BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780484|ref|YP_003064897.1| GTPase EngB [Candidatus
Liberibacter asiaticus str. psy62]
         (212 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780484|ref|YP_003064897.1| GTPase EngB [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040161|gb|ACT56957.1| GTPase EngB [Candidatus Liberibacter asiaticus str. psy62]
          Length = 212

 Score =  437 bits (1124), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 212/212 (100%), Positives = 212/212 (100%)

Query: 1   MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSN 60
           MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSN
Sbjct: 1   MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSN 60

Query: 61  APGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST 120
           APGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST
Sbjct: 61  APGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST 120

Query: 121 LRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
           LRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN
Sbjct: 121 LRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180

Query: 181 YPTAHPEVIPTSSVKRKGIEVLRKAILETINY 212
           YPTAHPEVIPTSSVKRKGIEVLRKAILETINY
Sbjct: 181 YPTAHPEVIPTSSVKRKGIEVLRKAILETINY 212


>gi|315122060|ref|YP_004062549.1| GTPase EngB [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495462|gb|ADR52061.1| GTPase EngB [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 192

 Score =  308 bits (788), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 166/190 (87%)

Query: 23  LLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNN 82
           LLP+ GPPEIAFSGRSNVGKSSLIN+L+NRKNLARTSN+PGRTQ +NFF+P D S  K+N
Sbjct: 3   LLPEEGPPEIAFSGRSNVGKSSLINMLLNRKNLARTSNSPGRTQEINFFIPSDCSGRKDN 62

Query: 83  LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVF 142
           LP M LVDMPGYGYA+APKKNV +WG L+VRYL ERSTLRCVYLLIDCRHG+K+IDQDVF
Sbjct: 63  LPTMTLVDMPGYGYAKAPKKNVAAWGNLVVRYLRERSTLRCVYLLIDCRHGIKKIDQDVF 122

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           + LDK+AVSYQ++LTK DKLSP  AQE LE TK L++N+P AH +VI TSS+K  GIE+L
Sbjct: 123 ALLDKEAVSYQVILTKADKLSPAMAQEKLENTKSLLQNHPAAHSDVILTSSIKGNGIEML 182

Query: 203 RKAILETINY 212
           RK+ILETI Y
Sbjct: 183 RKSILETIIY 192


>gi|163868926|ref|YP_001610153.1| ribosome biogenesis GTP-binding protein YsxC [Bartonella tribocorum
           CIP 105476]
 gi|189037171|sp|A9IXE1|ENGB_BART1 RecName: Full=Probable GTP-binding protein EngB
 gi|161018600|emb|CAK02158.1| GTP-binding protein [Bartonella tribocorum CIP 105476]
          Length = 214

 Score =  248 bits (632), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 151/205 (73%), Gaps = 1/205 (0%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +F+++ WIF+RGVP I  LP  GPPEIAF+GRSNVGKSSLIN LV +K LARTSN PGRT
Sbjct: 10  VFSRN-WIFIRGVPAIRFLPPEGPPEIAFAGRSNVGKSSLINALVQQKGLARTSNTPGRT 68

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+F+P  FS  + +LP  A+VDMPGYG+A APK  VD+W  LI  YL  RSTL+ VY
Sbjct: 69  QELNYFIPDGFSGQRGDLPPFAVVDMPGYGFAAAPKNLVDAWTNLIFSYLRGRSTLKRVY 128

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           LLID RHG+K  D+DV + LDK AVSYQIVLTK DK+     ++ +  T+  +  +P A+
Sbjct: 129 LLIDSRHGIKNNDEDVLALLDKAAVSYQIVLTKSDKIKSNALEKLIMITQTKLLKHPAAY 188

Query: 186 PEVIPTSSVKRKGIEVLRKAILETI 210
           PE++ TSS K  G+E LR AIL+TI
Sbjct: 189 PEILATSSEKAYGLEELRAAILQTI 213


>gi|222147368|ref|YP_002548325.1| ribosome biogenesis GTP-binding protein YsxC [Agrobacterium vitis
           S4]
 gi|254783181|sp|B9JZK9|ENGB_AGRVS RecName: Full=Probable GTP-binding protein EngB
 gi|221734358|gb|ACM35321.1| GTP-binding protein [Agrobacterium vitis S4]
          Length = 219

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 151/205 (73%), Gaps = 8/205 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LV +K LARTSN PGRTQ LN+F
Sbjct: 17  WIFIRGVPSMKFLPPEGPLEIAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYF 76

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP+ +S   ++LP MALVDMPGYGYA+APK +VD+W  L+  YL  R+TL+ VYLLID R
Sbjct: 77  VPEGYSGEGDDLPPMALVDMPGYGYAKAPKDHVDAWTKLVFDYLRGRATLKRVYLLIDSR 136

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS----PTTAQETLEKTKYLIRNYPTAHPE 187
           HG+K  D+DV + LDK A+SYQIVLTK DK+     P   +ETLEK    IR  P A+P 
Sbjct: 137 HGIKANDEDVLTLLDKAAMSYQIVLTKTDKIKEAGVPRLIEETLEK----IRKRPAAYPF 192

Query: 188 VIPTSSVKRKGIEVLRKAILETINY 212
           V+ TSS K KG++ LR AI ET+ +
Sbjct: 193 VLSTSSEKDKGLKELRAAICETVGH 217


>gi|240850502|ref|YP_002971901.1| GTP-ase EngB [Bartonella grahamii as4aup]
 gi|240267625|gb|ACS51213.1| GTP-ase EngB [Bartonella grahamii as4aup]
          Length = 214

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 151/205 (73%), Gaps = 1/205 (0%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           IF+++ WIF+RGVP I  LP  GPPEIAF+GRSNVGKSSLIN LV +K+LARTSN PGRT
Sbjct: 10  IFSRN-WIFIRGVPAIRFLPPEGPPEIAFAGRSNVGKSSLINALVQQKSLARTSNTPGRT 68

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+FVP  FS    +LP +ALVDMPGYG+A APK  VD+W  LI  YL  R+TL+ VY
Sbjct: 69  QELNYFVPDGFSGQLGDLPPLALVDMPGYGFAAAPKNLVDAWTNLIFSYLRGRTTLKRVY 128

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K  D+DV S LDK AVSYQIVLTK DK+     ++ +  T+  +   P A+
Sbjct: 129 ILIDSRHGIKNNDEDVLSLLDKAAVSYQIVLTKSDKIKSNALEKLIMSTQTKLLKRPAAY 188

Query: 186 PEVIPTSSVKRKGIEVLRKAILETI 210
           PE++ TSS K  G+E LR AIL+TI
Sbjct: 189 PELLVTSSEKALGLEELRAAILQTI 213


>gi|150395306|ref|YP_001325773.1| ribosome biogenesis GTP-binding protein YsxC [Sinorhizobium medicae
           WSM419]
 gi|166225985|sp|A6U5K8|ENGB_SINMW RecName: Full=Probable GTP-binding protein EngB
 gi|150026821|gb|ABR58938.1| GTP-binding protein HSR1-related [Sinorhizobium medicae WSM419]
          Length = 217

 Score =  245 bits (626), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 145/199 (72%), Gaps = 8/199 (4%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LV  K LARTSN PGRTQ LN+F
Sbjct: 17  WIFIRGVPSMKFLPPEGPTEIAFAGRSNVGKSSLINALVGHKGLARTSNTPGRTQELNYF 76

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  +S   ++LP MALVDMPGYGYA+APK+ VD+W  L+  YL  RSTL+ VY+LID R
Sbjct: 77  VPDGYSGEADDLPPMALVDMPGYGYAQAPKEQVDAWTKLVFDYLRGRSTLKRVYVLIDAR 136

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS----PTTAQETLEKTKYLIRNYPTAHPE 187
           HG+K+ D++V + LDK AVSYQIVLTK DK+     P    ETLEK    IR  P A PE
Sbjct: 137 HGIKKNDEEVLALLDKAAVSYQIVLTKTDKIKAAGVPRLLAETLEK----IRKRPAAFPE 192

Query: 188 VIPTSSVKRKGIEVLRKAI 206
           V+ TSS K +GIE LR AI
Sbjct: 193 VLSTSSEKGEGIEELRAAI 211


>gi|13474032|ref|NP_105600.1| ribosome biogenesis GTP-binding protein YsxC [Mesorhizobium loti
           MAFF303099]
 gi|24418390|sp|Q98D85|ENGB_RHILO RecName: Full=Probable GTP-binding protein EngB
 gi|14024784|dbj|BAB51386.1| GTP-binding protein [Mesorhizobium loti MAFF303099]
          Length = 212

 Score =  245 bits (625), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 148/211 (70%), Gaps = 1/211 (0%)

Query: 1   MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSN 60
           M++  +FT+  WIF+RGVP +  LP  GPPEIAF+GRSNVGKSSLIN LVN+K LARTSN
Sbjct: 1   MITTDLFTR-GWIFIRGVPAMKFLPPEGPPEIAFAGRSNVGKSSLINALVNQKGLARTSN 59

Query: 61  APGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST 120
            PGRTQ LN+FVP  FS    +LP MALVDMPGYGYA APK+ VD W  L+  YL  R T
Sbjct: 60  TPGRTQELNYFVPDGFSGEGADLPPMALVDMPGYGYATAPKEKVDEWTKLVFDYLKGRVT 119

Query: 121 LRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
           L+ VY+LID RHG+K  D +V S LDK AVSYQIVLTK DK+        +E+T   I+ 
Sbjct: 120 LKRVYVLIDARHGIKAKDDEVLSLLDKAAVSYQIVLTKTDKIKVAGVPRLIEETLQKIKK 179

Query: 181 YPTAHPEVIPTSSVKRKGIEVLRKAILETIN 211
            P A P V+ TSS K +G+E L+ AI+   N
Sbjct: 180 RPAAFPFVLATSSEKGEGLEELQAAIVLAAN 210


>gi|110632739|ref|YP_672947.1| GTPase EngB [Mesorhizobium sp. BNC1]
 gi|119369212|sp|Q11LE3|ENGB_MESSB RecName: Full=Probable GTP-binding protein EngB
 gi|110283723|gb|ABG61782.1| GTP-binding protein [Chelativorans sp. BNC1]
          Length = 225

 Score =  245 bits (625), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 143/200 (71%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GPPE+AF+GRSNVGKSSLIN LV RK LARTSN PGRTQ LN+F
Sbjct: 24  WIFIRGVPAMKFLPPEGPPEVAFAGRSNVGKSSLINGLVGRKGLARTSNTPGRTQELNYF 83

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP+ +S    +LP MALVDMPGYG+A+APK  VD+W  L+  YL  R TL+ VYLLID R
Sbjct: 84  VPEGYSGEAGDLPPMALVDMPGYGFAKAPKAQVDAWTKLVFDYLRGRVTLKRVYLLIDAR 143

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ID++V   LD  AVSYQIVLTK DK+      + + +T   I   P A PEVI T
Sbjct: 144 HGIKKIDEEVMDLLDSAAVSYQIVLTKADKIKSPAVTKLVAETGQKIVKRPAAFPEVIAT 203

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS K +G+E LR AI+  + 
Sbjct: 204 SSEKGEGLEELRAAIVHAVT 223


>gi|15964196|ref|NP_384549.1| GTPase EngB [Sinorhizobium meliloti 1021]
 gi|307301340|ref|ZP_07581102.1| ribosome biogenesis GTP-binding protein YsxC [Sinorhizobium
           meliloti BL225C]
 gi|307318010|ref|ZP_07597447.1| ribosome biogenesis GTP-binding protein YsxC [Sinorhizobium
           meliloti AK83]
 gi|24418387|sp|Q92SF6|ENGB_RHIME RecName: Full=Probable GTP-binding protein EngB
 gi|15073372|emb|CAC41880.1| Hypothetical GTP-binding protein [Sinorhizobium meliloti 1021]
 gi|306896412|gb|EFN27161.1| ribosome biogenesis GTP-binding protein YsxC [Sinorhizobium
           meliloti AK83]
 gi|306903796|gb|EFN34383.1| ribosome biogenesis GTP-binding protein YsxC [Sinorhizobium
           meliloti BL225C]
          Length = 217

 Score =  245 bits (625), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 144/199 (72%), Gaps = 8/199 (4%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LV  K LARTSN PGRTQ LN+F
Sbjct: 17  WIFIRGVPSMKFLPPEGPTEIAFAGRSNVGKSSLINALVGHKGLARTSNTPGRTQELNYF 76

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  +S    +LP MALVDMPGYGYA+APK+ VD+W  L+  YL  RSTL+ VY+LID R
Sbjct: 77  VPDGYSGEAGDLPPMALVDMPGYGYAQAPKEQVDAWTKLVFDYLRGRSTLKRVYVLIDAR 136

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS----PTTAQETLEKTKYLIRNYPTAHPE 187
           HG+K+ D+DV + LDK AVSYQIVLTK DK+     P    ETLEK    I+  P A PE
Sbjct: 137 HGIKKNDEDVLALLDKAAVSYQIVLTKTDKIKAAGVPRLVAETLEK----IKKRPAAFPE 192

Query: 188 VIPTSSVKRKGIEVLRKAI 206
           V+ TSS K +GIE LR AI
Sbjct: 193 VLSTSSEKGEGIEDLRAAI 211


>gi|15887733|ref|NP_353414.1| GTPase EngB [Agrobacterium tumefaciens str. C58]
 gi|24418376|sp|Q8UIB4|ENGB_AGRT5 RecName: Full=Probable GTP-binding protein EngB
 gi|15155296|gb|AAK86199.1| GTP-binding protein [Agrobacterium tumefaciens str. C58]
          Length = 217

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 148/203 (72%), Gaps = 8/203 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GPPEIAF+GRSNVGKSSLIN LV  K LARTSN PGRTQ LN+F
Sbjct: 17  WIFIRGVPAMKFLPPEGPPEIAFAGRSNVGKSSLINALVGHKGLARTSNTPGRTQELNYF 76

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP+ +S    +LP MALVDMPGYGYA+APK +VD+W  L+  YL  R+TL+ VY+LID R
Sbjct: 77  VPEGYSGEPGDLPPMALVDMPGYGYAQAPKDHVDAWTKLVFDYLRGRATLKRVYVLIDSR 136

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS----PTTAQETLEKTKYLIRNYPTAHPE 187
           HG+K+ D++V S LDK AVSYQ+VLTK DK+     P    ETLEK    IR  P A+PE
Sbjct: 137 HGIKKNDEEVLSLLDKAAVSYQVVLTKTDKIKDVGVPRLIGETLEK----IRKRPAAYPE 192

Query: 188 VIPTSSVKRKGIEVLRKAILETI 210
           V+ TSS K  G++ LR  I+ T+
Sbjct: 193 VLATSSEKSFGLDDLRAEIVRTV 215


>gi|325291816|ref|YP_004277680.1| ribosome biogenesis GTP-binding protein YsxC [Agrobacterium sp.
           H13-3]
 gi|325059669|gb|ADY63360.1| ribosome biogenesis GTP-binding protein YsxC [Agrobacterium sp.
           H13-3]
          Length = 217

 Score =  243 bits (620), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 148/204 (72%), Gaps = 8/204 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GPPEIAF+GRSNVGKSSLIN LV  K LARTSN PGRTQ LN+F
Sbjct: 17  WIFIRGVPAMKFLPPEGPPEIAFAGRSNVGKSSLINALVGHKGLARTSNTPGRTQELNYF 76

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP+ +S    +LP MALVDMPGYGYA+APK +VD+W  L+  YL  R+TL+ VY+LID R
Sbjct: 77  VPEGYSGEPGDLPPMALVDMPGYGYAQAPKDHVDAWTKLVFDYLRGRATLKRVYVLIDSR 136

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS----PTTAQETLEKTKYLIRNYPTAHPE 187
           HG+K+ D++V   LDK AVSYQ+VLTK DK+     P    ETLEK    IR  P A+PE
Sbjct: 137 HGIKKNDEEVLGLLDKAAVSYQVVLTKTDKIKDVGVPRLISETLEK----IRKRPAAYPE 192

