~R~t  878 (1466)
T TIGR00956       856 TALMGASGAGKTTLLNVLAERVT  878 (1466)
T ss_pred             EECCCCCCCCHHHHHHHHHCCCC
T ss_conf             65157887635788864433043


No 340
>KOG0083 consensus
Probab=97.70  E-value=1.4e-05  Score=51.16  Aligned_cols=157  Identities=17%  Similarity=0.151  Sum_probs=78.4

Q ss_pred             EECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97489988989999973897379873888414521202665556785089649999760010111224478988889987
Q gi|254780484|r   34 FSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVR  113 (212)
Q Consensus        34 ivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~  113 (212)
                      ++|.+.+||+-|+=+.-..-.++.  +.   ....+.-..+....+......+.++||+|.+++........+       
T Consensus         2 llgds~~gktcllir~kdgafl~~--~f---istvgid~rnkli~~~~~kvklqiwdtagqerfrsvt~ayyr-------   69 (192)
T KOG0083           2 LLGDSCTGKTCLLIRFKDGAFLAG--NF---ISTVGIDFRNKLIDMDDKKVKLQIWDTAGQERFRSVTHAYYR-------   69 (192)
T ss_pred             CCCCCCCCCEEEEEEECCCCEECC--CE---EEEEEECCCCCEECCCCCEEEEEEEECCCHHHHHHHHHHHHC-------
T ss_conf             345676685689999516740037--61---133200121304513883899998523145777554476631-------


Q ss_pred             HHHHHHHHCCCCCCCC-CCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEE
Q ss_conf             7776642000001122-357887545455432102575322122221111024689999999999753136898689998
Q gi|254780484|r  114 YLSERSTLRCVYLLID-CRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS  192 (212)
Q Consensus       114 ~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vS  192 (212)
                         +...+.....+.. ++-......+..+...........++.||+|+.....+.  .+.=+.+.+.|   +.|+..+|
T Consensus        70 ---da~allllydiankasfdn~~~wlsei~ey~k~~v~l~llgnk~d~a~er~v~--~ddg~kla~~y---~ipfmets  141 (192)
T KOG0083          70 ---DADALLLLYDIANKASFDNCQAWLSEIHEYAKEAVALMLLGNKCDLAHERAVK--RDDGEKLAEAY---GIPFMETS  141 (192)
T ss_pred             ---CCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHCCC--CCHHHHHHHHH---CCCCEECC
T ss_conf             ---65625543321130107789999999999988667675442535541230456--53178899987---99716403


Q ss_pred             CCCCCCHHHHHHHHHHHH
Q ss_conf             888899899999999872
Q gi|254780484|r  193 SVKRKGIEVLRKAILETI  210 (212)
Q Consensus       193 A~~g~Gi~eL~~~I~~~l  210 (212)
                      |++|.|+|.-.-.|.+.+
T Consensus       142 aktg~nvd~af~~ia~~l  159 (192)
T KOG0083         142 AKTGFNVDLAFLAIAEEL  159 (192)
T ss_pred             CCCCCCHHHHHHHHHHHH
T ss_conf             302643768999999999


No 341
>KOG3905 consensus
Probab=97.67  E-value=0.002  Score=38.87  Aligned_cols=67  Identities=21%  Similarity=0.243  Sum_probs=52.2

Q ss_pred             HHCCCCCCCCCCCCCCCCC-----CHHHHHHHHHHHHHHHHHCCCC-CCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             2102575322122221111-----0246899999999997531368-98689998888899899999999872
Q gi|254780484|r  144 FLDKKAVSYQIVLTKIDKL-----SPTTAQETLEKTKYLIRNYPTA-HPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       144 ~~~~~~~~~~~v~nK~D~~-----~~~~~~~~~~~~~~~~~~~~~~-~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
                      .....++|+++|++|+|.+     ..+...+..+.++..+..+.+. +-..+++|++...|||-|.++|...+
T Consensus       217 Lt~NlGi~vlVV~TK~D~~s~leke~eyrDehfdfiq~~lRkFCLr~GaaLiyTSvKE~KNidllyKYivhr~  289 (473)
T KOG3905         217 LTHNLGIPVLVVCTKCDAVSVLEKEHEYRDEHFDFIQSHLRKFCLRYGAALIYTSVKETKNIDLLYKYIVHRS  289 (473)
T ss_pred             HHHCCCCCEEEEEECCCHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             1212797479999534236676530100588899999999999987084368852133543579999988874


