HHsearch alignment for GI: 254780484 and conserved domain: pfam02263

>pfam02263 GBP Guanylate-binding protein, N-terminal domain. Transcription of the anti-viral guanylate-binding protein (GBP) is induced by interferon-gamma during macrophage induction. This family contains GBP1 and GPB2, both GTPases capable of binding GTP, GDP and GMP.
Probab=96.67  E-value=0.0067  Score=35.80  Aligned_cols=66  Identities=18%  Similarity=0.121  Sum_probs=40.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGY   96 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~   96 (212)
T Consensus        21 v~vvsv~G~~RtGKSfLlN~l~~~~~gF~~g--~~~~~~T~GIwmw~~p~~~~~~~~v~llDTeG~~d   86 (264)
T pfam02263        21 VVVVAIVGLYRTGKSYLMNFLAGKLTGFSLG--STVESETKGIWMWCVPHPNKPKHTLVLLDTEGLGD   86 (264)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCCCCCCCC--CCCCCCCCEEEEEECCCCCCCCEEEEEEECCCCCC
T ss_conf             5999977788687489999983757798747--77576665058860445788861799981466565