Query: 188 VIPTSSVKRKGIEVLRKAILETIN 211
           V+ TSS K  G++ LR  I+ T++
Sbjct: 193 VLATSSEKSFGLDSLRAEIVRTVS 216


>gi|49475955|ref|YP_033996.1| GTPase EngB [Bartonella henselae str. Houston-1]
 gi|81647688|sp|Q6G2G5|ENGB_BARHE RecName: Full=Probable GTP-binding protein EngB
 gi|49238763|emb|CAF28024.1| GTP-binding protein cgpa [Bartonella henselae str. Houston-1]
          Length = 215

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 147/199 (73%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W+F+RGVP I  LP  GPPEIAF+GRSNVGKSSLIN LV +K+LARTSN PGRTQ LN+F
Sbjct: 15  WVFIRGVPTIRFLPPEGPPEIAFAGRSNVGKSSLINALVRQKSLARTSNMPGRTQELNYF 74

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  FS    +LP +ALVDMPGYG+A+APK  VD+W  LI  YL  R+TL+ VY+LID R
Sbjct: 75  VPDGFSGRPEDLPPIALVDMPGYGFAKAPKNLVDAWTDLIYSYLRGRTTLKRVYVLIDSR 134

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D ++   LDK AVSYQIVLTK DK+  +  ++ +  TK  +   P A+PE++ T
Sbjct: 135 HGIKKNDAEILELLDKAAVSYQIVLTKSDKIKSSVLEQRIITTKTKLLKRPAAYPEILAT 194

Query: 192 SSVKRKGIEVLRKAILETI 210
           SS K  G+E LR AIL+TI
Sbjct: 195 SSEKAFGLEELRAAILQTI 213


>gi|319780375|ref|YP_004139851.1| ribosome biogenesis GTP-binding protein YsxC [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317166263|gb|ADV09801.1| ribosome biogenesis GTP-binding protein YsxC [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 219

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 147/211 (69%), Gaps = 1/211 (0%)

Query: 1   MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSN 60
           ++   +FT+  WIF+RGVP +  LP  GPPEIAF+GRSNVGKSSLIN LVN+K LARTSN
Sbjct: 8   IIGTELFTR-GWIFIRGVPAMKFLPPEGPPEIAFAGRSNVGKSSLINALVNQKGLARTSN 66

Query: 61  APGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST 120
            PGRTQ LN+FVP  FS    +LP +ALVDMPGYGYA APK+ VD W  L+  YL  R T
Sbjct: 67  TPGRTQELNYFVPDGFSGEGADLPPLALVDMPGYGYATAPKEKVDEWTKLVFDYLKGRVT 126

Query: 121 LRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
           L+ VY+LID RHG+K  D +V S LDK AVSYQIVLTK DK+        +E+T   I+ 
Sbjct: 127 LKRVYVLIDARHGIKAKDDEVLSLLDKAAVSYQIVLTKTDKIKTAGVPRLIEETLAKIKK 186

Query: 181 YPTAHPEVIPTSSVKRKGIEVLRKAILETIN 211
            P A P V+ TSS K +G+E L+ AI+   N
Sbjct: 187 RPAAFPFVLATSSEKAEGLEELQAAIVLAAN 217


>gi|260461154|ref|ZP_05809403.1| GTP-binding protein HSR1-related protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259033188|gb|EEW34450.1| GTP-binding protein HSR1-related protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 219

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 146/210 (69%), Gaps = 1/210 (0%)

Query: 2   VSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNA 61
           +   +FT+  WIF+RGVP +  LP  GPPEIAF+GRSNVGKSSLIN LVN+K LARTSN 
Sbjct: 9   IGTDLFTR-GWIFIRGVPAMKFLPPEGPPEIAFAGRSNVGKSSLINALVNQKGLARTSNT 67

Query: 62  PGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTL 121
           PGRTQ LN+FVP  FS    +LP MALVDMPGYGYA APK+ VD W  L+  YL  R TL
Sbjct: 68  PGRTQELNYFVPDGFSGEGADLPPMALVDMPGYGYATAPKEKVDEWTKLVFDYLKGRVTL 127

Query: 122 RCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY 181
           + VY+LID RHG+K  D +V S LDK AVSYQIVLTK DK+        +E+T   I+  
Sbjct: 128 KRVYVLIDARHGIKAKDDEVLSLLDKAAVSYQIVLTKTDKIKVAGVPRLIEETLAKIKKR 187

Query: 182 PTAHPEVIPTSSVKRKGIEVLRKAILETIN 211
           P A P V+ TSS K +G+E L+ AI+   N
Sbjct: 188 PAAFPFVLATSSEKGEGLEELQAAIVLAAN 217


>gi|218515056|ref|ZP_03511896.1| GTPase EngB [Rhizobium etli 8C-3]
          Length = 217

 Score =  242 bits (617), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 115/200 (57%), Positives = 146/200 (73%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP E+AF+GRSNVGKSSLIN LV +K LARTSN PGRTQ LN+F
Sbjct: 13  WIFIRGVPSLTFLPPEGPSEVAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYF 72

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  +S    +LP MA+VDMPGYGYA+APK+ VD W  L+  YL  R+TL+ VY+LID R
Sbjct: 73  VPDGYSGEGGDLPPMAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSR 132

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D+DV + LDK AVSYQ+VLTK DK++     + L +T   IR  P A+P V+ T
Sbjct: 133 HGIKKNDEDVLTLLDKAAVSYQLVLTKTDKITAPAVPKLLAETADKIRKRPAAYPAVLST 192

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS K  G++ LR+AI +T+ 
Sbjct: 193 SSEKGDGLDDLRQAIAQTVG 212


>gi|163757862|ref|ZP_02164951.1| GTPase EngB [Hoeflea phototrophica DFL-43]
 gi|162285364|gb|EDQ35646.1| GTPase EngB [Hoeflea phototrophica DFL-43]
          Length = 225

 Score =  242 bits (617), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 148/205 (72%), Gaps = 1/205 (0%)

Query: 2   VSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNA 61
           +S T+F K  W+F+RGVP +  LP  GPPEIAF+GRSNVGKSSLIN LV  K LARTSN 
Sbjct: 16  LSATLFAKP-WVFIRGVPSLKFLPPEGPPEIAFAGRSNVGKSSLINALVGAKGLARTSNT 74

Query: 62  PGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTL 121
           PGRTQ LN+FVP  +S  +++LP MALVDMPGYGYA+APK+ VD W  L+  Y+  RSTL
Sbjct: 75  PGRTQELNYFVPGGYSGAEDDLPPMALVDMPGYGYAKAPKEQVDLWTKLVFDYMRGRSTL 134

Query: 122 RCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY 181
           + VYLLID RHG+K+ D++V   LDK A+SYQ+VLTK DK+        + +T   ++  
Sbjct: 135 KRVYLLIDSRHGIKKNDEEVMDLLDKAAMSYQVVLTKTDKIKEAGVPRLIGETLNKLKRR 194

Query: 182 PTAHPEVIPTSSVKRKGIEVLRKAI 206
           P A+PEV+ TSS K  G++ LR AI
Sbjct: 195 PAAYPEVLATSSEKANGVDDLRIAI 219


>gi|121602307|ref|YP_989324.1| GTPase EngB [Bartonella bacilliformis KC583]
 gi|166225944|sp|A1UTM1|ENGB_BARBK RecName: Full=Probable GTP-binding protein EngB
 gi|120614484|gb|ABM45085.1| GTP-binding protein [Bartonella bacilliformis KC583]
          Length = 215

 Score =  241 bits (616), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 144/199 (72%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP I  LP  GPPEIAF+GRSNVGKSSLIN LV +K LARTSN PGRTQ LN+F
Sbjct: 15  WIFIRGVPTIQFLPPEGPPEIAFAGRSNVGKSSLINALVQQKGLARTSNTPGRTQELNYF 74

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  FS  K + P MALVDMPGYG+A+APK  VD+W  L+  YL  R+TL+ VY+LID R
Sbjct: 75  VPDGFSGSKEDFPPMALVDMPGYGFAQAPKNLVDAWTHLVFNYLRGRTTLKRVYILIDSR 134

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D++V   LDK AVSYQI+LTK DK+     +  +  T+  +   P A+PE++ T
Sbjct: 135 HGIKKNDEEVLDLLDKAAVSYQIILTKSDKIKSNMLENLMTTTQMSLLKRPAAYPELLTT 194

Query: 192 SSVKRKGIEVLRKAILETI 210
           S+ K  G+E LR AIL+ +
Sbjct: 195 SAEKALGLEELRTAILQAV 213


>gi|49474532|ref|YP_032574.1| GTPase EngB [Bartonella quintana str. Toulouse]
 gi|81646890|sp|Q6FZ15|ENGB_BARQU RecName: Full=Probable GTP-binding protein EngB
 gi|49240036|emb|CAF26455.1| GTP-binding protein cgpA [Bartonella quintana str. Toulouse]
          Length = 215

 Score =  241 bits (615), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 122/205 (59%), Positives = 147/205 (71%), Gaps = 1/205 (0%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           IF++  WIF+RG+P I  LP  GPPEIAF+GRSNVGKSSLIN LV +K+LARTSN PGRT
Sbjct: 10  IFSRK-WIFIRGIPTIHFLPPEGPPEIAFAGRSNVGKSSLINALVQQKSLARTSNTPGRT 68

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+FVP  FS    NLP +ALVDMPGYG+A APK  VD+W  LI  YL  R+TL+ VY
Sbjct: 69  QELNYFVPDGFSGEPGNLPPIALVDMPGYGFAEAPKNLVDAWTHLIFSYLRGRTTLKRVY 128

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K+ D DV   LDK AVSYQIVLTK DK       + +  TK  +  +P A+
Sbjct: 129 VLIDSRHGIKKNDGDVLDLLDKAAVSYQIVLTKSDKTKSNELAKLIMITKTKLLKHPAAY 188

Query: 186 PEVIPTSSVKRKGIEVLRKAILETI 210
           PE++ TSS K  G+E LR AIL+ I
Sbjct: 189 PELLVTSSEKALGLEELRAAILQAI 213


>gi|190890107|ref|YP_001976649.1| GTP-binding protein [Rhizobium etli CIAT 652]
 gi|238692551|sp|B3Q039|ENGB_RHIE6 RecName: Full=Probable GTP-binding protein EngB
 gi|190695386|gb|ACE89471.1| GTP-binding protein [Rhizobium etli CIAT 652]
          Length = 217

 Score =  241 bits (615), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 115/200 (57%), Positives = 145/200 (72%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP E+AF+GRSNVGKSSLIN LV +K LARTSN PGRTQ LN+F
Sbjct: 13  WIFIRGVPSLTFLPPEGPSEVAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYF 72

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  +S    +LP MA+VDMPGYGYA+APK+ VD W  L+  YL  R+TL+ VY+LID R
Sbjct: 73  VPDGYSGEGGDLPPMAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSR 132

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D+DV + LDK AVSYQ+VLTK DK+      + L +T   IR  P A+P V+ T
Sbjct: 133 HGIKKNDEDVLTLLDKAAVSYQLVLTKTDKIKAPAVPKLLAETADKIRKRPAAYPAVLST 192

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS K  G++ LR+AI +T+ 
Sbjct: 193 SSEKGDGLDDLRQAIAQTVG 212


>gi|218461047|ref|ZP_03501138.1| GTPase EngB [Rhizobium etli Kim 5]
          Length = 217

 Score =  241 bits (615), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 145/200 (72%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP E+AF+GRSNVGKSSLIN LV +K LARTSN PGRTQ LN+F
Sbjct: 13  WIFIRGVPSLTFLPPEGPSEVAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYF 72

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  +S    +LP MA+VDMPGYGYA+APK+ VD W  L+  YL  R+TL+ VY+LID R
Sbjct: 73  VPDGYSGEGGDLPPMAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSR 132

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D+DV + LDK AVSYQ+VLTK DK+      + L +T   IR  P A+P V+ T
Sbjct: 133 HGIKKNDEDVLTLLDKAAVSYQLVLTKTDKIKAPAVPKLLAETADKIRKRPAAYPFVLST 192

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS K  G++ LR+AI ET+ 
Sbjct: 193 SSEKGDGLDDLRQAIAETVG 212


>gi|327192536|gb|EGE59488.1| GTP-binding protein [Rhizobium etli CNPAF512]
          Length = 217

 Score =  241 bits (614), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 115/200 (57%), Positives = 145/200 (72%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP E+AF+GRSNVGKSSLIN LV +K LARTSN PGRTQ LN+F
Sbjct: 13  WIFIRGVPSLTFLPPEGPSEVAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYF 72

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  +S    +LP MA+VDMPGYGYA+APK+ VD W  L+  YL  R+TL+ VY+LID R
Sbjct: 73  VPDGYSGEGGDLPPMAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSR 132

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D+DV + LDK AVSYQ+VLTK DK+      + L +T   IR  P A+P V+ T
Sbjct: 133 HGIKKNDEDVLTLLDKAAVSYQLVLTKTDKIKAPAVPKLLAETADKIRKRPAAYPAVLST 192

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS K  G++ LR+AI +T+ 
Sbjct: 193 SSEKGDGLDDLRQAIAQTVG 212


>gi|227820667|ref|YP_002824637.1| ribosome biogenesis GTP-binding protein YsxC [Sinorhizobium fredii
           NGR234]
 gi|254783206|sp|C3MF47|ENGB_RHISN RecName: Full=Probable GTP-binding protein EngB
 gi|227339666|gb|ACP23884.1| predicted GTP-binding protein EngB-related [Sinorhizobium fredii
           NGR234]
          Length = 217

 Score =  240 bits (613), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 121/203 (59%), Positives = 146/203 (71%), Gaps = 8/203 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LV  K LARTSN PGRTQ LN+F
Sbjct: 17  WIFIRGVPSMKFLPPEGPAEIAFAGRSNVGKSSLINALVGHKGLARTSNTPGRTQELNYF 76

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  +S   ++LP MALVDMPGYGYA+APK+ VD+W  L+  YL  RSTL+ VY+LID R
Sbjct: 77  VPDGYSGEADDLPPMALVDMPGYGYAQAPKEQVDAWTKLVFDYLRGRSTLKRVYVLIDAR 136

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS----PTTAQETLEKTKYLIRNYPTAHPE 187
           HG+K+ D++V + LDK AVSYQIVLTK DK+     P    ETL+K    I+  P A+PE
Sbjct: 137 HGIKKNDEEVLALLDKAAVSYQIVLTKTDKIKAAGVPRLIAETLDK----IKKRPAAYPE 192

Query: 188 VIPTSSVKRKGIEVLRKAILETI 210
           V+ TSS K  GIE LR  I + +
Sbjct: 193 VLSTSSEKGAGIEDLRITIEQAV 215


>gi|319406773|emb|CBI80406.1| GTP-binding protein [Bartonella sp. 1-1C]
          Length = 213

 Score =  240 bits (612), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 146/199 (73%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GPPEIAF+GRSNVGKSSLIN LV +KNLARTSN PGRTQ LN+F
Sbjct: 14  WIFIRGVPTMKFLPPEGPPEIAFAGRSNVGKSSLINALVQQKNLARTSNTPGRTQELNYF 73

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           +P  F+   +NLP +A VDMPGYG+A+APK  V++W  LI  YL  R+TL+ VY+LID R
Sbjct: 74  IPDGFNEQTHNLPPVAFVDMPGYGFAKAPKNLVNAWTHLIFDYLRGRTTLKRVYVLIDSR 133

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D D  + LDK AVSYQIVLTK DK+   T +  +  TK  +  +P A+PE++ T
Sbjct: 134 HGIKKNDTDTLNLLDKAAVSYQIVLTKSDKIKFNTLEALITMTKTKLLKHPAAYPEILVT 193

Query: 192 SSVKRKGIEVLRKAILETI 210
           S+ K  G+E LR AI++ I
Sbjct: 194 SAEKASGLEELRAAIIQAI 212


>gi|114706825|ref|ZP_01439725.1| GTP-binding protein [Fulvimarina pelagi HTCC2506]
 gi|114537773|gb|EAU40897.1| GTP-binding protein [Fulvimarina pelagi HTCC2506]
          Length = 217

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/195 (56%), Positives = 142/195 (72%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W+F+RGVP +  LP  GPPE+AF+GRSNVGKSSLIN L+ +K LARTSN PGRTQ LNFF
Sbjct: 18  WVFVRGVPAMKFLPPEGPPEVAFAGRSNVGKSSLINALLGQKGLARTSNTPGRTQELNFF 77