No 342
>KOG0077 consensus
Probab=97.64  E-value=0.00024  Score=44.14  Aligned_cols=153  Identities=19%  Similarity=0.155  Sum_probs=75.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785089649999760010111224478988889
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGL  110 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~  110 (212)
                      ++.+.|--||||+||++.|-.. +++.  ..||-..+.        ....+.+..+.-.|..|+...      ..  ...
T Consensus        22 KllFlGLDNAGKTTLLHMLKdD-rl~q--hvPTlHPTS--------E~l~Ig~m~ftt~DLGGH~qA------rr--~wk   82 (193)
T KOG0077          22 KLLFLGLDNAGKTTLLHMLKDD-RLGQ--HVPTLHPTS--------EELSIGGMTFTTFDLGGHLQA------RR--VWK   82 (193)
T ss_pred             EEEEEEECCCCHHHHHHHHCCC-CCCC--CCCCCCCCH--------HHHEECCCEEEEECCCCHHHH------HH--HHH
T ss_conf             1899951577526689887330-0113--578768976--------773135715899725667999------98--888


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCC--CCCHHHHH---HHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC---
Q ss_conf             9877776642000001122357--88754545---543210257532212222111102468999999999975313---
Q gi|254780484|r  111 IVRYLSERSTLRCVYLLIDCRH--GVKQIDQD---VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP---  182 (212)
Q Consensus       111 ~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~---~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~---  182 (212)
                      .+.     ...+.+.+..++-.  .+.+...+   ..........|+++..||+|.......++. ...........   
T Consensus        83 dyf-----~~v~~iv~lvda~d~er~~es~~el~~ll~~e~la~vp~lilgnKId~~~a~se~~l-~~~l~l~~~t~~~~  156 (193)
T KOG0077          83 DYF-----PQVDAIVYLVDAYDQERFAESKKELDALLSDESLATVPFLILGNKIDIPYAASEDEL-RFHLGLSNFTTGKG  156 (193)
T ss_pred             HHH-----HHHCEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCHHHH-HHHHHHHHHHCCCC
T ss_conf             787-----654316853011217776778999998876887715861011165568873337999-89999888742465


Q ss_pred             ------CC--CCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             ------68--986899988888998999999998
Q gi|254780484|r  183 ------TA--HPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       183 ------~~--~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                            ..  ...++.+|...+.|-.+-.+.+.+
T Consensus       157 ~v~~~~~~~rp~evfmcsi~~~~gy~e~fkwl~q  190 (193)
T KOG0077         157 KVNLTDSNVRPLEVFMCSIVRKMGYGEGFKWLSQ  190 (193)
T ss_pred             CCCCCCCCCCEEEEEEEEEECCCCCCEEEEEHHH
T ss_conf             2124688877568998998636766310010002


No 343
>TIGR02857 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydD; InterPro: IPR014216   The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain and a C-terminal ATP-binding domain. In Escherichia coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in the export of redox-active thiol compounds such as cysteine and glutathione , . The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components.    The genes used as the seed members for this entry are all either found in the gammaproteobacterial context, or the CydABCD context. All members of this entry scoring above the trusted cut off at the time of its creation were from genomes which encode a cytochrome bd complex. Unfortunately, the gene symbol nomenclature, based on this operon in Bacillus subtilis, assigns cydC to the third gene in the operon, where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologues in this family in accordance with the precedence of publication of the E. coli name, CydD..
Probab=97.63  E-value=3.8e-05  Score=48.70  Aligned_cols=22  Identities=41%  Similarity=0.685  Sum_probs=21.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHCC
Q ss_conf             8999748998898999997389
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNR   52 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~   52 (212)
                      +|||+|.+++|||||+|.|.|-
T Consensus       380 ~vAl~G~SGaGKSTLL~lLLGf  401 (570)
T TIGR02857       380 RVALVGPSGAGKSTLLNLLLGF  401 (570)
T ss_pred             EEEEEECCCCCHHHHHHHHHCC
T ss_conf             4888627999788999999715


