BLAST/PSIBLAST alignment of GI: 254780484 and GI: 163868926 at iteration 1
>gi|163868926|ref|YP_001610153.1| ribosome biogenesis GTP-binding protein YsxC [Bartonella tribocorum CIP 105476] Length = 214
>gi|189037171|sp|A9IXE1|ENGB_BART1 RecName: Full=Probable GTP-binding protein EngB Length = 214
>gi|161018600|emb|CAK02158.1| GTP-binding protein [Bartonella tribocorum CIP 105476] Length = 214
 Score =  248 bits (632), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 151/205 (73%), Gaps = 1/205 (0%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +F+++ WIF+RGVP I  LP  GPPEIAF+GRSNVGKSSLIN LV +K LARTSN PGRT
Sbjct: 10  VFSRN-WIFIRGVPAIRFLPPEGPPEIAFAGRSNVGKSSLINALVQQKGLARTSNTPGRT 68

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+F+P  FS  + +LP  A+VDMPGYG+A APK  VD+W  LI  YL  RSTL+ VY
Sbjct: 69  QELNYFIPDGFSGQRGDLPPFAVVDMPGYGFAAAPKNLVDAWTNLIFSYLRGRSTLKRVY 128

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           LLID RHG+K  D+DV + LDK AVSYQIVLTK DK+     ++ +  T+  +  +P A+
Sbjct: 129 LLIDSRHGIKNNDEDVLALLDKAAVSYQIVLTKSDKIKSNALEKLIMITQTKLLKHPAAY 188

Query: 186 PEVIPTSSVKRKGIEVLRKAILETI 210
           PE++ TSS K  G+E LR AIL+TI
Sbjct: 189 PEILATSSEKAYGLEELRAAILQTI 213