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  F      LP +A+VDMPGYGYA+APK+ VD+W  L+  YL  R TL+ V++LID R
Sbjct: 78  VPDGFGGETTELPPIAIVDMPGYGYAQAPKEKVDAWTELVFDYLRGRPTLKRVFVLIDAR 137

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K  D++V   LDK A+SYQIVLTKIDK+ PT   + +  T+  IR  P A+P ++ T
Sbjct: 138 HGIKANDEEVLKLLDKAAMSYQIVLTKIDKIKPTGVPKLIAATEEAIRKRPAAYPGILAT 197

Query: 192 SSVKRKGIEVLRKAI 206
           SS KR G++ L+ A+
Sbjct: 198 SSEKRSGLDELQAAL 212


>gi|222084725|ref|YP_002543254.1| GTP-binding protein [Agrobacterium radiobacter K84]
 gi|254783180|sp|B9J8E2|ENGB_AGRRK RecName: Full=Probable GTP-binding protein EngB
 gi|221722173|gb|ACM25329.1| GTP-binding protein [Agrobacterium radiobacter K84]
          Length = 219

 Score =  238 bits (606), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 142/200 (71%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP E+AF+GRSNVGKSSLIN LV  K LARTSN PGRTQ LN+F
Sbjct: 17  WIFIRGVPAMKFLPPEGPLEVAFAGRSNVGKSSLINALVGHKGLARTSNTPGRTQELNYF 76

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  FS    +LP MALVDMPGYGYA APK+ VD+W  L+  YL  R+TL+ VY+LID R
Sbjct: 77  VPDGFSGEGGDLPPMALVDMPGYGYAEAPKEQVDAWTKLVFDYLRGRTTLKRVYVLIDSR 136

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D++V + LDK AVSYQIVLTK DK+      + L  T   IR  P A+P ++ T
Sbjct: 137 HGIKKNDEEVLALLDKAAVSYQIVLTKTDKIKEAGLPKLLADTAEKIRKRPAAYPGILST 196

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS K  G+E +R+AI  T+ 
Sbjct: 197 SSEKGDGLEEVRQAIRLTVG 216


>gi|153008691|ref|YP_001369906.1| ribosome biogenesis GTP-binding protein YsxC [Ochrobactrum anthropi
           ATCC 49188]
 gi|151560579|gb|ABS14077.1| GTP-binding protein HSR1-related [Ochrobactrum anthropi ATCC 49188]
          Length = 241

 Score =  237 bits (605), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 116/201 (57%), Positives = 141/201 (70%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +  K +WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LVN+K LARTSN PGRT
Sbjct: 34  LLFKKSWIFIRGVPSMKFLPPEGPVEIAFAGRSNVGKSSLINALVNKKGLARTSNTPGRT 93

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+FVP  +S    +LP +ALVDMPGYG+A APK  VD+W  L+  YL  R+TL+ VY
Sbjct: 94  QELNYFVPDGYSGENGDLPPLALVDMPGYGFAEAPKAQVDAWTRLVFDYLRGRTTLKRVY 153

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K+ D +V   LDK AVSYQIVLTKIDK+ P      LE+T  L        
Sbjct: 154 VLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDKIKPAGVPRLLEETHKLTYKRAACF 213

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
           P +I TSS K +G++ LR AI
Sbjct: 214 PGIIATSSEKGEGLDELRAAI 234


>gi|239832646|ref|ZP_04680975.1| GTP-binding conserved hypothetical protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239824913|gb|EEQ96481.1| GTP-binding conserved hypothetical protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 268

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 141/205 (68%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +  K +WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LVN+K LARTSN PGRT
Sbjct: 60  LLFKKSWIFIRGVPSMKFLPPEGPVEIAFAGRSNVGKSSLINALVNKKGLARTSNTPGRT 119

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+FVP  +S    +LP +ALVDMPGYG+A APK  VD+W  L+  YL  R+TL+ VY
Sbjct: 120 QELNYFVPDGYSGENGDLPPLALVDMPGYGFAEAPKAQVDAWTRLVFDYLRGRTTLKRVY 179

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K+ D +V   LDK AVSYQIVLTKIDK+ P      LE+T  L        
Sbjct: 180 VLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDKIKPAGVPRLLEETHKLTYKRAACF 239

Query: 186 PEVIPTSSVKRKGIEVLRKAILETI 210
           P +I TSS K  G++ LR AI   I
Sbjct: 240 PGIIATSSEKGVGLDELRAAIARLI 264


>gi|260567730|ref|ZP_05838199.1| ATP/GTP-binding site-containing protein A [Brucella suis bv. 4 str.
           40]
 gi|260154395|gb|EEW89476.1| ATP/GTP-binding site-containing protein A [Brucella suis bv. 4 str.
           40]
          Length = 241

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 141/201 (70%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +  K +WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LV +K LARTSN PGRT
Sbjct: 34  LLFKKSWIFIRGVPSMKFLPPEGPVEIAFAGRSNVGKSSLINALVGKKGLARTSNTPGRT 93

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+FVP  +S+   +LP +ALVDMPGYG+A APK  VD+W  L+  YL  R+TL+ VY
Sbjct: 94  QELNYFVPDGYSSENGDLPPLALVDMPGYGFAEAPKAQVDAWTRLVFDYLRGRTTLKRVY 153

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K+ D +V   LDK AVSYQIVLTKIDK+ P      LE+T  L        
Sbjct: 154 VLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDKIKPAGVPRLLEETHKLTYKRAACF 213

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
           P +I TSS K +G++ LR AI
Sbjct: 214 PGIIATSSEKGQGLDDLRAAI 234


>gi|161621072|ref|YP_001594958.1| GTPase EngB [Brucella canis ATCC 23365]
 gi|161337883|gb|ABX64187.1| GTP-binding conserved hypothetical protein [Brucella canis ATCC
           23365]
          Length = 267

 Score =  235 bits (599), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 141/201 (70%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +  K +WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LV +K LARTSN PGRT
Sbjct: 60  LLFKKSWIFIRGVPSMKFLPPEGPVEIAFAGRSNVGKSSLINALVGKKGLARTSNTPGRT 119

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+FVP  +S+   +LP +ALVDMPGYG+A APK  VD+W  L+  YL  R+TL+ VY
Sbjct: 120 QELNYFVPDGYSSENGDLPPLALVDMPGYGFAEAPKAQVDAWTRLVFDYLRGRTTLKRVY 179

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K+ D +V   LDK AVSYQIVLTKIDK+ P      LE+T  L        
Sbjct: 180 VLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDKIKPAGVPRLLEETHKLTYKRAACF 239

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
           P +I TSS K +G++ LR AI
Sbjct: 240 PGIIATSSEKGQGLDDLRAAI 260


>gi|17988618|ref|NP_541251.1| ribosome biogenesis GTP-binding protein YsxC [Brucella melitensis
           bv. 1 str. 16M]
 gi|189023103|ref|YP_001932844.1| ribosome biogenesis GTP-binding protein YsxC [Brucella abortus S19]
 gi|254690661|ref|ZP_05153915.1| ribosome biogenesis GTP-binding protein YsxC [Brucella abortus bv.
           6 str. 870]
 gi|254696034|ref|ZP_05157862.1| ribosome biogenesis GTP-binding protein YsxC [Brucella abortus bv.
           3 str. Tulya]
 gi|254699143|ref|ZP_05160971.1| ribosome biogenesis GTP-binding protein YsxC [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254700219|ref|ZP_05162047.1| ribosome biogenesis GTP-binding protein YsxC [Brucella suis bv. 5
           str. 513]
 gi|254703340|ref|ZP_05165168.1| ribosome biogenesis GTP-binding protein YsxC [Brucella suis bv. 3
           str. 686]
 gi|254705519|ref|ZP_05167347.1| ribosome biogenesis GTP-binding protein YsxC [Brucella
           pinnipedialis M163/99/10]
 gi|254710750|ref|ZP_05172561.1| ribosome biogenesis GTP-binding protein YsxC [Brucella
           pinnipedialis B2/94]
 gi|254720148|ref|ZP_05181959.1| ribosome biogenesis GTP-binding protein YsxC [Brucella sp. 83/13]
 gi|254732587|ref|ZP_05191165.1| ribosome biogenesis GTP-binding protein YsxC [Brucella abortus bv.
           4 str. 292]
 gi|256029133|ref|ZP_05442747.1| ribosome biogenesis GTP-binding protein YsxC [Brucella
           pinnipedialis M292/94/1]
 gi|256043892|ref|ZP_05446812.1| ribosome biogenesis GTP-binding protein YsxC [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256058816|ref|ZP_05449032.1| ribosome biogenesis GTP-binding protein YsxC [Brucella neotomae
           5K33]
 gi|256157325|ref|ZP_05455243.1| ribosome biogenesis GTP-binding protein YsxC [Brucella ceti
           M490/95/1]
 gi|256253697|ref|ZP_05459233.1| ribosome biogenesis GTP-binding protein YsxC [Brucella ceti B1/94]
 gi|256255843|ref|ZP_05461379.1| ribosome biogenesis GTP-binding protein YsxC [Brucella abortus bv.
           9 str. C68]
 gi|260167775|ref|ZP_05754586.1| ribosome biogenesis GTP-binding protein YsxC [Brucella sp. F5/99]
 gi|260545088|ref|ZP_05820909.1| ATP/GTP-binding site-containing protein A [Brucella abortus NCTC
           8038]
 gi|260565069|ref|ZP_05835554.1| ATP/GTP-binding site-containing protein A [Brucella melitensis bv.
           1 str. 16M]
 gi|260756232|ref|ZP_05868580.1| GTPase EngB [Brucella abortus bv. 6 str. 870]
 gi|260760399|ref|ZP_05872747.1| GTPase EngB [Brucella abortus bv. 4 str. 292]
 gi|260763639|ref|ZP_05875971.1| GTPase EngB [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882056|ref|ZP_05893670.1| GTPase EngB [Brucella abortus bv. 9 str. C68]
 gi|261216466|ref|ZP_05930747.1| GTPase EngB [Brucella abortus bv. 3 str. Tulya]
 gi|261220834|ref|ZP_05935115.1| GTPase EngB [Brucella ceti B1/94]
 gi|261312923|ref|ZP_05952120.1| GTPase EngB [Brucella pinnipedialis M163/99/10]
 gi|261318318|ref|ZP_05957515.1| GTPase EngB [Brucella pinnipedialis B2/94]
 gi|261322753|ref|ZP_05961950.1| GTPase EngB [Brucella neotomae 5K33]
 gi|261750714|ref|ZP_05994423.1| GTPase EngB [Brucella suis bv. 5 str. 513]
 gi|261753970|ref|ZP_05997679.1| GTPase EngB [Brucella suis bv. 3 str. 686]
 gi|261757212|ref|ZP_06000921.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265985154|ref|ZP_06097889.1| GTPase EngB [Brucella sp. 83/13]
 gi|265986116|ref|ZP_06098673.1| GTPase EngB [Brucella pinnipedialis M292/94/1]
 gi|265990315|ref|ZP_06102872.1| GTPase EngB [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995810|ref|ZP_06108367.1| GTPase EngB [Brucella ceti M490/95/1]
 gi|306839546|ref|ZP_07472353.1| GTP-binding conserved hypothetical protein [Brucella sp. NF 2653]
 gi|306840614|ref|ZP_07473367.1| GTP-binding conserved hypothetical protein [Brucella sp. BO2]
 gi|306846226|ref|ZP_07478788.1| GTP-binding conserved hypothetical protein [Brucella sp. BO1]
 gi|54037055|sp|P64067|ENGB_BRUSU RecName: Full=Probable GTP-binding protein EngB
 gi|54040978|sp|P64066|ENGB_BRUME RecName: Full=Probable GTP-binding protein EngB
 gi|119368793|sp|Q2YJR1|ENGB_BRUA2 RecName: Full=Probable GTP-binding protein EngB
 gi|119368794|sp|Q576T9|ENGB_BRUAB RecName: Full=Probable GTP-binding protein EngB
 gi|17984421|gb|AAL53515.1| gtp-binding protein cgpa [Brucella melitensis bv. 1 str. 16M]
 gi|189021677|gb|ACD74398.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19]
 gi|260098359|gb|EEW82233.1| ATP/GTP-binding site-containing protein A [Brucella abortus NCTC
           8038]
 gi|260152712|gb|EEW87805.1| ATP/GTP-binding site-containing protein A [Brucella melitensis bv.
           1 str. 16M]
 gi|260670717|gb|EEX57657.1| GTPase EngB [Brucella abortus bv. 4 str. 292]
 gi|260674060|gb|EEX60881.1| GTPase EngB [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676340|gb|EEX63161.1| GTPase EngB [Brucella abortus bv. 6 str. 870]
 gi|260871584|gb|EEX78653.1| GTPase EngB [Brucella abortus bv. 9 str. C68]
 gi|260918073|gb|EEX84934.1| GTPase EngB [Brucella abortus bv. 3 str. Tulya]
 gi|260919418|gb|EEX86071.1| GTPase EngB [Brucella ceti B1/94]
 gi|261297541|gb|EEY01038.1| GTPase EngB [Brucella pinnipedialis B2/94]
 gi|261298733|gb|EEY02230.1| GTPase EngB [Brucella neotomae 5K33]
 gi|261301949|gb|EEY05446.1| GTPase EngB [Brucella pinnipedialis M163/99/10]
 gi|261737196|gb|EEY25192.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261740467|gb|EEY28393.1| GTPase EngB [Brucella suis bv. 5 str. 513]
 gi|261743723|gb|EEY31649.1| GTPase EngB [Brucella suis bv. 3 str. 686]
 gi|262550107|gb|EEZ06268.1| GTPase EngB [Brucella ceti M490/95/1]
 gi|263000984|gb|EEZ13674.1| GTPase EngB [Brucella melitensis bv. 1 str. Rev.1]
 gi|264658313|gb|EEZ28574.1| GTPase EngB [Brucella pinnipedialis M292/94/1]
 gi|264663746|gb|EEZ34007.1| GTPase EngB [Brucella sp. 83/13]
 gi|306273477|gb|EFM55338.1| GTP-binding conserved hypothetical protein [Brucella sp. BO1]
 gi|306289399|gb|EFM60633.1| GTP-binding conserved hypothetical protein [Brucella sp. BO2]
 gi|306405378|gb|EFM61650.1| GTP-binding conserved hypothetical protein [Brucella sp. NF 2653]
          Length = 241

 Score =  235 bits (599), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 140/201 (69%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +  K +WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LV +K LARTSN PGRT
Sbjct: 34  LLFKKSWIFIRGVPSMKFLPPEGPVEIAFAGRSNVGKSSLINALVGKKGLARTSNTPGRT 93

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+FVP  +S    +LP +ALVDMPGYG+A APK  VD+W  L+  YL  R+TL+ VY
Sbjct: 94  QELNYFVPDGYSGENGDLPPLALVDMPGYGFAEAPKAQVDAWTRLVFDYLRGRTTLKRVY 153

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K+ D +V   LDK AVSYQIVLTKIDK+ P      LE+T  L        
Sbjct: 154 VLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDKIKPAGVPRLLEETHKLTYKRAACF 213

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
           P +I TSS K +G++ LR AI
Sbjct: 214 PGIIATSSEKGQGLDDLRAAI 234