No 344
>KOG0447 consensus
Probab=97.62  E-value=0.0012  Score=40.05  Aligned_cols=182  Identities=19%  Similarity=0.240  Sum_probs=86.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEEC-----CCCCE--------------EE--------------------
Q ss_conf             7668689997489988989999973897379873-----88841--------------45--------------------
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTS-----NAPGR--------------TQ--------------------   66 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~-----~~p~t--------------t~--------------------   66 (212)
                      .+++|+|.+||-..+||+|.+-.+..++.....+     ..|.+              +.                    
T Consensus       305 ~DhLPRVVVVGDQSaGKTSVLEmiAqARIFPRGSGEMMTRaPVKVTLsEGPyHVAqFrDSsREfDLTKE~DLq~LR~e~E  384 (980)
T KOG0447         305 QDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIE  384 (980)
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHCCCCCCCCCEECCCCEEEEECCCCCHHHHHCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             14686279975666662289999987430768885310037747881468603454246542246541557999988888


Q ss_pred             -------ECCEEEEEEEEEE---EECCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC--CCCCCC
Q ss_conf             -------2120266555678---5089649999760010111224478988889987777664200000112--235788
Q gi|254780484|r   67 -------HLNFFVPKDFSNL---KNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLI--DCRHGV  134 (212)
Q Consensus        67 -------~~~~~~~~~~~~~---~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~  134 (212)
                             .-+.+.-.....+   ..+...+.++|.||........-..........+..+-.......+.++  ......
T Consensus       385 ~RMr~sVr~GkTVSnEvIsltVKGPgLqRMVLVDLPGvIsTvT~dMA~dTKd~I~~msKayM~NPNAIILCIQDGSVDAE  464 (980)
T KOG0447         385 LRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAE  464 (980)
T ss_pred             HHHHHCCCCCCCCCCCEEEEEECCCCCCEEEEECCCCHHHHHCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHH
T ss_conf             99885035785145121689721899623688637732544002346431677999999974599838999516873055


Q ss_pred             CHHHHHHHHHHCCCCCCCCCCCCCCCCCCHH-HHHHHHHHHHHHHHHCCCCCCCEEEEECCCC---CCHHHHHHHHHH
Q ss_conf             7545455432102575322122221111024-6899999999997531368986899988888---998999999998
Q gi|254780484|r  135 KQIDQDVFSFLDKKAVSYQIVLTKIDKLSPT-TAQETLEKTKYLIRNYPTAHPEVIPTSSVKR---KGIEVLRKAILE  208 (212)
Q Consensus       135 ~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~-~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g---~Gi~eL~~~I~~  208 (212)
                      +.....+...+...+...++|++|.|+..++ .....+..+-+. +.+++.--.++.|-.-+|   ..||++++.=.+
T Consensus       465 RSnVTDLVsq~DP~GrRTIfVLTKVDlAEknlA~PdRI~kIleG-KLFPMKALGYfaVVTGrGnssdSIdaIR~YEE~  541 (980)
T KOG0447         465 RSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEG-KLFPMKALGYFAVVTGKGNSSESIEAIREYEEE  541 (980)
T ss_pred             HHHHHHHHHHCCCCCCEEEEEEEECCHHHHCCCCHHHHHHHHHC-CCCCHHHCCEEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             51388898713877873699985111564405987999998725-734143332268985688861028999999998


No 345
>PRK00098 ribosome-associated GTPase; Reviewed
Probab=97.62  E-value=0.00017  Score=45.00  Aligned_cols=67  Identities=16%  Similarity=0.242  Sum_probs=47.3

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             5454554321025753221222211110246899999999997531368986899988888998999999998
Q gi|254780484|r  136 QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       136 ~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                      .....+.-.....+++.++++||+|++++.+..      ...+..|...+-+++++||+++.|+++|++.|..
T Consensus        98 ~~idR~Lv~a~~~~i~pvivlnK~DL~~~~~~~------~~~~~~y~~~gy~v~~~S~~~~~g~~~L~~~l~~  164 (298)
T PRK00098         98 DLLDRFLVLAEANDIKPIIVLNKIDLVDDLEEA------RERLALYRAIGYDVLELSAKEGPGLDELKPLLAG  164 (298)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHH------HHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHCC
T ss_conf             999999999998699589996424564779999------9999999878997899968999899999998579


No 346
>PRK12289 ribosome-associated GTPase; Reviewed
Probab=97.61  E-value=0.00023  Score=44.27  Aligned_cols=66  Identities=20%  Similarity=0.144  Sum_probs=48.6

