HHsearch alignment for GI: 254780484 and conserved domain: pfam00009

>pfam00009 GTP_EFTU Elongation factor Tu GTP binding domain. This domain contains a P-loop motif, also found in several other families such as pfam00071, pfam00025 and pfam00063. Elongation factor Tu consists of three structural domains, this plus two C-terminal beta barrel domains.
Probab=99.94  E-value=1e-25  Score=166.93  Aligned_cols=169  Identities=16%  Similarity=0.244  Sum_probs=119.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCC-----CEE-----EECCEEEEEEEEEEEECCCEEEEEECCHHHHH
Q ss_conf             68689997489988989999973897379873888-----414-----52120266555678508964999976001011
Q gi|254780484|r   28 GPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAP-----GRT-----QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYA   97 (212)
Q Consensus        28 ~~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p-----~tt-----~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~   97 (212)
T Consensus         2 ~~rnVaivG~~n~GKSTL~n~Ll~~~~~-i~~~~~~~~~~~~d~~~~E~~rgiTi~~~~~~~~~~~~~i~~iDtPGh~~f   80 (185)
T pfam00009         2 RHRNIGIIGHVDHGKTTLTDALLYVTGA-IDKRGEVKQEGELDRLKEERERGITIKIAAVSFETKKRHINIIDTPGHVDF   80 (185)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCC-CCCCCCCCCCCCCCCCHHHHHCCEEEEEEEEEEEECCCEEEEEECCCCCCH
T ss_conf             9678999938994499999999715487-654643100333365588885782698769999608936899989987143


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             12244789888899877776642000001122357887545455432102575322122221111024689999999999
Q gi|254780484|r   98 RAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYL  177 (212)
Q Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~  177 (212)
T Consensus        81 ~~-------------~~~~~l~~aD~~vlVvda~~G~~~qt~~~~~~~~~~~~p~iv~vNKiD~v~~~~~~~~~~e~~~~  147 (185)
T pfam00009        81 TK-------------EMIRGAAQADGAILVVDAVEGVMPQTREHLLLAKQLGVPIIVFINKMDRVDDAELDEVVEEISRE  147 (185)
T ss_pred             HH-------------HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             99-------------99999864656429998676853230999999998289879999773277767699999999999


Q ss_pred             -HHHCCC--CCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             -753136--898689998888899899999999872
Q gi|254780484|r  178 -IRNYPT--AHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       178 -~~~~~~--~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
T Consensus       148 ll~~~~~~~~~~pivpiSA~~G~gv~~Ll~~i~~~l  183 (185)
T pfam00009       148 LLEKYGFGGETIPVIPGSALTGEGIDTLLEALDLYL  183 (185)
T ss_pred             HHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             888732489988699967899979899999999778