>gi|23500747|ref|NP_700187.1| ribosome biogenesis GTP-binding protein YsxC [Brucella suis 1330]
 gi|62317853|ref|YP_223706.1| ribosome biogenesis GTP-binding protein YsxC [Brucella abortus bv.
           1 str. 9-941]
 gi|83269832|ref|YP_419123.1| ribosome biogenesis GTP-binding protein YsxC [Brucella melitensis
           biovar Abortus 2308]
 gi|148558302|ref|YP_001257935.1| ribosome biogenesis GTP-binding protein YsxC [Brucella ovis ATCC
           25840]
 gi|163845138|ref|YP_001622793.1| ribosome biogenesis GTP-binding protein YsxC [Brucella suis ATCC
           23445]
 gi|225629473|ref|ZP_03787506.1| GTP-binding conserved hypothetical protein [Brucella ceti str.
           Cudo]
 gi|237817393|ref|ZP_04596385.1| GTP-binding conserved hypothetical protein [Brucella abortus str.
           2308 A]
 gi|256015783|ref|YP_003105792.1| GTP-binding protein [Brucella microti CCM 4915]
 gi|297249211|ref|ZP_06932912.1| GTP-binding protein [Brucella abortus bv. 5 str. B3196]
 gi|23464401|gb|AAN34192.1| GTP-binding protein, putative [Brucella suis 1330]
 gi|62198046|gb|AAX76345.1| hypothetical GTP-binding protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82940106|emb|CAJ13153.1| ATP/GTP-binding site motif A (P-loop):GTP-binding domain [Brucella
           melitensis biovar Abortus 2308]
 gi|148369587|gb|ABQ62459.1| putative GTP-binding protein [Brucella ovis ATCC 25840]
 gi|163675861|gb|ABY39971.1| GTP-binding conserved hypothetical protein [Brucella suis ATCC
           23445]
 gi|225615969|gb|EEH13018.1| GTP-binding conserved hypothetical protein [Brucella ceti str.
           Cudo]
 gi|237788206|gb|EEP62422.1| GTP-binding conserved hypothetical protein [Brucella abortus str.
           2308 A]
 gi|255998443|gb|ACU50130.1| GTP-binding protein [Brucella microti CCM 4915]
 gi|297173080|gb|EFH32444.1| GTP-binding protein [Brucella abortus bv. 5 str. B3196]
          Length = 267

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 140/201 (69%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +  K +WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LV +K LARTSN PGRT
Sbjct: 60  LLFKKSWIFIRGVPSMKFLPPEGPVEIAFAGRSNVGKSSLINALVGKKGLARTSNTPGRT 119

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+FVP  +S    +LP +ALVDMPGYG+A APK  VD+W  L+  YL  R+TL+ VY
Sbjct: 120 QELNYFVPDGYSGENGDLPPLALVDMPGYGFAEAPKAQVDAWTRLVFDYLRGRTTLKRVY 179

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K+ D +V   LDK AVSYQIVLTKIDK+ P      LE+T  L        
Sbjct: 180 VLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDKIKPAGVPRLLEETHKLTYKRAACF 239

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
           P +I TSS K +G++ LR AI
Sbjct: 240 PGIIATSSEKGQGLDDLRAAI 260


>gi|256111043|ref|ZP_05452105.1| ribosome biogenesis GTP-binding protein YsxC [Brucella melitensis
           bv. 3 str. Ether]
 gi|265992578|ref|ZP_06105135.1| GTPase EngB [Brucella melitensis bv. 3 str. Ether]
 gi|262763448|gb|EEZ09480.1| GTPase EngB [Brucella melitensis bv. 3 str. Ether]
          Length = 241

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 140/201 (69%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +  K +WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LV +K LARTSN PGRT
Sbjct: 34  LLFKKSWIFIRGVPSMKFLPPEGPVEIAFAGRSNVGKSSLINALVGKKGLARTSNTPGRT 93

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+FVP  +S    +LP +ALVDMPGYG+A APK  VD+W  L+  YL  R+TL+ VY
Sbjct: 94  QELNYFVPDGYSGKNGDLPPLALVDMPGYGFAEAPKAQVDAWTRLVFDYLRGRTTLKRVY 153

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K+ D +V   LDK AVSYQIVLTKIDK+ P      LE+T  L        
Sbjct: 154 VLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDKIKPAGVPRLLEETHKLTYKRAACF 213

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
           P +I TSS K +G++ LR AI
Sbjct: 214 PGIIATSSEKGQGLDDLRAAI 234


>gi|319405205|emb|CBI78810.1| GTP-binding protein [Bartonella sp. AR 15-3]
          Length = 214

 Score =  234 bits (598), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 113/199 (56%), Positives = 145/199 (72%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GPPEIAF+GRSNVGKSSLIN LV +KNLARTSN PGRTQ LN+F
Sbjct: 15  WIFIRGVPTMKFLPPEGPPEIAFAGRSNVGKSSLINALVQQKNLARTSNTPGRTQELNYF 74

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           +P  F+   ++LP +ALVDMPGYG+A APK  +++W  LI  YL  R+TL+ VY+LID R
Sbjct: 75  IPDGFNGQTHHLPPVALVDMPGYGFAEAPKNLINAWTHLIFDYLRGRTTLKRVYVLIDSR 134

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D D  + LDK AVSYQIVLTK DK+   T +  +  TK  +  +  A+PE++ T
Sbjct: 135 HGIKKNDTDTLNLLDKAAVSYQIVLTKSDKIKLNTLEALIIMTKTKLLKHSAAYPEILVT 194

Query: 192 SSVKRKGIEVLRKAILETI 210
           S+ K  G+E LR AI++ I
Sbjct: 195 SAEKASGLEELRTAIIQAI 213


>gi|319898440|ref|YP_004158533.1| GTP-binding protein [Bartonella clarridgeiae 73]
 gi|319402404|emb|CBI75945.1| GTP-binding protein [Bartonella clarridgeiae 73]
          Length = 213

 Score =  234 bits (597), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 113/199 (56%), Positives = 143/199 (71%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GPPEIAF+GRSNVGKSSLIN LV +KNLARTSN PGRTQ LN+F
Sbjct: 14  WIFIRGVPTMKFLPAEGPPEIAFAGRSNVGKSSLINALVQQKNLARTSNTPGRTQELNYF 73

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           +P  F+    N P +A VDMPGYG+A APK  V++W  LI  YL  R+TL+ VY+LID R
Sbjct: 74  IPDGFNGQSQNFPPIAFVDMPGYGFAEAPKHLVNAWTHLIFDYLRGRTTLKRVYVLIDSR 133

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D + F+ LDK AVSYQIVLTK DK+     +  +  TK  +  +P A+PE++ T
Sbjct: 134 HGIKKNDIETFNLLDKAAVSYQIVLTKSDKIKSDALKALIMITKTKLLKHPAAYPEILVT 193

Query: 192 SSVKRKGIEVLRKAILETI 210
           S+ K  G+E LR AI++ I
Sbjct: 194 SAKKTFGLEELRTAIIQVI 212


>gi|256262087|ref|ZP_05464619.1| ATP/GTP-binding site domain-containing protein A [Brucella
           melitensis bv. 2 str. 63/9]
 gi|263091776|gb|EEZ16107.1| ATP/GTP-binding site domain-containing protein A [Brucella
           melitensis bv. 2 str. 63/9]
 gi|326411187|gb|ADZ68251.1| ribosome biogenesis GTP-binding protein YsxC [Brucella melitensis
           M28]
 gi|326554478|gb|ADZ89117.1| ribosome biogenesis GTP-binding protein YsxC [Brucella melitensis
           M5-90]
          Length = 241

 Score =  234 bits (597), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 140/201 (69%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +  K +WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LV +K LARTSN PGRT
Sbjct: 34  LLFKKSWIFIRGVPSMKFLPPEGPVEIAFAGRSNVGKSSLINALVGKKGLARTSNTPGRT 93

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+FVP  +S    +LP +ALVDMPGYG+A APK  VD+W  L+  YL  R+TL+ VY
Sbjct: 94  QELNYFVPDGYSGENGDLPPLALVDMPGYGFAEAPKVQVDAWTRLVFDYLRGRTTLKRVY 153

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K+ D +V   LDK AVSYQIVLTKIDK+ P      LE+T  L        
Sbjct: 154 VLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDKIKPAGVPRLLEETHKLTYKRAACF 213

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
           P +I TSS K +G++ LR AI
Sbjct: 214 PGIIATSSEKGQGLDDLRAAI 234


>gi|225686779|ref|YP_002734751.1| ribosome biogenesis GTP-binding protein YsxC [Brucella melitensis
           ATCC 23457]
 gi|225642884|gb|ACO02797.1| GTP-binding conserved hypothetical protein [Brucella melitensis
           ATCC 23457]
          Length = 267

 Score =  234 bits (597), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 140/201 (69%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +  K +WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LV +K LARTSN PGRT
Sbjct: 60  LLFKKSWIFIRGVPSMKFLPPEGPVEIAFAGRSNVGKSSLINALVGKKGLARTSNTPGRT 119

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+FVP  +S    +LP +ALVDMPGYG+A APK  VD+W  L+  YL  R+TL+ VY
Sbjct: 120 QELNYFVPDGYSGENGDLPPLALVDMPGYGFAEAPKVQVDAWTRLVFDYLRGRTTLKRVY 179

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K+ D +V   LDK AVSYQIVLTKIDK+ P      LE+T  L        
Sbjct: 180 VLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDKIKPAGVPRLLEETHKLTYKRAACF 239

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
           P +I TSS K +G++ LR AI
Sbjct: 240 PGIIATSSEKGQGLDDLRAAI 260


>gi|254712780|ref|ZP_05174591.1| ribosome biogenesis GTP-binding protein YsxC [Brucella ceti
           M644/93/1]
 gi|254715849|ref|ZP_05177660.1| ribosome biogenesis GTP-binding protein YsxC [Brucella ceti
           M13/05/1]
 gi|261217610|ref|ZP_05931891.1| GTPase EngB [Brucella ceti M13/05/1]
 gi|261320487|ref|ZP_05959684.1| GTPase EngB [Brucella ceti M644/93/1]
 gi|260922699|gb|EEX89267.1| GTPase EngB [Brucella ceti M13/05/1]
 gi|261293177|gb|EEX96673.1| GTPase EngB [Brucella ceti M644/93/1]
          Length = 241

 Score =  234 bits (596), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 114/201 (56%), Positives = 140/201 (69%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +  K +WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LV +K LARTSN PGRT
Sbjct: 34  LLFKKSWIFIRGVPSMKFLPPEGPVEIAFAGRSNVGKSSLINALVGKKGLARTSNTPGRT 93

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+FVP  +S    +LP +ALVDMPGYG+A APK  VD+W  L+  YL  R+TL+ VY
Sbjct: 94  QELNYFVPDGYSGENGDLPPLALVDMPGYGFAEAPKAQVDAWTRLVFDYLRGRTTLKRVY 153

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K+ D +V   LDK AVSYQIVLTK+DK+ P      LE+T  L        
Sbjct: 154 VLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKLDKIKPAGVPRLLEETHKLTYKRAACF 213

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
           P +I TSS K +G++ LR AI
Sbjct: 214 PGIIATSSEKGQGLDDLRAAI 234


>gi|294853977|ref|ZP_06794649.1| GTP-binding protein [Brucella sp. NVSL 07-0026]
 gi|294819632|gb|EFG36632.1| GTP-binding protein [Brucella sp. NVSL 07-0026]
          Length = 267

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 114/201 (56%), Positives = 139/201 (69%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +  K +WIF+RGVP +  LP  GP EIAF+GRSNVGKSSLIN LV +K LARTSN PGRT
Sbjct: 60  LLFKKSWIFIRGVPSMKFLPPEGPVEIAFAGRSNVGKSSLINALVGKKGLARTSNTPGRT 119

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LN+FVP  +S    +LP +ALVDMPGY +A APK  VD+W  L+  YL  R+TL+ VY
Sbjct: 120 QELNYFVPDGYSGENGDLPPLALVDMPGYSFAEAPKAQVDAWTRLVFDYLRGRTTLKRVY 179

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K+ D +V   LDK AVSYQIVLTKIDK+ P      LE+T  L        
Sbjct: 180 VLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDKIKPAGVPRLLEETHKLTYKRAACF 239

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
           P +I TSS K +G++ LR AI
Sbjct: 240 PGIIATSSEKGQGLDDLRAAI 260


>gi|90419895|ref|ZP_01227804.1| GTP-binding protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90335936|gb|EAS49684.1| GTP-binding protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 226

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 141/200 (70%)

Query: 7   FTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ 66
           F    W+F+RGVP +  LP  GPPEIAF+GRSNVGKSSLIN L+ +K LARTSN PGRTQ
Sbjct: 22  FFGQPWVFVRGVPAMKFLPPEGPPEIAFAGRSNVGKSSLINALLAQKGLARTSNTPGRTQ 81

Query: 67  HLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYL 126
            LNFFVP  +      LP +A+VDMPGYGYA+APK +VD+W  L+  YL  R++L+ V+L
Sbjct: 82  ELNFFVPDGYGGETAELPPIAVVDMPGYGYAKAPKDHVDAWTKLVFSYLRGRASLKRVFL 141

Query: 127 LIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP 186
           LID RHG+K+ D++V   LDK AVSYQIVLTK DK+  T   + +E T   I+ +P A P
Sbjct: 142 LIDARHGIKKNDEEVMGLLDKAAVSYQIVLTKTDKIKATGVPKLIEATALGIKRHPAAFP 201

Query: 187 EVIPTSSVKRKGIEVLRKAI 206
            ++ TSS K  G++ L+  I
Sbjct: 202 RILSTSSEKGVGLDELKAEI 221


>gi|86356093|ref|YP_467985.1| GTPase EngB [Rhizobium etli CFN 42]
 gi|119369241|sp|Q2KD28|ENGB_RHIEC RecName: Full=Probable GTP-binding protein EngB
 gi|86280195|gb|ABC89258.1| GTP-binding protein [Rhizobium etli CFN 42]
          Length = 217

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 145/200 (72%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GPPE+AF+GRSNVGKSSLIN LV++K LARTSN PGRTQ LN+F
Sbjct: 13  WIFIRGVPSLNFLPPEGPPEVAFAGRSNVGKSSLINALVSQKGLARTSNTPGRTQELNYF 72

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  +S    +LP MA+VDMPGYGYA+APK+ VD W  L+  YL  R+TL+ VY+LID R
Sbjct: 73  VPDGYSGEAGDLPPMAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSR 132

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D DV   LDK AVSYQ+VLTK DK+      + L +T   IR  P A+P ++ T
Sbjct: 133 HGIKKNDDDVLDLLDKAAVSYQLVLTKTDKIKAPAVPKLLAETADKIRKRPAAYPYLLST 192

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS K  G++ LR+AI ET+ 
Sbjct: 193 SSEKGDGLDELRQAIAETVG 212


>gi|209547691|ref|YP_002279608.1| ribosome biogenesis GTP-binding protein YsxC [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|238058987|sp|B5ZN41|ENGB_RHILW RecName: Full=Probable GTP-binding protein EngB
 gi|209533447|gb|ACI53382.1| GTP-binding protein HSR1-related [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 217

 Score =  225 bits (573), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 143/200 (71%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP E+AF+GRSNVGKSSLIN LV +K LARTSN PGRTQ LN+F
Sbjct: 13  WIFIRGVPSLNFLPPEGPLEVAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYF 72

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  +S    ++P MA+VDMPGYGYA+APK+ VD W  L+  YL  R+TL+ VY+LID R
Sbjct: 73  VPDGYSGESGDMPPMAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSR 132

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D DV   LDK AVSYQIVLTK DK+      + L +T   IR  P A+P V+ T
Sbjct: 133 HGIKKNDDDVLDLLDKAAVSYQIVLTKTDKIKAPAVPKLLAETAEKIRKRPAAYPGVLST 192

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS K  G++ LR+AI ET+ 
Sbjct: 193 SSEKGDGLDDLRQAIGETVG 212


>gi|116250221|ref|YP_766059.1| ribosome biogenesis GTP-binding protein YsxC [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|119369242|sp|Q1MM59|ENGB_RHIL3 RecName: Full=Probable GTP-binding protein EngB
 gi|115254869|emb|CAK05943.1| putative GTP-binding protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 217

 Score =  224 bits (570), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 142/200 (71%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP E+AF+GRSNVGKSSLIN LV +K LARTSN PGRTQ LN+F
Sbjct: 13  WIFIRGVPSLNFLPPEGPLEVAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYF 72

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  +S    +LP  A+VDMPGYGYA+APK+ VD W  L+  YL  R+TL+ VY+LID R
Sbjct: 73  VPDGYSGEGGDLPPTAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSR 132

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D DV   LDK AVSYQIVLTK DK+      + L +T   IR  P A+P V+ T
Sbjct: 133 HGIKKNDDDVLDLLDKAAVSYQIVLTKTDKIKAAGVPKLLAETAEKIRKRPAAYPGVLST 192

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS K  G++ LR+AI ET+ 
Sbjct: 193 SSEKGDGLDELRQAIAETVG 212