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             4545543210257532212222111102468999999999975313689868999888889989999999987
Q gi|254780484|r  137 IDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILET  209 (212)
Q Consensus       137 ~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~  209 (212)
                      ....+.-.....+++.++++||+|++++.+.....    ....   ..+-+++++|+.+|.|+++|++.|...
T Consensus       107 ~LDRfLv~ae~~~i~~vivlnK~DL~~~~e~~~~~----~~~~---~~GY~~i~iS~~~~~gl~~L~~~L~~k  172 (351)
T PRK12289        107 QLSRFLVKAESTGLEIQLCLNKADLVSPTQQQQWQ----DRLA---QWGYQPLFISVEQGIGLEALLKQLRNK  172 (351)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEHHHCCCHHHHHHHH----HHHH---HCCCCEEEEECCCCCCHHHHHHHHCCC
T ss_conf             99999999998799789998657749989999999----9999---779828999678996899999987598


No 347
>KOG3859 consensus
Probab=97.59  E-value=0.00025  Score=43.99  Aligned_cols=144  Identities=22%  Similarity=0.303  Sum_probs=75.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCE--EEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHH----H
Q ss_conf             8999748998898999997389737--987388841452120266555678508964999976001011122447----8
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNL--ARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKN----V  104 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~--a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~----~  104 (212)
                      .|--||-++-|||||++.|++.+..  ......|+.....+++....    ..-...+.++||.|+.........    .
T Consensus        44 NilCvGETg~GKsTLmdtLFNt~f~~~p~~H~~~~V~L~~~TyelqE----snvrlKLtiv~tvGfGDQinK~~Syk~iV  119 (406)
T KOG3859          44 NILCVGETGLGKSTLMDTLFNTKFESEPSTHTLPNVKLQANTYELQE----SNVRLKLTIVDTVGFGDQINKEDSYKPIV  119 (406)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCEEECCHHHHHH----CCEEEEEEEEEECCCCCCCCCCCCCCHHH
T ss_conf             78884267754778999986366678878667887321002143442----57168999984034432137100102699


Q ss_pred             HHHHHHHHHH-------------HHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             9888899877-------------776642000001122357887545455432102575322122221111024689999
Q gi|254780484|r  105 DSWGGLIVRY-------------LSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETL  171 (212)
Q Consensus       105 ~~~~~~~~~~-------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~  171 (212)
                      .......+.+             ..+...-.+..++.....+....++.....+ .....++.++-|.|.+.+++....-
T Consensus       120 dyidaQFEaYLQEELKi~Rsl~~~hDsRiH~CLYFI~PTGH~LKslDLvtmk~L-dskVNIIPvIAKaDtisK~eL~~FK  198 (406)
T KOG3859         120 DYIDAQFEAYLQEELKIRRSLFTYHDSRIHVCLYFISPTGHSLKSLDLVTMKKL-DSKVNIIPVIAKADTISKEELKRFK  198 (406)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999987788888875267258999995688741457799999987-5340157888876443099999999


Q ss_pred             HHHHHHHH
Q ss_conf             99999975
Q gi|254780484|r  172 EKTKYLIR  179 (212)
Q Consensus       172 ~~~~~~~~  179 (212)
                      ..+...+.
T Consensus       199 ~kimsEL~  206 (406)
T KOG3859         199 IKIMSELV  206 (406)
T ss_pred             HHHHHHHH
T ss_conf             99999998


No 348
>PRK09866 hypothetical protein; Provisional
Probab=97.58  E-value=1.9e-05  Score=50.47  Aligned_cols=25  Identities=36%  Similarity=0.505  Sum_probs=22.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCE
Q ss_conf             8999748998898999997389737
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNL   55 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~   55 (212)
                      ..||||.--+||||.|||+.|++.+
T Consensus        71 vlaiVgtMKAGKSTtINAIVG~evL   95 (742)
T PRK09866         71 VLAIVGTMKAGKSTTINAIVGTEVL   95 (742)
T ss_pred             HHHHHCCCCCCCCEEHHHHHCCCCC
T ss_conf             9875100236752221676334227


