HHsearch alignment for GI: 254780484 and conserved domain: smart00175

>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=99.55  E-value=2.2e-14  Score=101.77  Aligned_cols=157  Identities=16%  Similarity=0.135  Sum_probs=85.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
T Consensus         1 ~Ki~vvG~~~vGKTsli~r~~~~~f~--~~~~~Ti~~~~----~~~~i~~~~~~~~l~iwDt~G~e~~~~l~--------   66 (164)
T smart00175        1 FKIILIGDSGVGKSSLLSRFTDGKFS--EQYKSTIGVDF----KTKTIEVDGKRVKLQIWDTAGQERFRSIT--------   66 (164)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCC--CCCCCCCCEEE----EEEEEEECCEEEEEEEEECCCCHHHHHHH--------
T ss_conf             98999998997799999999419999--98688456666----77999999999999999679944664779--------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--CHHHH--HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9987777664200000112235788--75454--5543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--KQIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~--~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
T Consensus        67 --~~~~---~~~~~~ilvfdi~~~~Sf~~i~~w~~~i~~~~~~~~piilvgnK~Dl~~~r~V~~--~e~~~~a~~~---~  136 (164)
T smart00175       67 --SSYY---RGAVGALLVYDITNRESFENLKNWLKELREYADPNVVIMLVGNKSDLEDQRQVSR--EEAEAFAEEH---G  136 (164)
T ss_pred             --HHHH---CCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCHHHHCCCCH--HHHHHHHHHC---C
T ss_conf             --9883---3665368843689989999999999999986799982551164568565187999--9999999984---9


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
T Consensus       137 ~~~~e~SAk~~~~v~e~F~~l~~~i  161 (164)
T smart00175      137 LPFFETSAKTNTNVEEAFEELAREI  161 (164)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9799983166908899999999999