>gi|241202848|ref|YP_002973944.1| ribosome biogenesis GTP-binding protein YsxC [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240856738|gb|ACS54405.1| GTP-binding protein HSR1-related [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 217

 Score =  224 bits (570), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 142/200 (71%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP E+AF+GRSNVGKSSLIN LV +K LARTSN PGRTQ LN+F
Sbjct: 13  WIFIRGVPSLNFLPPEGPLEVAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYF 72

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  +S    +LP  A+VDMPGYGYA+APK+ VD W  L+  YL  R+TL+ VY+LID R
Sbjct: 73  VPDGYSGEGQDLPPTAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSR 132

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D DV   LDK AVSYQIVLTK DK+      + L +T   IR  P A+P V+ T
Sbjct: 133 HGIKKNDDDVLDLLDKAAVSYQIVLTKTDKIKAAGVPKLLAETAEKIRKRPAAYPGVLST 192

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS K  G++ LR+AI ET+ 
Sbjct: 193 SSEKGDGLDELRQAIAETVG 212


>gi|304392401|ref|ZP_07374342.1| ribosome biogenesis GTP-binding protein YsxC [Ahrensia sp. R2A130]
 gi|303295505|gb|EFL89864.1| ribosome biogenesis GTP-binding protein YsxC [Ahrensia sp. R2A130]
          Length = 233

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 139/204 (68%), Gaps = 10/204 (4%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+RGVP +  LP+ GPPEIAF+GRSNVGKSSLIN L   K LARTSN PGRTQ LNFF
Sbjct: 35  WQFVRGVPAMKFLPEEGPPEIAFAGRSNVGKSSLINALTATKGLARTSNTPGRTQELNFF 94

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
            P   +  ++ LP +ALVDMPGYG+A+APK  VD+W  LI  YL  R+TL+ VY+LID R
Sbjct: 95  TPD--AEFEDGLPPIALVDMPGYGFAKAPKDAVDAWTKLIFSYLRGRTTLKRVYVLIDAR 152

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTT----AQETLEKTKYLIRNYPTAHPE 187
           HGVK+ D++VF  LDK AVSYQ+VLTK DK+ P        ETLEK    I     A P 
Sbjct: 153 HGVKKNDEEVFDLLDKAAVSYQLVLTKADKIKPPALVKLQAETLEK----IAKRAAAFPF 208

Query: 188 VIPTSSVKRKGIEVLRKAILETIN 211
           ++ TSS K  G++ L+  IL  I 
Sbjct: 209 IVSTSSEKGHGVDDLKGQILYAIE 232


>gi|218679046|ref|ZP_03526943.1| GTPase EngB [Rhizobium etli CIAT 894]
          Length = 185

 Score =  214 bits (545), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 104/180 (57%), Positives = 129/180 (71%)

Query: 32  IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDM 91
           +AF+GRSNVGKSSLIN LV +K LARTSN PGRTQ LN+FVP  +S    +LP  A+VDM
Sbjct: 1   MAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYFVPDGYSGEGGDLPPTAIVDM 60

Query: 92  PGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVS 151
           PGYGYA+APK+ VD W  L+  YL  R+TL+ VY+LID RHG+K+ D+DV   LDK AVS
Sbjct: 61  PGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDEDVLDLLDKAAVS 120

Query: 152 YQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETIN 211
           YQIVLTK DK+      + L +T   IR  P A+P V+ TSS K  G++ LR+AI ET+ 
Sbjct: 121 YQIVLTKTDKIKAAGVPKLLAETAERIRKRPAAYPAVLSTSSEKGDGMDELRQAIAETVG 180


>gi|319408961|emb|CBI82618.1| GTP-binding protein [Bartonella schoenbuchensis R1]
          Length = 181

 Score =  207 bits (528), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 98/164 (59%), Positives = 120/164 (73%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+R VP I  LP  GPPEIAF GRSNVGKSSLIN LV +K LARTSN PGRTQ LN+F
Sbjct: 15  WIFIRSVPTIQCLPPEGPPEIAFVGRSNVGKSSLINALVQQKGLARTSNTPGRTQELNYF 74

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           +P++ S+ K + P +ALVDMPGYG+A+AP   +++W  LI  YL  R+TL+  Y+LID R
Sbjct: 75  IPENLSDQKEDFPPIALVDMPGYGFAKAPPSCIEAWTRLIFDYLRGRTTLKRAYVLIDSR 134

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK 175
           HG+K+ D DV   LDK AVSYQIVLTK DK+ P   +  +  TK
Sbjct: 135 HGIKKNDTDVLDLLDKAAVSYQIVLTKSDKIKPNALETLVTATK 178


>gi|254473683|ref|ZP_05087078.1| GTP-binding protein [Pseudovibrio sp. JE062]
 gi|211957069|gb|EEA92274.1| GTP-binding protein [Pseudovibrio sp. JE062]
          Length = 216

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 110/201 (54%), Positives = 130/201 (64%), Gaps = 8/201 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+  V E+  LP     EIAF+GRSNVGKSSLIN L  +K LARTSN PGRTQ LNFF
Sbjct: 23  WEFITSVKEMHQLPVLDGIEIAFAGRSNVGKSSLINKLTGKKALARTSNTPGRTQMLNFF 82

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
              + S LK       +VDMPGYGYA APK  VD+W  LI  YL  RSTLR V+ LID R
Sbjct: 83  -GAEHSMLK-------IVDMPGYGYAEAPKGMVDAWTSLIFDYLRGRSTLRRVFSLIDSR 134

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D D  + LDK AV YQ+VLTK DKL P   Q   E+T  ++   P AHPEVI T
Sbjct: 135 HGIKKNDLDAMAILDKAAVPYQVVLTKADKLKPGQLQRMKEETLKVLAKRPAAHPEVIAT 194

Query: 192 SSVKRKGIEVLRKAILETINY 212
           SS K  G++ LR  I + ++Y
Sbjct: 195 SSEKGLGMDDLRAEIAQLVSY 215


>gi|328545252|ref|YP_004305361.1| GTPase EngB [polymorphum gilvum SL003B-26A1]
 gi|326414994|gb|ADZ72057.1| GTPase EngB [Polymorphum gilvum SL003B-26A1]
          Length = 218

 Score =  198 bits (504), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 124/200 (62%), Gaps = 8/200 (4%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W FL  V +I  LP  G  EIAF+GRSNVGKSSLIN L  +K LARTSN PGRTQ LNFF
Sbjct: 23  WRFLTSVADIRQLPDIGSLEIAFAGRSNVGKSSLINALTGQKALARTSNTPGRTQMLNFF 82

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
             +          A+ +VDMPGYGYA APK  VD+W  LI  YL  R TLR V+LLID R
Sbjct: 83  GAEG--------AAVTIVDMPGYGYAEAPKGMVDAWTDLIFAYLRGRPTLRRVFLLIDSR 134

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K  D +    LDK AV YQ+VLTK DK+ P      +  T   +   P AHPE++ T
Sbjct: 135 HGLKSNDLEAMQLLDKAAVVYQVVLTKADKIKPGQLDRLVVDTAKALAKRPAAHPEILVT 194

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS K  GI+ LR AI   +N
Sbjct: 195 SSEKNTGIDSLRAAIAVLVN 214


>gi|218509358|ref|ZP_03507236.1| GTPase EngB [Rhizobium etli Brasil 5]
          Length = 175

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 95/170 (55%), Positives = 121/170 (71%)

Query: 42  KSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPK 101
           KSSLIN LV +K LARTSN PGRTQ LN+FVP  +S    +LP MA+VDMPGYGYA+APK
Sbjct: 1   KSSLINALVGQKGLARTSNTPGRTQELNYFVPDGYSGEGGDLPPMAIVDMPGYGYAQAPK 60

Query: 102 KNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDK 161
           + VD W  L+  YL  R+TL+ VY+LID RHG+K+ D+DV + LDK AVSYQ+VLTK DK
Sbjct: 61  EQVDKWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDEDVLTLLDKAAVSYQLVLTKTDK 120

Query: 162 LSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETIN 211
           +      + L +T   IR  P A+P V+ TSS K  G++ LR+AI +T+ 
Sbjct: 121 IKAPAVPKLLAETADKIRKRPAAYPAVLSTSSEKGDGLDDLRQAIAQTVG 170


>gi|118589751|ref|ZP_01547156.1| GTP-binding protein [Stappia aggregata IAM 12614]
 gi|118437837|gb|EAV44473.1| GTP-binding protein [Stappia aggregata IAM 12614]
          Length = 215

 Score =  195 bits (495), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 128/196 (65%), Gaps = 8/196 (4%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W FL  V ++  LP+A   EIAF+GRSNVGKSSLIN L  RK+LARTS  PGRTQ LNFF
Sbjct: 23  WDFLTSVTDMANLPEAAGAEIAFAGRSNVGKSSLINALTGRKDLARTSATPGRTQMLNFF 82

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           +  +          + +VDMPGYGYA+APK+ V++W  L+  YL  R  LR V LLID R
Sbjct: 83  IAPE--------TPLTIVDMPGYGYAQAPKELVEAWTKLVFSYLRGRPNLRRVILLIDSR 134

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D +    LDK AV YQ+VLTK DK+ P      +E+T+ ++R    AHPE++ T
Sbjct: 135 HGIKKNDLEAMELLDKAAVVYQVVLTKSDKIKPPQLVRLIEETQAILRKRVAAHPEILAT 194

Query: 192 SSVKRKGIEVLRKAIL 207
           SS K +G++ LR  + 
Sbjct: 195 SSEKNRGVDELRAELF 210


>gi|94495880|ref|ZP_01302459.1| GTP-binding protein [Sphingomonas sp. SKA58]
 gi|94424572|gb|EAT09594.1| GTP-binding protein [Sphingomonas sp. SKA58]
          Length = 215

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 98/197 (49%), Positives = 124/197 (62%), Gaps = 7/197 (3%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+  P++  LP     E+AF+GRSNVGKSSL+N L NR  LARTSN PGRTQ LNFF  
Sbjct: 23  FLKSAPDLKFLPDMAVNEVAFAGRSNVGKSSLLNALTNRNGLARTSNTPGRTQELNFFDV 82

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D    +       LVDMPGYGYA+APK  V  W  L+  YL  R+ L+   +LID RHG
Sbjct: 83  GDPLRFR-------LVDMPGYGYAKAPKDMVKKWRFLVNDYLRGRAALKRTLVLIDSRHG 135

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D D+   LD  AVSY+IVLTK DK+  +      ++T   IR  P AHP++I TSS
Sbjct: 136 IKDVDTDMLDMLDGAAVSYRIVLTKADKIKASALAAVTQQTADAIRKRPAAHPDIIATSS 195

Query: 194 VKRKGIEVLRKAILETI 210
            K  G+  LR A+LE++
Sbjct: 196 EKGMGLPELRAAVLESV 212


>gi|154250754|ref|YP_001411578.1| ribosome biogenesis GTP-binding protein YsxC [Parvibaculum
           lavamentivorans DS-1]
 gi|154154704|gb|ABS61921.1| GTP-binding protein HSR1-related [Parvibaculum lavamentivorans
           DS-1]
          Length = 235

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/193 (52%), Positives = 122/193 (63%), Gaps = 5/193 (2%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+RGV  +  LP     E+AF+GRSNVGKSSLIN L  RK LARTSN PGRT+ LNFF  
Sbjct: 33  FVRGVVAMDGLPSTTITEVAFAGRSNVGKSSLINALTGRKTLARTSNTPGRTKELNFFAL 92

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               N     PA+ LVD+PGYGYAR  +  VD W  LI+ YL  R  LR V +LID RHG
Sbjct: 93  GTSGN-----PAIMLVDLPGYGYARETRTRVDQWTDLIMAYLRGRVPLRRVLVLIDARHG 147

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K  D  V + LD+ AVSYQIVLTKIDKL     +  L++ +  IR +  AHP ++ TSS
Sbjct: 148 LKDNDHSVMTLLDEAAVSYQIVLTKIDKLKAGELETRLDEVRAGIRRHVAAHPRIVATSS 207

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 208 EKGTGIAELRAEI 220


>gi|332186237|ref|ZP_08387982.1| ribosome biogenesis GTP-binding protein YsxC [Sphingomonas sp. S17]
 gi|332013605|gb|EGI55665.1| ribosome biogenesis GTP-binding protein YsxC [Sphingomonas sp. S17]
          Length = 224

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 126/198 (63%), Gaps = 7/198 (3%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+  P +  LP    PEIA +GRSNVGKSSL+N L NR  LARTSN PGRTQ LNFF  
Sbjct: 34  FLKSAPALKFLPDPIVPEIAVAGRSNVGKSSLLNALTNRNGLARTSNTPGRTQELNFF-- 91

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D      N P + LVDMPGYG+A+APK  V  W  L+  +L  R  L+   +LID RHG
Sbjct: 92  -DV----GNPPTLRLVDMPGYGFAKAPKDMVKQWRFLVNDFLRGRQALKRALVLIDSRHG 146

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K++D+++   LD+ AVSY+IVLTK DK+  T   + + +T+   R  P AHP+++ TSS
Sbjct: 147 IKEVDREILEMLDRAAVSYRIVLTKADKVKATELADVVARTEVEARKRPAAHPDILATSS 206

Query: 194 VKRKGIEVLRKAILETIN 211
               GI  LR A+LE I 
Sbjct: 207 EGGMGIAELRAAVLEAIG 224


>gi|307294061|ref|ZP_07573905.1| ribosome biogenesis GTP-binding protein YsxC [Sphingobium
           chlorophenolicum L-1]
 gi|306880212|gb|EFN11429.1| ribosome biogenesis GTP-binding protein YsxC [Sphingobium
           chlorophenolicum L-1]
          Length = 215

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 98/197 (49%), Positives = 123/197 (62%), Gaps = 7/197 (3%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+  P++  LP     E+AF+GRSNVGKSSL+N L NR  LARTSN PGRTQ LNFF  
Sbjct: 23  FLKSAPDLKFLPDMAVNEVAFAGRSNVGKSSLLNALTNRNGLARTSNTPGRTQELNFFDV 82

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D    +       LVDMPGYGYA+APK  V  W  L+  YL  R+ L+   +LID RHG
Sbjct: 83  GDPLRFR-------LVDMPGYGYAKAPKDMVRKWRFLVNDYLRGRAKLKRTLVLIDSRHG 135

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D D+   LD  AVSY+IVLTK DK+  +   E  +     IR  P AHP++I TSS
Sbjct: 136 IKDVDTDILDMLDAAAVSYRIVLTKADKVKASHLAEVKQAVAEAIRKRPAAHPDIIATSS 195

Query: 194 VKRKGIEVLRKAILETI 210
            K  G+  LR A+LE++
Sbjct: 196 EKGMGLPELRAAVLESV 212


>gi|294675900|ref|YP_003576515.1| GTP-binding protein EngB [Rhodobacter capsulatus SB 1003]
 gi|294474720|gb|ADE84108.1| GTP-binding protein EngB [Rhodobacter capsulatus SB 1003]
          Length = 216

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 97/199 (48%), Positives = 129/199 (64%), Gaps = 10/199 (5%)

Query: 13  IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           +FL+GV  +  LP A   E+ F+GRSNVGKSSLIN L  RKNLAR SN PGRTQ +NFF 
Sbjct: 28  LFLKGVVAMAGLPPADRIEVCFAGRSNVGKSSLINALTGRKNLARASNTPGRTQEINFFT 87

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
            +             LVD+PGYG+A AP   V  W  L+  YLS R+TLR  ++LID RH
Sbjct: 88  TEG---------GPYLVDLPGYGFAEAPVAIVKKWQALLKSYLSGRATLRRAFVLIDARH 138

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
           GVK +D+++   LD+ AV++Q VLTK DK+S    +  +E+ K  +  +P A+PE++ TS
Sbjct: 139 GVKAVDEEILQLLDRSAVTFQAVLTKADKISKAELERVIEQVKGALAKHPAAYPEIVVTS 198

Query: 193 SVKRKGIEVLRKAILETIN 211
           S K +GIE LR AI+ T+ 
Sbjct: 199 SEKGEGIETLR-AIIATLE 216


>gi|294010744|ref|YP_003544204.1| GTP-binding protein [Sphingobium japonicum UT26S]
 gi|292674074|dbj|BAI95592.1| GTP-binding protein [Sphingobium japonicum UT26S]
          Length = 215