No 349
>KOG0446 consensus
Probab=97.56  E-value=5.3e-05  Score=47.90  Aligned_cols=139  Identities=19%  Similarity=0.100  Sum_probs=72.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEE----E---------CCEE--EEEEEEEEEE---------
Q ss_conf             76686899974899889899999738973798738884145----2---------1202--6655567850---------
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ----H---------LNFF--VPKDFSNLKN---------   81 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~----~---------~~~~--~~~~~~~~~~---------   81 (212)
                      .-.+|.|++||...+||||.++++.|+..++......|+..    .         ...+  +.........         
T Consensus        26 ~i~lP~I~vvG~QSsGKSSvLE~lvG~~flpRg~givTRrPlvlqL~~~~~~~~e~~~f~~h~~~~~~~D~~~vrkeI~~  105 (657)
T KOG0446          26 FIPLPQIVVVGGQSSGKSSVLESLVGFVFLPRGVGIVTRRPLILQLSIVAGGDEEEASFLTHDKKKRFTDFEEVRKEIRS  105 (657)
T ss_pred             CCCCCCEEEECCCCCCCHHHHHHHHCCCCCCCCCCCEECCCCEEECCCCCCCCCCCHHHHHCCCCCCCCCHHHHHHHHHH
T ss_conf             67788569977988861179998526635677667541465024423247886531232212775235887999999886


Q ss_pred             ------------------------CCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC--CCCCCCC
Q ss_conf             ------------------------89649999760010111224478988889987777664200000112--2357887
Q gi|254780484|r   82 ------------------------NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLI--DCRHGVK  135 (212)
Q Consensus        82 ------------------------~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~  135 (212)
                                              ......++|.||+.......+..........+....+......+...  .......
T Consensus       106 et~~~~g~~kgiS~~pI~L~i~s~~v~~lTlvDlPG~tkvpv~dqp~di~~qI~~mi~~yi~~~~~iILav~~an~d~at  185 (657)
T KOG0446         106 ETDRITGSNKGISPVPITLKIFSALVANLTLVDLPGLTKVPVADQPDDIEEEIKSMIEEYIEKPNRIILAVTPANSDIAT  185 (657)
T ss_pred             HHHHHHCCCCCCCCCCEEEEECCCCCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHCCCHHHHHHC
T ss_conf             28876089988688871575068888514316789873467799984589999999998556630256521504545434


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCH
Q ss_conf             54545543210257532212222111102
Q gi|254780484|r  136 QIDQDVFSFLDKKAVSYQIVLTKIDKLSP  164 (212)
Q Consensus       136 ~~~~~~~~~~~~~~~~~~~v~nK~D~~~~  164 (212)
                      ..-..+.......+...+.|++|.|+.+.
T Consensus       186 s~alkiarevDp~g~RTigvitK~Dlmdk  214 (657)
T KOG0446         186 SPALVVAREVDPGGSRTLEVITKFDFMDK  214 (657)
T ss_pred             CHHHHHHHHHCCCCCCHHHHHHHHHHHHC
T ss_conf             78999998618876612588650776433


No 350
>KOG0071 consensus
Probab=97.55  E-value=0.00024  Score=44.16  Aligned_cols=156  Identities=13%  Similarity=0.180  Sum_probs=86.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
                      .+|.-+|...+||+|++-+|.-.+.   +...|++.    +   .. ..+......+...|..|.....      ..+.+
T Consensus        18 ~~ilmlGLd~aGKTtiLyKLkl~~~---~~~ipTvG----F---nv-etVtykN~kfNvwdvGGqd~iR------plWrh   80 (180)
T KOG0071          18 MRILMLGLDAAGKTTILYKLKLGQS---VTTIPTVG----F---NV-ETVTYKNVKFNVWDVGGQDKIR------PLWRH   80 (180)
T ss_pred             CEEEEEECCCCCCEEHHHHHHCCCC---CCCCCCCC----E---EE-EEEEEEEEEEEEEECCCCHHHH------HHHHH
T ss_conf             2178881266884003468762897---64035542----0---47-7777300688521226712204------88986


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCC--HHHH---HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99877776642000001122357887--5454---554321025753221222211110246899999999997531368
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVK--QIDQ---DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~---~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
                        +.     .-....+++.|......  +...   .++........++++..||-|+-+.-..++..+..+  ++.....
T Consensus        81 --Yy-----~gtqglIFV~Dsa~~dr~eeAr~ELh~ii~~~em~~~~~LvlANkQDlp~A~~pqei~d~le--Le~~r~~  151 (180)
T KOG0071          81 --YY-----TGTQGLIFVVDSADRDRIEEARNELHRIINDREMRDAIILILANKQDLPDAMKPQEIQDKLE--LERIRDR  151 (180)
T ss_pred             --HC-----CCCCEEEEEEECCCCCHHHHHHHHHHHHHCCHHHHCCEEEEEECCCCCCCCCCHHHHHHHHC--CCCCCCC
T ss_conf             --35-----67725999982432104999999999985787661205898854665522169899888754--2312699


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             986899988888998999999998728
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      ...+.|.||.+|.|+.+=...|.+.++
T Consensus       152 ~W~vqp~~a~~gdgL~eglswlsnn~~  178 (180)
T KOG0071         152 NWYVQPSCALSGDGLKEGLSWLSNNLK  178 (180)
T ss_pred             CCEEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             606603534440278889999985526


No 351
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein; InterPro: IPR005968   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     Thiamine pyrophosphate (TPP) is a required cofactor synthesized de novo in Salmonella typhimurium. The primary role for TPP is in central metabolism as an electron carrier and nucleophile for such enzymes as pyruvate dehydrogenase (1.2.4.1 from EC), acetolactate synthase (4.1.3.18 from EC), and alpha-ketoglutarate dehydrogenase (1.2.4.2 from EC).    Despite its importance in cellular physiology, neither the de novo biosynthetic pathway nor the salvage systems for thiamine are fully understood in any organism.    The model describes thiamine ABC transporter, ATP-binding protein, believed to be involved in the specific translocation of thiamine and its phosphoesters across the inner membrane The protein belongs to the larger ABC transport system which consists of at least three components: the inner membrane permease; thiamine binding protein and an ATP-binding subunit. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found. It has been experimentally demonstrated that mutants in the various steps in the de novo synthesis of thiamine and its biologically active form, namely thiamine pyrophosphate can be exogenously supplemented with thiamine, thiamine monophosphate or thiamine pyrophosphate. ; GO: 0005524 ATP binding, 0042626 ATPase activity coupled to transmembrane movement of substances, 0006810 transport, 0009276 1-2nm peptidoglycan-based cell wall.
Probab=97.55  E-value=5.2e-05  Score=47.94  Aligned_cols=28  Identities=29%  Similarity=0.411  Sum_probs=23.1

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCC
Q ss_conf             7668689997489988989999973897
Q gi|254780484|r   26 KAGPPEIAFSGRSNVGKSSLINILVNRK   53 (212)
Q Consensus        26 ~~~~p~VaivG~~NvGKSSLiNaL~g~~   53 (212)
                      -++.=.|||+|.++||||||+|=+.|-.
T Consensus        21 V~~Ge~VAi~GpSGAGKSTLLnLiAGF~   48 (213)
T TIGR01277        21 VEDGERVAILGPSGAGKSTLLNLIAGFL   48 (213)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             3017768887589862788987786404


No 352
>KOG0393 consensus
Probab=97.54  E-value=3.9e-05  Score=48.67  Aligned_cols=156  Identities=15%  Similarity=0.148  Sum_probs=79.2

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEE---CCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850---896499997600101112244789
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN---NLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~---~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
                      ..++.|||--.+||++|+-..+...       .|+....+.  ..+.......   ....+.++||+|.+.+.-      
T Consensus         4 ~~K~VvVGDga~GKT~ll~~~t~~~-------fp~~yvPTV--Fdnys~~v~V~dg~~v~L~LwDTAGqedYDr------   68 (198)
T KOG0393           4 RIKCVVVGDGAVGKTCLLISYTTNA-------FPEEYVPTV--FDNYSANVTVDDGKPVELGLWDTAGQEDYDR------   68 (198)
T ss_pred             EEEEEEECCCCCCCEEEEEEECCCC-------CCCCCCCEE--ECCCEEEEEECCCCEEEEEEEECCCCCCCCC------
T ss_conf             3699998988767458898843576-------866545638--7562389996489789986331479730113------


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCC----HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHH---------
Q ss_conf             888899877776642000001122357887----5454554321025753221222211110246899999---------
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVK----QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLE---------  172 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~---------  172 (212)
                       ...+  .+- ....+..+..+.+ ...+.    ++..++...  ....|+++|.+|.|+-++....+.+.         
T Consensus        69 -lRpl--sY~-~tdvfl~cfsv~~-p~S~~nv~~kW~pEi~~~--cp~vpiiLVGtk~DLr~d~~~~~~l~~~~~~~Vt~  141 (198)
T KOG0393          69 -LRPL--SYP-QTDVFLLCFSVVS-PESFENVKSKWIPEIKHH--CPNVPIILVGTKADLRDDPSTLEKLQRQGLEPVTY  141 (198)
T ss_pred             -CCCC--CCC-CCCEEEEEEECCC-HHHHHHHHHHHHHHHHHH--CCCCCEEEEEEHHHHHHCHHHHHHHHHCCCCCCCH
T ss_conf             -3636--778-8888999987698-266888775106889963--89998899821277653878899987465786567