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 98/197 (49%), Positives = 122/197 (61%), Gaps = 7/197 (3%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+  P++  LP     E+AF+GRSNVGKSSL+N L NR  LARTSN PGRTQ LNFF  
Sbjct: 23  FLKSAPDLKFLPDMAVNEVAFAGRSNVGKSSLLNALTNRNGLARTSNTPGRTQELNFFDV 82

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D    +       LVDMPGYGYA+APK  V  W  L+  YL  R+ L+   +LID RHG
Sbjct: 83  GDPLRFR-------LVDMPGYGYAKAPKDMVRKWRFLVNDYLRGRAKLKRTLVLIDSRHG 135

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D D+   LD  AVSY+IVLTK DK+  +   E        IR  P AHP++I TSS
Sbjct: 136 IKDVDTDILDMLDAAAVSYRIVLTKADKVKASHLAEVRHSVTEAIRKRPAAHPDIIATSS 195

Query: 194 VKRKGIEVLRKAILETI 210
            K  G+  LR A+LE++
Sbjct: 196 EKGMGLPELRAAVLESV 212


>gi|312113265|ref|YP_004010861.1| ribosome biogenesis GTP-binding protein YsxC [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311218394|gb|ADP69762.1| ribosome biogenesis GTP-binding protein YsxC [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 214

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 99/195 (50%), Positives = 129/195 (66%), Gaps = 9/195 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ GV ++  LP+   PE+AF+GRSNVGKSSL+N L++R+NLAR SN PGRT+ +N+F  
Sbjct: 27  FVLGVTDVAALPEGNRPEVAFAGRSNVGKSSLLNALLSRRNLARVSNTPGRTREVNYFSV 86

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D         A+ +VDMPGYGYA+APK  V  W  LI  YL  R  L+ V LLID RHG
Sbjct: 87  GD---------ALYVVDMPGYGYAKAPKALVKGWTQLIHDYLRGRPQLKRVMLLIDSRHG 137

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K  D+++ + LDK AVSYQ VLTK DK       + + +T+ ++R +P AHP V+ TSS
Sbjct: 138 LKPSDKEIMTLLDKAAVSYQGVLTKADKPKAGDLGQVVRETEAVMRTHPAAHPVVLTTSS 197

Query: 194 VKRKGIEVLRKAILE 208
           V   GIE LR AI E
Sbjct: 198 VDGAGIEELRTAIAE 212


>gi|254501660|ref|ZP_05113811.1| small GTP-binding protein domain, putative [Labrenzia alexandrii
           DFL-11]
 gi|222437731|gb|EEE44410.1| small GTP-binding protein domain, putative [Labrenzia alexandrii
           DFL-11]
          Length = 215

 Score =  191 bits (484), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 99/195 (50%), Positives = 124/195 (63%), Gaps = 8/195 (4%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W FL  V ++  LP A   EIAF+GRSNVGKSSLIN L  RK LARTS+ PGRTQ LNFF
Sbjct: 23  WDFLTSVTDMANLPPAAGTEIAFAGRSNVGKSSLINALTGRKGLARTSSTPGRTQMLNFF 82

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           V  +          + +VDMPGYGYA+APK+ V++W  L+  YL  R  LR V LLID R
Sbjct: 83  VAPE--------TPLTIVDMPGYGYAQAPKELVEAWTNLVFSYLRGRPNLRRVILLIDSR 134

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D +    LDK AV YQ+VLTK DK+ P      +++TK        AHPE+I T
Sbjct: 135 HGIKKNDLEAMELLDKAAVVYQVVLTKADKIKPPALVRLIDETKAASAKRVAAHPEIIAT 194

Query: 192 SSVKRKGIEVLRKAI 206
           SS K +G++ LR  +
Sbjct: 195 SSEKNRGVDELRAEL 209


>gi|90422336|ref|YP_530706.1| ribosome biogenesis GTP-binding protein YsxC [Rhodopseudomonas
           palustris BisB18]
 gi|119369245|sp|Q21B49|ENGB_RHOPB RecName: Full=Probable GTP-binding protein EngB
 gi|90104350|gb|ABD86387.1| GTP-binding [Rhodopseudomonas palustris BisB18]
          Length = 216

 Score =  191 bits (484), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 99/199 (49%), Positives = 127/199 (63%), Gaps = 7/199 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+   P I  LP     E+AF+GRSNVGKSSLIN L  R  LARTS+ PGRTQ L FF
Sbjct: 21  WQFIWASPSIETLPPMAGLEVAFAGRSNVGKSSLINALTGRNALARTSHTPGRTQELIFF 80

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
              + +N +       LVDMPGYGYA APK  + SW  LI  +L  RSTL  VY+LID R
Sbjct: 81  EGPENANFR-------LVDMPGYGYASAPKAKIASWTSLIHNFLQGRSTLARVYVLIDAR 133

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K++DQDV + LDK AVSYQ+VLTK D++ P    +     +  +R +P A+PE++ T
Sbjct: 134 HGLKEVDQDVLNTLDKSAVSYQVVLTKADQVKPAELAQCRIDVEAGLRKHPAAYPELLVT 193

Query: 192 SSVKRKGIEVLRKAILETI 210
           SS    G+  LR A+++ I
Sbjct: 194 SSRTGAGMPELRAAMIKLI 212


>gi|148556520|ref|YP_001264102.1| ribosome biogenesis GTP-binding protein YsxC [Sphingomonas
           wittichii RW1]
 gi|148501710|gb|ABQ69964.1| GTP-binding protein, HSR1-related [Sphingomonas wittichii RW1]
          Length = 220

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/197 (48%), Positives = 127/197 (64%), Gaps = 2/197 (1%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+  P++  LP    PE+AF+GRSNVGKSSL+N L NR  LARTSN PGRTQ LNFF  
Sbjct: 24  FLKSAPDLRYLPDPVAPEVAFAGRSNVGKSSLLNRLTNRVGLARTSNTPGRTQELNFF-- 81

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
              ++ +  +PA+ LVDMPGYG+A+APK  V  W  ++  YL  R  LR   +LID RHG
Sbjct: 82  DVGADEEGGVPALRLVDMPGYGFAKAPKDIVRKWRHVVNDYLRGRVVLRRALVLIDSRHG 141

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D+++   LDK AV+Y +VLTK DK+  +      E+T    R +  AHP ++ TSS
Sbjct: 142 IKDVDREIMEMLDKAAVTYHLVLTKADKIKASELAAVTERTAAEARTHVAAHPRLLVTSS 201

Query: 194 VKRKGIEVLRKAILETI 210
            K  G+  LR AIL+ I
Sbjct: 202 EKDMGMAELRAAILDAI 218


>gi|103485501|ref|YP_615062.1| ribosome biogenesis GTP-binding protein YsxC [Sphingopyxis
           alaskensis RB2256]
 gi|119369262|sp|Q1GN74|ENGB_SPHAL RecName: Full=Probable GTP-binding protein EngB
 gi|98975578|gb|ABF51729.1| GTP-binding [Sphingopyxis alaskensis RB2256]
          Length = 219

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 122/198 (61%), Gaps = 7/198 (3%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+  P +  LP    PEIAF+GRSNVGKSSL+N L NR  LARTS  PGRTQ LN+F  
Sbjct: 28  FLKSAPALQHLPVPSVPEIAFAGRSNVGKSSLLNALTNRNGLARTSVTPGRTQELNYF-- 85

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D        P   LVDMPGYG+A+APK  V  W  LI  YL  R  L+   +LID RHG
Sbjct: 86  -DV----GEPPVFRLVDMPGYGFAKAPKDVVRKWRFLINDYLRGRQVLKRTLVLIDSRHG 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D+DV   LD  AVSY++VLTK DK+  +   +    T+   R +P AHPEVI TSS
Sbjct: 141 IKDVDRDVLEMLDTAAVSYRLVLTKADKIKASALADVHAATEAEARKHPAAHPEVIATSS 200

Query: 194 VKRKGIEVLRKAILETIN 211
            K  GI  LR A+LE + 
Sbjct: 201 EKGMGIAELRTAVLEAVE 218


>gi|146337895|ref|YP_001202943.1| ribosome biogenesis GTP-binding protein YsxC [Bradyrhizobium sp.
           ORS278]
 gi|146190701|emb|CAL74705.1| putative GTP-binding protein engB [Bradyrhizobium sp. ORS278]
          Length = 219

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 127/201 (63%), Gaps = 7/201 (3%)

Query: 11  AWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNF 70
           AW F    P I  LP  GP EIAF+GRSNVGKSSLIN L  +  LARTS+ PGRTQ L F
Sbjct: 22  AWRFTHASPSIASLPPMGPIEIAFAGRSNVGKSSLINALTGQNALARTSHTPGRTQELIF 81

Query: 71  FVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDC 130
           F   D + L+       LVDMPGYGYA A K  V SW  LI ++L  R++L  VY+LID 
Sbjct: 82  FQGPDSAPLR-------LVDMPGYGYAAAAKTKVASWTELIHQFLLGRASLARVYVLIDA 134

Query: 131 RHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP 190
           RHG+K++DQ++   LD+ AVSYQ+VLTK D++ P      + +T+  +  +P A P+V+ 
Sbjct: 135 RHGLKEVDQEILKTLDRSAVSYQLVLTKADQIKPAELASRIAETETALAKHPAAFPQVLA 194

Query: 191 TSSVKRKGIEVLRKAILETIN 211
           TSS    G+  LR A++  + 
Sbjct: 195 TSSRSGTGMPELRAAMVRLLE 215


>gi|218658399|ref|ZP_03514329.1| GTPase EngB [Rhizobium etli IE4771]
          Length = 173

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 105/136 (77%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP E+AF+GRSNVGKSSLIN LV +K LARTSN PGRTQ LN+F
Sbjct: 13  WIFIRGVPSLTFLPPEGPSEVAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYF 72

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           VP  +S    +LP MA+VDMPGYGYA+APK+ VD W  L+  YL  R+TL+ VY+LID R
Sbjct: 73  VPDGYSGEGGDLPPMAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSR 132

Query: 132 HGVKQIDQDVFSFLDK 147
           HG+K+ D+DV + LDK
Sbjct: 133 HGIKKNDEDVLTLLDK 148


>gi|115522672|ref|YP_779583.1| ribosome biogenesis GTP-binding protein YsxC [Rhodopseudomonas
           palustris BisA53]
 gi|123026147|sp|Q07TY1|ENGB_RHOP5 RecName: Full=Probable GTP-binding protein EngB
 gi|115516619|gb|ABJ04603.1| GTP-binding protein [Rhodopseudomonas palustris BisA53]
          Length = 216

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 124/200 (62%), Gaps = 9/200 (4%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+   P +  LP     E+AF+GRSNVGKSSLIN L  R  LARTS+ PGRTQ L FF
Sbjct: 21  WQFIWASPSVETLPPMQGLEVAFAGRSNVGKSSLINALTGRNGLARTSHTPGRTQELIFF 80

Query: 72  V-PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDC 130
             P D            LVDMPGYGYA APK  + SW  LI ++L  R+TL  VY+LID 
Sbjct: 81  EGPAD--------AGFRLVDMPGYGYAAAPKTKIASWTKLIHQFLQGRATLVRVYVLIDA 132

Query: 131 RHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP 190
           RHG+K +D +V + LDK AVSYQIVLTK D++ P    E +  T   +R +P A PE++ 
Sbjct: 133 RHGIKDVDNEVLTTLDKSAVSYQIVLTKADQVKPAELAERVAATTEALRKHPAAFPEIVV 192

Query: 191 TSSVKRKGIEVLRKAILETI 210
           TSS    G+  LR AI++ +
Sbjct: 193 TSSRNASGMPELRAAIIKLV 212


>gi|241762237|ref|ZP_04760319.1| GTP-binding protein HSR1-related [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241373284|gb|EER62903.1| GTP-binding protein HSR1-related [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 212

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 125/197 (63%), Gaps = 7/197 (3%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+  P +  LP    PE+AF+GRSNVGKSSLIN L NR +LAR S  PGRTQ LNFF  
Sbjct: 22  FLKSAPALEFLPAPTAPEVAFAGRSNVGKSSLINALTNRNSLARASTTPGRTQELNFF-- 79

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               ++   L  M LVDMPGYG+A+APK  V  W  LI  YL  R+ LR   +LID RHG
Sbjct: 80  ----DVGEPL-QMRLVDMPGYGFAKAPKDVVKRWKWLINDYLRGRAVLRRSLILIDSRHG 134

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D+D+   LD  A+SY++VLTK DK+     ++T++     +R +P A PE+I TSS
Sbjct: 135 IKDVDRDLMKMLDDAAISYRVVLTKSDKIKAAELEKTVKAITEEMRKHPAAFPEIIATSS 194

Query: 194 VKRKGIEVLRKAILETI 210
            K  GI  LR A+ + I
Sbjct: 195 EKGTGIAELRAAVYDAI 211


>gi|56552523|ref|YP_163362.1| ribosome biogenesis GTP-binding protein YsxC [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|260753816|ref|YP_003226709.1| ribosome biogenesis GTP-binding protein YsxC [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|13124231|sp|Q9RNL6|ENGB_ZYMMO RecName: Full=GTP-binding protein EngB; AltName: Full=GTP-binding
           protein CgpA
 gi|5932358|gb|AAD56911.1|AF180145_3 GTP-binding protein CgpA [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56544097|gb|AAV90251.1| GTP-binding protein HSR1-related protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|258553179|gb|ACV76125.1| GTP-binding protein HSR1-related [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 212

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 125/197 (63%), Gaps = 7/197 (3%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+  P +  LP    PE+AF+GRSNVGKSSLIN L NR +LAR S  PGRTQ LNFF  
Sbjct: 22  FLKSAPALEFLPAPTAPEVAFAGRSNVGKSSLINALTNRNSLARASTTPGRTQELNFF-- 79

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               ++   L  M LVDMPGYG+A+APK  V  W  LI  YL  R+ LR   +LID RHG
Sbjct: 80  ----DVGEPL-QMRLVDMPGYGFAKAPKDVVKRWKWLINDYLRGRAVLRRSLILIDSRHG 134

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D+D+   LD  A+SY++VLTK DK+     ++T++     +R +P A PE+I TSS
Sbjct: 135 IKDVDRDLMKMLDDAAISYRVVLTKSDKIKAVELEKTVKAITEEMRKHPAAFPEIIATSS 194

Query: 194 VKRKGIEVLRKAILETI 210
            K  GI  LR A+ + I
Sbjct: 195 EKGTGIAELRAAVYDAI 211


>gi|126734529|ref|ZP_01750275.1| GTP-binding protein [Roseobacter sp. CCS2]
 gi|126715084|gb|EBA11949.1| GTP-binding protein [Roseobacter sp. CCS2]
          Length = 215

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 125/193 (64%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKSSLIN +  RK LAR SN PGRTQ +NFF  
Sbjct: 29  FVKGVVAMDGLPPADRVEVCFAGRSNVGKSSLINAITGRKGLARASNTPGRTQEINFFTA 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A AP   V+ W  L+ +YL  R TLR V++LID RHG
Sbjct: 89  GD----------IYVVDLPGYGFATAPVAVVEKWQRLLKQYLQGRQTLRRVFVLIDARHG 138

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            K +D+++ S LD  AV++Q+V+TK+DKL     Q +L+KT+  +  +P A PE+I TSS
Sbjct: 139 AKAVDEEIMSLLDSSAVTFQVVMTKVDKLKGEALQASLDKTRAALAKHPAAFPELILTSS 198

Query: 194 VKRKGIEVLRKAI 206
            K  GI+ LR  I
Sbjct: 199 EKGDGIKTLRAII 211


>gi|300024924|ref|YP_003757535.1| ribosome biogenesis GTP-binding protein YsxC [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526745|gb|ADJ25214.1| ribosome biogenesis GTP-binding protein YsxC [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 221

 Score =  187 bits (475), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 96/206 (46%), Positives = 128/206 (62%), Gaps = 9/206 (4%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +FT+ AW F RG P +  LP    PEIAF+GRSNVGKSSLIN LV ++ LAR SN PGRT
Sbjct: 21  LFTR-AWTFSRGSPGLDHLPPDDRPEIAFAGRSNVGKSSLINALVGQRTLARASNTPGRT 79