Q ss_pred             -HHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             -999997531368986899988888998999999998
Q gi|254780484|r  173 -KTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       173 -~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
                       .-.++..  ..+-..++.+||++..|+.+..+.-..
T Consensus       142 ~~g~~lA~--~iga~~y~EcSa~tq~~v~~vF~~a~~  176 (198)
T KOG0393         142 EQGLELAK--EIGAVKYLECSALTQKGVKEVFDEAIR  176 (198)
T ss_pred             HHHHHHHH--HHCCCEEEEEHHHHHCCCHHHHHHHHH
T ss_conf             89999999--859511232017563771888999999


No 353
>TIGR00955 3a01204 Pigment precourser permease; InterPro: IPR005284   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    This family includes different parts of a membrane-spanning permease system necessary for the transport of pigment precursor into pigment cells responsible for eye color. White protein dimerises with brown protein for the transport of guanine and with scarlet protein for the transport of tryptophan.; GO: 0006810 transport.
Probab=97.50  E-value=6.9e-05  Score=47.23  Aligned_cols=22  Identities=41%  Similarity=0.637  Sum_probs=21.0

Q ss_pred             EEEECCCCCCHHHHHHHHHCCC
Q ss_conf             9997489988989999973897
Q gi|254780484|r   32 IAFSGRSNVGKSSLINILVNRK   53 (212)
Q Consensus        32 VaivG~~NvGKSSLiNaL~g~~   53 (212)
                      +||+|-++||||||+|+|..+.
T Consensus        61 lA~mGsSGAGKTTLmn~La~R~   82 (671)
T TIGR00955        61 LAIMGSSGAGKTTLMNALAFRS   82 (671)
T ss_pred             EEEECCCCCCHHHHHHHHHCCC
T ss_conf             8984787662689999985337


No 354
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain. Guanylate-binding proteins (GBPs) define a group of proteins that are synthesized after activation of the cell by interferons.  The biochemical properties of GBPs are clearly different from those of Ras-like and heterotrimeric GTP-binding proteins.  They bind guanine nucleotides with low affinity (micromolar range), are stable in their absence and have a high turnover GTPase.  In addition to binding GDP/GTP, they have the unique ability to bind GMP with equal affinity and hydrolyze GTP not only to GDP, but also to GMP. Furthermore, two unique regions around the base and the phosphate-binding areas, the guanine and the phosphate caps, respectively, give the nucleotide-binding site a unique appearance not found in the canonical GTP-binding proteins.  The phosphate cap, which constitutes the region analogous to switch I, completely shields the phosphate-binding site from solvent such that a potential GTPase-activating protein
Probab=97.50  E-value=0.00048  Score=42.39  Aligned_cols=65  Identities=18%  Similarity=0.104  Sum_probs=40.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCC-CCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHH
Q ss_conf             8999748998898999997389737987388-8414521202665556785089649999760010111
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNA-PGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYAR   98 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~-p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~   98 (212)
                      -|+|+|.-..|||+|+|.|+|...--.+.+. -.+|...   ..............+.+.||-|.....
T Consensus         9 vvsv~G~~rtGKS~LlN~l~~~~~~F~~~~~~~~~T~Gi---w~~~~p~~~~~~~~~~llDtEG~~~~~   74 (224)
T cd01851           9 VVSVFGPQSSGKSFLLNHLFGTLSGFDVMDTSQQTTKGI---WMWSVPFKLGKEHAVLLLDTEGTDGRE   74 (224)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCEE---EEEECCCCCCCCCEEEEEECCCCCCCC
T ss_conf             999876898988999999948888987478877656506---998356357887338998347777611


No 355
>KOG0072 consensus
Probab=97.50  E-value=0.00031  Score=43.50  Aligned_cols=115  Identities=15%  Similarity=0.191  Sum_probs=61.0

Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCH--HHHHHHHHHC---CCCCCCCCCC
Q ss_conf             8964999976001011122447898888998777766420000011223578875--4545543210---2575322122
Q gi|254780484|r   82 NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQ--IDQDVFSFLD---KKAVSYQIVL  156 (212)
Q Consensus        82 ~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~---~~~~~~~~v~  156 (212)
                      ...++.+.|..|...      ....+..-       -...+.+++++|..+..+.  ...++..++.   ..+...+++.
T Consensus        60 KNLk~~vwdLggqtS------irPyWRcY-------y~dt~avIyVVDssd~dris~a~~el~~mL~E~eLq~a~llv~a  126 (182)
T KOG0072          60 KNLKFQVWDLGGQTS------IRPYWRCY-------YADTDAVIYVVDSSDRDRISIAGVELYSMLQEEELQHAKLLVFA  126 (182)
T ss_pred             CCCCCEEEECCCCCC------CCHHHHHH-------HCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEE
T ss_conf             665512467158643------32778887-------60666289997165434431468999998554865484699986


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHC
Q ss_conf             2211110246899999999997531368986899988888998999999998728
Q gi|254780484|r  157 TKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETIN  211 (212)
Q Consensus       157 nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l~  211 (212)
                      ||.|.-..-...+....+.  +........+++..||.+|.|+|+..+++.+.|.
T Consensus       127 nKqD~~~~~t~~E~~~~L~--l~~Lk~r~~~Iv~tSA~kg~Gld~~~DWL~~~l~  179 (182)
T KOG0072         127 NKQDYSGALTRSEVLKMLG--LQKLKDRIWQIVKTSAVKGEGLDPAMDWLQRPLK  179 (182)
T ss_pred             CCCCCHHHHHHHHHHHHHC--HHHHHHHEEEEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             0455213556999999848--2887502268876011446677678999987776


No 356
>COG0523 Putative GTPases (G3E family) [General function prediction only]
Probab=97.46  E-value=0.0021  Score=38.74  Aligned_cols=163  Identities=17%  Similarity=0.155  Sum_probs=75.2

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCC----CCEEEECCCCCEEEEC-CEEEEEEEEEEE-----------------------
Q ss_conf             868999748998898999997389----7379873888414521-202665556785-----------------------
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNR----KNLARTSNAPGRTQHL-NFFVPKDFSNLK-----------------------   80 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~----~~~a~~~~~p~tt~~~-~~~~~~~~~~~~-----------------------   80 (212)
                      +|-..|-|.=++|||||+|.|..+    |..+.+....-...+- ............                       
T Consensus         1 ipVtvitGFLGsGKTTlL~~lL~~~~g~kiAVIVNEfGEvgID~~~~l~~~~e~~~El~nGCICCT~r~dl~~~~~~L~~   80 (323)
T COG0523           1 IPVTVITGFLGSGKTTLLNHLLANRDGKKIAVIVNEFGEVGIDGGALLSDTGEEVVELTNGCICCTVRDDLLPALERLLR   80 (323)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCEEEECCCCEEEECCCHHHHHHHHHHH
T ss_conf             97799811677998999999985458980799985574022167764134897579836970787034215899999985


Q ss_pred             -ECCCEEEEEECCHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             -08964999976001011122447898888998-7777664200000112235788754545543210257532212222
Q gi|254780484|r   81 -NNLPAMALVDMPGYGYARAPKKNVDSWGGLIV-RYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTK  158 (212)
Q Consensus        81 -~~~~~~~~~DtpG~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK  158 (212)
                       .+.+...++.|-|+......      ...... .........+..+-+.|+....................--++++||
T Consensus        81 ~~~~~D~ivIEtTGlA~P~pv------~~t~~~~~~l~~~~~ld~vvtvVDa~~~~~~~~~~~~~~~~Qia~AD~ivlNK  154 (323)
T COG0523          81 RRDRPDRLVIETTGLADPAPV------IQTFLTDPELADGVRLDGVVTVVDAAHFLEGLDAIAELAEDQLAFADVIVLNK  154 (323)
T ss_pred             CCCCCCEEEEECCCCCCCHHH------HHHHHCCCCCCCCEEECCEEEEEEHHHHHHHHHHHHHHHHHHHHHCCEEEEEC
T ss_conf             256899899968877786999------99860651224540413369998478865456779999999998679999836


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHH
Q ss_conf             111102468999999999975313689868999888889989999
Q gi|254780484|r  159 IDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR  203 (212)
Q Consensus       159 ~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~  203 (212)
                      .