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LNFF   +          + LVDMPGYG+A APK  V +W   +  +L+ R TL  V+
Sbjct: 80  QELNFFTDPNAD--------LYLVDMPGYGFAEAPKDKVAAWNKTLRSFLAGRRTLLRVF 131

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +L+D RHG+K +D ++ + LD  AVSYQ++LTK DK+S T  +     T   +  +P A+
Sbjct: 132 VLVDARHGLKPVDDEIMALLDGAAVSYQVLLTKADKISRTDLERVTANTTKSLAKHPAAY 191

Query: 186 PEVIPTSSVKRKGIEVLRKAILETIN 211
           P V+ TSS    G E LR  + + I+
Sbjct: 192 PRVLATSSETGMGFEDLRAVVAKLID 217


>gi|299132594|ref|ZP_07025789.1| ribosome biogenesis GTP-binding protein YsxC [Afipia sp. 1NLS2]
 gi|298592731|gb|EFI52931.1| ribosome biogenesis GTP-binding protein YsxC [Afipia sp. 1NLS2]
          Length = 221

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 122/199 (61%), Gaps = 2/199 (1%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F    P I  LP     EIAF+GRSNVGKSSLIN L NR  LARTS+ PGRTQ L FF
Sbjct: 21  WQFFWASPSIETLPTMQGVEIAFAGRSNVGKSSLINALTNRNGLARTSHTPGRTQELIFF 80

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
             K    L    P + LVDMPGYGYA APK  + SW  LI  +L  R+ L  VY+LID R
Sbjct: 81  --KGPGPLDARTPELRLVDMPGYGYASAPKTQIASWTKLIHNFLLGRANLARVYVLIDSR 138

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG K  D +V + LDK AVSYQIVLTK D++     +ET+      +R +P A PE++ T
Sbjct: 139 HGFKDADNEVLTTLDKAAVSYQIVLTKADQVKKAALEETMAAMAEKLRKHPAAFPEMLVT 198

Query: 192 SSVKRKGIEVLRKAILETI 210
           SS    G+  +R AI++ +
Sbjct: 199 SSRDGGGMAEMRAAIVKLL 217


>gi|310816970|ref|YP_003964934.1| GTP-binding protein HSR1-related protein [Ketogulonicigenium
           vulgare Y25]
 gi|308755705|gb|ADO43634.1| GTP-binding protein HSR1-related protein [Ketogulonicigenium
           vulgare Y25]
          Length = 216

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/193 (49%), Positives = 123/193 (63%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   EI F+GRSNVGKSSLIN L  RK+LAR SN PGRTQ LNFF  
Sbjct: 29  FVKGVVAMSGLPPADRVEICFAGRSNVGKSSLINALTGRKSLARASNTPGRTQELNFFAL 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            +VD+PGYGYA AP   V+ W  L+  YLS R TLR  ++LID RHG
Sbjct: 89  GE---------DRYMVDLPGYGYANAPLAVVEKWQKLLKSYLSGRQTLRRAFVLIDSRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D ++ + LDK AV++Q+V+TK DK+S        E+ K  ++ +P A+PEV+ TSS
Sbjct: 140 VKSVDDEIMNLLDKSAVTFQVVMTKADKVSKAELAANFEQVKGALKKHPAAYPEVVLTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K  GIE LR  I
Sbjct: 200 EKGDGIETLRAII 212


>gi|304322174|ref|YP_003855817.1| GTP-binding protein [Parvularcula bermudensis HTCC2503]
 gi|303301076|gb|ADM10675.1| GTP-binding protein [Parvularcula bermudensis HTCC2503]
          Length = 213

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 123/193 (63%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ GV  +  LP    PE AF+GRSNVGKSSLIN L  RK LARTSN PGRT+ LNFF  
Sbjct: 24  FMLGVTTMAALPPPDLPEFAFAGRSNVGKSSLINRLTGRKALARTSNTPGRTRELNFF-- 81

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               +L   L    LVD+PGYGYA+A +  V+SW GL   +L  R  LR V++L+D RHG
Sbjct: 82  ----DLGGRL---RLVDLPGYGYAKASRSAVESWTGLTRDFLRGRPNLRRVHILVDSRHG 134

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D++  S LD+ AV YQ+VLTKIDK+ PT A   ++     I   P AHP++I TSS
Sbjct: 135 LKPVDEETMSLLDESAVPYQLVLTKIDKIKPTEAARRIKAVGEAIGRRPAAHPDIIATSS 194

Query: 194 VKRKGIEVLRKAI 206
               GI  LR+ +
Sbjct: 195 ETGDGIAALREGM 207


>gi|209886641|ref|YP_002290498.1| GTP-binding protein [Oligotropha carboxidovorans OM5]
 gi|229813297|sp|B6JJN9|ENGB_OLICO RecName: Full=Probable GTP-binding protein EngB
 gi|209874837|gb|ACI94633.1| GTP-binding protein [Oligotropha carboxidovorans OM5]
          Length = 221

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 122/199 (61%), Gaps = 2/199 (1%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F    P I  LP     EIA +GRSNVGKSSLIN L  R  LARTS+ PGRTQ L FF
Sbjct: 21  WQFFWASPSIETLPPMQGIEIALAGRSNVGKSSLINALTGRNALARTSHTPGRTQELIFF 80

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
             K    L    P + LVDMPGYGYA APK  + SW  LI RYL  R+ L  VY+LID R
Sbjct: 81  --KGPGPLDAQTPELRLVDMPGYGYASAPKTKIASWTTLIHRYLLGRANLARVYVLIDSR 138

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG K  D +V + LDK AVSYQIVLTK D++  +   ET+      +R +P A+PE++ T
Sbjct: 139 HGFKDADDEVLTTLDKSAVSYQIVLTKTDQVKKSALDETMAAMAEKLRKHPAAYPEMLVT 198

Query: 192 SSVKRKGIEVLRKAILETI 210
           SS    G+  +R AI++ +
Sbjct: 199 SSRDGAGMAEMRAAIVKLL 217


>gi|92119159|ref|YP_578888.1| ribosome biogenesis GTP-binding protein YsxC [Nitrobacter
           hamburgensis X14]
 gi|119369222|sp|Q1QH69|ENGB_NITHX RecName: Full=Probable GTP-binding protein EngB
 gi|91802053|gb|ABE64428.1| GTP-binding protein [Nitrobacter hamburgensis X14]
          Length = 217

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/201 (49%), Positives = 124/201 (61%), Gaps = 9/201 (4%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+   P I  LP     E+AF+GRSNVGKSSLIN L  R  LARTS  PGRTQ L FF
Sbjct: 21  WQFIWASPSIETLPPMAGVEVAFAGRSNVGKSSLINALTGRGTLARTSRTPGRTQELIFF 80

Query: 72  V-PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDC 130
             PKD          + LVDMPGYG+A APK  + SW  LI ++L  R++L  VY+LID 
Sbjct: 81  EGPKDAD--------VRLVDMPGYGFASAPKARIASWTSLIHKFLLGRASLARVYVLIDS 132

Query: 131 RHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP 190
           RHG+K IDQ + + LD+ AVSYQIVLTK D++  T   E  E T+ L+  +P A P+V+ 
Sbjct: 133 RHGIKDIDQAILTTLDRSAVSYQIVLTKADEVKATEMAERTEATRTLLAKHPAAFPDVLV 192

Query: 191 TSSVKRKGIEVLRKAILETIN 211
           TSS    G+  LR A+   I 
Sbjct: 193 TSSRTGYGVPELRAAMARLIG 213


>gi|84515674|ref|ZP_01003035.1| GTP-binding protein [Loktanella vestfoldensis SKA53]
 gi|84510116|gb|EAQ06572.1| GTP-binding protein [Loktanella vestfoldensis SKA53]
          Length = 215

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 125/193 (64%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKSSLIN L  RK LAR SN PGRTQ +NFF  
Sbjct: 29  FVKGVVAMDGLPPADRIEVCFAGRSNVGKSSLINALTGRKGLARASNTPGRTQEINFFTA 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A AP   V+ W  L+ +YL  R TLR V++LID RHG
Sbjct: 89  GD----------IYVVDLPGYGFANAPVAVVEKWQRLLKQYLQGRQTLRRVFVLIDARHG 138

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            K +D+++ S LD  AV++Q+V+TK+DKL      E+L KT+  +  +P A+PE+I TS+
Sbjct: 139 AKAVDEEIMSLLDASAVTFQVVMTKVDKLRGDALAESLAKTRAALVKHPAAYPELILTSA 198

Query: 194 VKRKGIEVLRKAI 206
            K +GI  LR  I
Sbjct: 199 EKGEGIPTLRAII 211


>gi|126463487|ref|YP_001044601.1| ribosome biogenesis GTP-binding protein YsxC [Rhodobacter
           sphaeroides ATCC 17029]
 gi|332559540|ref|ZP_08413862.1| GTP-binding protein YsxC [Rhodobacter sphaeroides WS8N]
 gi|126105151|gb|ABN77829.1| GTP-binding protein, HSR1-related [Rhodobacter sphaeroides ATCC
           17029]
 gi|332277252|gb|EGJ22567.1| GTP-binding protein YsxC [Rhodobacter sphaeroides WS8N]
          Length = 217

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 128/193 (66%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKSSLIN L  RK+LAR SN PGRTQ +N+F  
Sbjct: 30  FVKGVTTMEALPPADRIEVCFAGRSNVGKSSLINALTGRKSLARASNTPGRTQEINYFAL 89

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P+  LVD+PGYGYA APK  V+ W  L+  YL+ R TLR  ++LID RHG
Sbjct: 90  G---------PSRYLVDLPGYGYAEAPKPIVERWQRLLKGYLAGRQTLRRAFVLIDTRHG 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D+++ + LD+ AV++Q+V+TK DK+S    +  L++ +  ++ +P A+PE++ TSS
Sbjct: 141 VKSVDEEILTLLDRSAVTFQVVMTKADKVSQAEREAVLDQVRGALKKHPAAYPELVMTSS 200

Query: 194 VKRKGIEVLRKAI 206
            K  GIE LR  +
Sbjct: 201 EKGMGIETLRTIV 213


>gi|148258512|ref|YP_001243097.1| ribosome biogenesis GTP-binding protein YsxC [Bradyrhizobium sp.
           BTAi1]
 gi|146410685|gb|ABQ39191.1| putative GTP-binding protein engB [Bradyrhizobium sp. BTAi1]
          Length = 220

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 127/197 (64%), Gaps = 8/197 (4%)

Query: 11  AWIFLRGVPEIGLLP-KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLN 69
           AW F    P I  LP  +G  EIAF+GRSNVGKSSLIN L  +  LARTS+ PGRTQ L 
Sbjct: 22  AWRFTHASPSIASLPPMSGQIEIAFAGRSNVGKSSLINALTGQNALARTSHTPGRTQELI 81

Query: 70  FFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLID 129
           FF   D++ L+       LVDMPGYGYA A K  V SW  LI ++L  R++L  VY+LID
Sbjct: 82  FFEGPDYAPLR-------LVDMPGYGYAAAAKTKVASWTKLIHQFLLGRASLARVYVLID 134

Query: 130 CRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVI 189
            RHG+K++DQ++F  LD+ AVSYQ+VLTK D++ P      + +T+  +  +P A P+V+
Sbjct: 135 ARHGLKEVDQEIFKTLDRSAVSYQLVLTKADQVKPPELAARIAETEAALAKHPAAFPQVL 194

Query: 190 PTSSVKRKGIEVLRKAI 206
            TSS    G+  LR A+
Sbjct: 195 ATSSRSGTGMPELRAAM 211


>gi|158425674|ref|YP_001526966.1| ribosome biogenesis GTP-binding protein YsxC [Azorhizobium
           caulinodans ORS 571]
 gi|158332563|dbj|BAF90048.1| GTP-binding protein [Azorhizobium caulinodans ORS 571]
          Length = 223

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 119/200 (59%), Gaps = 9/200 (4%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+   P + +LP     EIA  GRSNVGKSSL+N L  R  LARTS  PGRTQ L FF
Sbjct: 30  WKFVTAAPTVDVLPPMQGVEIALVGRSNVGKSSLVNALTGRTALARTSVTPGRTQELIFF 89

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                      +P M LVDMPGYG+A+APK  VD+W   I  YL  R  L  V++LID R
Sbjct: 90  ---------RCVPEMMLVDMPGYGFAKAPKDKVDAWVATIRAYLRGRVNLARVFVLIDAR 140

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K +D ++   LDK AVSY IVLTK D++  T  +  +  TK  IR  P A PEV PT
Sbjct: 141 HGIKPVDAEILDLLDKAAVSYAIVLTKSDQVKRTDLEAVIADTKDKIRRRPAAFPEVFPT 200

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS   KG+  LR AI   I+
Sbjct: 201 SSHGGKGLAELRAAIARIID 220


>gi|221640559|ref|YP_002526821.1| ribosome biogenesis GTP-binding protein YsxC [Rhodobacter
           sphaeroides KD131]
 gi|221161340|gb|ACM02320.1| GTP-binding protein engB [Rhodobacter sphaeroides KD131]
          Length = 217

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 127/193 (65%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKSSLIN L  RK LAR SN PGRTQ +N+F  
Sbjct: 30  FVKGVTTMEALPPADRIEVCFAGRSNVGKSSLINALTGRKALARASNTPGRTQEINYFAL 89

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P+  LVD+PGYGYA APK  V+ W  L+  YL+ R TLR  ++LID RHG
Sbjct: 90  G---------PSRYLVDLPGYGYAEAPKPIVERWQRLLKGYLAGRQTLRRAFVLIDTRHG 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D+++ + LD+ AV++Q+V+TK DK+S    +  L++ +  ++ +P A+PE++ TSS
Sbjct: 141 VKSVDEEILTLLDRSAVTFQVVMTKADKVSQAEREAVLDQVRGALKKHPAAYPELVMTSS 200

Query: 194 VKRKGIEVLRKAI 206
            K  GIE LR  +
Sbjct: 201 EKGMGIETLRTIV 213


>gi|77464647|ref|YP_354151.1| ribosome biogenesis GTP-binding protein YsxC [Rhodobacter
           sphaeroides 2.4.1]
 gi|119369248|sp|Q3IYY4|ENGB_RHOS4 RecName: Full=Probable GTP-binding protein EngB
 gi|77389065|gb|ABA80250.1| Probable GTP-binding protein [Rhodobacter sphaeroides 2.4.1]
          Length = 217

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 126/193 (65%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKSSLIN L  RK LAR SN PGRTQ +N+F  
Sbjct: 30  FVKGVTTMEALPPADRIEVCFAGRSNVGKSSLINALTGRKALARASNTPGRTQEINYFAL 89

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P+  LVD+PGYGYA APK  V  W  L+  YL+ R TLR  ++LID RHG
Sbjct: 90  G---------PSRYLVDLPGYGYAEAPKPIVQRWQRLLKGYLAGRQTLRRAFVLIDTRHG 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D+++ + LD+ AV++Q+V+TK DK+S    +  L++ +  ++ +P A+PE++ TSS
Sbjct: 141 VKSVDEEILTLLDRSAVTFQVVMTKADKVSQAEREAVLDQVRGALKKHPAAYPELVMTSS 200

Query: 194 VKRKGIEVLRKAI 206
            K  GIE LR  +
Sbjct: 201 EKGMGIETLRTIV 213


>gi|87198603|ref|YP_495860.1| GTPase EngB [Novosphingobium aromaticivorans DSM 12444]
 gi|119369226|sp|Q2GAU7|ENGB_NOVAD RecName: Full=Probable GTP-binding protein EngB
 gi|87134284|gb|ABD25026.1| GTP-binding protein [Novosphingobium aromaticivorans DSM 12444]
          Length = 217

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 95/195 (48%), Positives = 125/195 (64%), Gaps = 7/195 (3%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+  P +  LP    PEIAF+GRSNVGKSSL+N L  RK+LARTS  PGRTQ LN+F  
Sbjct: 26  FLKSAPALKFLPDPDVPEIAFAGRSNVGKSSLLNALTGRKSLARTSVTPGRTQELNYFEV 85

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            + + L+       LVDMPGYG+A+AP K V++W  L+  +L  R  L+   LLID RHG
Sbjct: 86  GEPTRLR-------LVDMPGYGFAKAPPKVVETWRRLVRDFLRGRVVLKRTLLLIDSRHG 138

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D D+   LD+  V Y+IVLTK DK+  +  ++   +T    R    A+PE+I TSS
Sbjct: 139 VKPVDDDMMQMLDEAGVGYRIVLTKADKIKASELEKVTAETIAAARKRTAAYPEIIVTSS 198

Query: 194 VKRKGIEVLRKAILE 208
            K+ GIE LR A+L+
Sbjct: 199 EKKMGIEELRAAVLQ 213


>gi|146278899|ref|YP_001169058.1| ribosome biogenesis GTP-binding protein YsxC [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145557140|gb|ABP71753.1| GTP-binding protein, HSR1-related [Rhodobacter sphaeroides ATCC
           17025]
          Length = 217

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/197 (46%), Positives = 127/197 (64%), Gaps = 9/197 (4%)

Query: 10  SAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLN 69
            A  F++GV  +  LP A   E+ F+GRSNVGKSSLIN L  RK LAR SN PGRTQ +N
Sbjct: 26  GACDFVKGVTTMEALPPADRIEVCFAGRSNVGKSSLINALTGRKALARASNTPGRTQEIN 85

Query: 70  FFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLID 129
           +F            P+  LVD+PGYGYA APK  V+ W  L+  YL+ R TLR  ++LID
Sbjct: 86  YFALG---------PSRYLVDLPGYGYAEAPKPIVERWQRLLKGYLAGRQTLRRAFVLID 136

Query: 130 CRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVI 189
            RHG+K +D+++ + LD+ AV++Q+V+TK DK+S    +  L + +  ++ +P A+PE++
Sbjct: 137 TRHGIKSVDEEILNLLDRSAVTFQVVMTKADKVSQAEREAVLGQVRGALKKHPAAYPELV 196

Query: 190 PTSSVKRKGIEVLRKAI 206
            TSS K  GIE LR  I
Sbjct: 197 MTSSEKGLGIETLRTII 213


>gi|86135822|ref|ZP_01054401.1| GTP-binding protein [Roseobacter sp. MED193]
 gi|85826696|gb|EAQ46892.1| GTP-binding protein [Roseobacter sp. MED193]
          Length = 216

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 121/194 (62%), Gaps = 9/194 (4%)

Query: 13  IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           +F++GV  +  LP A   E+ F+GRSNVGKSSLIN L   K LAR SN PGRTQ +N+F 
Sbjct: 28  LFVKGVVAMSGLPDADRMEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINYFT 87

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
                      P + LVD+PGYGYA AP   V+ W  L+ RYLS R TLR  ++LID RH
Sbjct: 88  QG---------PELYLVDLPGYGYANAPLAVVEKWQKLLKRYLSGRQTLRRAFVLIDSRH 138

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
           GVK +D+++ S LD  AV++Q V+TK DK+        +E+ +  +  +P A+PE++ TS
Sbjct: 139 GVKDVDEEIMSLLDSSAVTFQCVMTKADKVKIKDRDRVIEQVRTALARHPAAYPEIVLTS 198

Query: 193 SVKRKGIEVLRKAI 206
           S K  GI  LR  I
Sbjct: 199 SEKGDGIATLRSII 212


>gi|126737053|ref|ZP_01752788.1| GTP-binding protein [Roseobacter sp. SK209-2-6]
 gi|126721638|gb|EBA18341.1| GTP-binding protein [Roseobacter sp. SK209-2-6]
          Length = 216

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 123/193 (63%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP+A   E+ F+GRSNVGKSSLIN L   K LAR SN PGRTQ +N+F  
Sbjct: 29  FVKGVVAMSGLPEADRMEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINYF-- 86

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P + LVD+PGYGYA AP   V+ W  L+ RYLS R TLR  ++LID RHG
Sbjct: 87  -------TQGPDLFLVDLPGYGYANAPLPVVEKWQKLLKRYLSGRQTLRRAFVLIDSRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK++D+++   LD  AV++Q V+TK DK+     ++ LE+ +  +  +P A+PE++ TSS
Sbjct: 140 VKEVDEEIMKLLDSAAVTFQCVMTKADKVKVKDREKVLEQVRKALARHPAAYPEIVLTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 200 EKGDGIATLRALI 212


>gi|149913106|ref|ZP_01901640.1| GTP-binding protein [Roseobacter sp. AzwK-3b]
 gi|149813512|gb|EDM73338.1| GTP-binding protein [Roseobacter sp. AzwK-3b]
          Length = 216

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 122/193 (63%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+GV  +  LP A   E+ F+GRSNVGKSSLIN L  RK +AR SN PGRTQ +NFF  
Sbjct: 29  FLKGVVAMSGLPPADRIEVCFAGRSNVGKSSLINALTGRKAIARASNTPGRTQEINFFAL 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +         +  LVD+PGYGYA AP   V +W  L+ +YLS R +LR  ++L+D RHG
Sbjct: 89  GE---------SHYLVDLPGYGYANAPLDKVAAWQALLKKYLSGRQSLRRAFVLVDTRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D+++ S LD  AV++Q VLTK DK+     +  LE+ +  +  +P A+PE+I TSS
Sbjct: 140 IKSVDEEIMSLLDSSAVTFQCVLTKADKVKDKDREAVLEQVRAKLAKHPAAYPEIIMTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 200 EKGDGIATLRAVI 212


>gi|27383210|ref|NP_774739.1| ribosome biogenesis GTP-binding protein YsxC [Bradyrhizobium
           japonicum USDA 110]
 gi|81734112|sp|Q89BP9|ENGB_BRAJA RecName: Full=Probable GTP-binding protein EngB
 gi|27356384|dbj|BAC53364.1| GTP-binding protein [Bradyrhizobium japonicum USDA 110]
          Length = 217

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 95/195 (48%), Positives = 122/195 (62%), Gaps = 7/195 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+   P I  LP     EIAF+GRSNVGKSSLIN L  R  LARTS+ PGRTQ L FF
Sbjct: 21  WQFIWASPSIQTLPPMDGVEIAFAGRSNVGKSSLINALTGRNALARTSHTPGRTQELIFF 80

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                 +L+       LVDMPGYGYA+APK  V SW  LI ++L  R++L  VY+LID R
Sbjct: 81  EVPGKKDLR-------LVDMPGYGYAKAPKSQVASWTELIHKFLLGRASLARVYVLIDAR 133

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K +D ++   LD+ AVSYQIVLTK D++ P+     + +T+  +  +P A P V+ T
Sbjct: 134 HGLKDVDLEILGTLDRSAVSYQIVLTKADQVKPSELASRIAETEAALAKHPAAFPNVLAT 193

Query: 192 SSVKRKGIEVLRKAI 206
           SS    G+  LR A+
Sbjct: 194 SSRSATGMAELRAAM 208


>gi|144899246|emb|CAM76110.1| GTP-binding protein [Magnetospirillum gryphiswaldense MSR-1]
          Length = 193

 Score =  181 bits (460), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 100/197 (50%), Positives = 124/197 (62%), Gaps = 9/197 (4%)

Query: 15  LRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPK 74
           +RG  ++  LP  G PE+AF+GRSNVGKSSLIN L  R  +ARTSN PGRTQ LNFF   
Sbjct: 1   MRGAVDLETLPPFGLPELAFAGRSNVGKSSLINALCGRSTVARTSNTPGRTQELNFF--- 57

Query: 75  DFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGV 134
           D +        + LVDMPGYG+A APK  VD+W  LI  +L  R TLR   LL+D RHG+
Sbjct: 58  DVNG------RLILVDMPGYGFASAPKDKVDAWTRLIKGFLRGRPTLRRCILLVDSRHGL 111

Query: 135 KQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSV 194
           K  D+++   LDK AV YQ+VLTKIDKL+    +   E+T+  I     A+P +I TSS 
Sbjct: 112 KDNDREMMDMLDKAAVVYQVVLTKIDKLNAAEVKAVQERTQAEISKRVAAYPTLILTSSE 171

Query: 195 KRKGIEVLRKAILETIN 211
           K  GI  LR  IL+  N
Sbjct: 172 KGIGIPELRAEILQLAN 188


>gi|119383630|ref|YP_914686.1| GTPase EngB [Paracoccus denitrificans PD1222]
 gi|119373397|gb|ABL68990.1| small GTP-binding protein [Paracoccus denitrificans PD1222]
          Length = 216

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 91/198 (45%), Positives = 127/198 (64%), Gaps = 10/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+GV  +  LP A  PE+ F+GRSN GKSSLIN L  RK+LAR SN PGRTQ +N+F  
Sbjct: 29  FLKGVVAMDGLPPADRPEVCFAGRSNAGKSSLINALTGRKSLARASNTPGRTQEINYFTL 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            + + L         VD+PGYG+A+AP   V  W  L+  YLS R TLR  + LID RHG
Sbjct: 89  GERAYL---------VDLPGYGFAKAPVAVVAKWQALLKNYLSGRPTLRRAFTLIDSRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D ++   LD+ AV +Q+VLTK DK+     + T+ + +  ++ +P A+PE++ TSS
Sbjct: 140 VKDVDHEIMKLLDRSAVPFQVVLTKADKIGAQAMEATVAQVQEALQKHPAAYPELVITSS 199

Query: 194 VKRKGIEVLRKAILETIN 211
            K +GI  LR AI+ +++
Sbjct: 200 EKGQGIATLR-AIIASLD 216


>gi|259415701|ref|ZP_05739621.1| ribosome biogenesis GTP-binding protein YsxC [Silicibacter sp.
           TrichCH4B]
 gi|259347140|gb|EEW58917.1| ribosome biogenesis GTP-binding protein YsxC [Silicibacter sp.
           TrichCH4B]
          Length = 216

 Score =  181 bits (458), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 122/193 (63%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+GV  +  LP A   E+ F+GRSNVGKSSLIN L   K LAR SN PGRTQ +NFF  
Sbjct: 29  FLKGVVAMSGLPPADRIEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINFF-- 86

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P + LVD+PGYGYA AP   V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 87  -------TQGPELYLVDLPGYGYANAPLAVVEKWQRLLKQYLSGRQTLRRAFVLIDTRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK++D+++   LD  AV++Q+V+TK DK+      + L++ +  +  +P A+PE++ TSS
Sbjct: 140 VKKVDEEIMKLLDSAAVTFQVVMTKADKVKEKDRAKILDQVRDALSKHPAAYPEIVLTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 200 EKGDGIATLRSII 212


>gi|99080146|ref|YP_612300.1| ribosome biogenesis GTP-binding protein YsxC [Ruegeria sp. TM1040]
 gi|119369260|sp|Q1GJX8|ENGB_SILST RecName: Full=Probable GTP-binding protein EngB
 gi|99036426|gb|ABF63038.1| GTP-binding [Ruegeria sp. TM1040]
          Length = 216

 Score =  181 bits (458), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 122/193 (63%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+GV  +  LP A   E+ F+GRSNVGKSSLIN L   K LAR SN PGRTQ +NFF  
Sbjct: 29  FLKGVVAMSGLPPADRIEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINFF-- 86

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P + LVD+PGYGYA AP   V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 87  -------TQGPELYLVDLPGYGYANAPLAVVEKWQRLLKQYLSGRQTLRRAFVLIDTRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK++D+++   LD  AV++Q+V+TK DK+      + L++ +  +  +P A+PE++ TSS
Sbjct: 140 VKKVDEEIMKLLDTSAVTFQVVMTKADKVKEKDRAKILDQVRDALSKHPAAYPEIVLTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 200 EKGDGIATLRSII 212


>gi|315498840|ref|YP_004087644.1| ribosome biogenesis gtp-binding protein ysxc [Asticcacaulis
           excentricus CB 48]
 gi|315416852|gb|ADU13493.1| ribosome biogenesis GTP-binding protein YsxC [Asticcacaulis
           excentricus CB 48]
          Length = 231

 Score =  180 bits (457), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 99/208 (47%), Positives = 126/208 (60%), Gaps = 10/208 (4%)

Query: 2   VSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNA 61
            +  +F + A  F+ G  +I  LP A  PE+ F+GRSNVGKSSLIN LV + +LAR SN 
Sbjct: 29  AARVLFARPA-TFMMGAAKIEQLPAADLPEVTFAGRSNVGKSSLINALVGQNHLARASNE 87

Query: 62  PGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTL 121
           PGRT+ +NFFV  +          + LVD+PGYG+A+A K  V  +  L   YL  R  L
Sbjct: 88  PGRTREVNFFVLDE---------KLRLVDLPGYGWAKASKAEVKKFQNLGRDYLRGRPNL 138

Query: 122 RCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY 181
           +  YLLID RHG+K +D +    LD  AVSYQIVLTK DK+ P   +  +EKT+  IR  
Sbjct: 139 KRAYLLIDARHGLKAVDNEPMDALDVAAVSYQIVLTKADKIKPHELKAVIEKTQAQIRKR 198

Query: 182 PTAHPEVIPTSSVKRKGIEVLRKAILET 209
           P AHP V+ TSS K  GI  LR  I+ T
Sbjct: 199 PAAHPVVLATSSEKGHGIPELRAEIMTT 226


>gi|89068161|ref|ZP_01155578.1| GTP-binding protein [Oceanicola granulosus HTCC2516]
 gi|89046400|gb|EAR52457.1| GTP-binding protein [Oceanicola granulosus HTCC2516]
          Length = 218

 Score =  180 bits (457), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/198 (45%), Positives = 125/198 (63%), Gaps = 10/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A  PE+ F+GRSNVGKS+LIN L  RK LAR SN PGRTQ +N+F  
Sbjct: 31  FVKGVVAMSGLPGADRPEVCFAGRSNVGKSTLINALTGRKALARASNTPGRTQEINYFAL 90

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D         +  LVD+PGYG+A AP   V  W  L+ +YL  R TLR  ++LID RHG
Sbjct: 91  AD---------SHYLVDLPGYGFANAPVAVVAKWQALLKQYLQGRQTLRRAFVLIDARHG 141

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            K +D+++ + LD  AV++Q VLTK DK+  +     L++ +  +  +P A+PE++ TSS
Sbjct: 142 AKAVDEEIMALLDSAAVTFQCVLTKADKIKASERDRVLDQVRATLARHPAAYPEIVLTSS 201

Query: 194 VKRKGIEVLRKAILETIN 211
            K  GIE LR AI+  I+
Sbjct: 202 EKGDGIETLR-AIVAGID 218


>gi|84499799|ref|ZP_00998087.1| GTP-binding protein [Oceanicola batsensis HTCC2597]
 gi|84392943|gb|EAQ05154.1| GTP-binding protein [Oceanicola batsensis HTCC2597]
          Length = 216

 Score =  180 bits (457), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 124/193 (64%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKSSLIN L   +NLAR SN PGRTQ +N+F  
Sbjct: 29  FVKGVVAMDGLPPADRMEVCFAGRSNVGKSSLINALTGTRNLARASNTPGRTQEINYFTL 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D   L         VD+PGYGYA AP   V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 89  GDRGYL---------VDLPGYGYANAPLPVVEKWQRLLRQYLSGRQTLRRAFVLIDARHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK++D+++ S LD  AV++++VLTKIDK+  +     L+ T+  +  +P A+PE++ TSS
Sbjct: 140 VKKVDEEIMSLLDSAAVTFEVVLTKIDKVRRSDLDRALDVTRSALSKHPAAYPELVLTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 200 EKGDGIATLRSII 212


>gi|56695444|ref|YP_165792.1| ribosome biogenesis GTP-binding protein YsxC [Ruegeria pomeroyi
           DSS-3]
 gi|81558731|sp|Q5LW13|ENGB_SILPO RecName: Full=Probable GTP-binding protein EngB
 gi|56677181|gb|AAV93847.1| GTP-binding protein [Ruegeria pomeroyi DSS-3]
          Length = 217

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 119/193 (61%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKSSLIN L   K LAR SN PGRTQ +NFF  
Sbjct: 30  FVKGVVAMSGLPPADRVEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINFF-- 87

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P + LVD+PGYGYA AP K V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 88  -------TQGPELYLVDLPGYGYANAPLKVVEKWQKLLKQYLSGRQTLRRAFVLIDARHG 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D ++   LD  AV++Q VLTK DK+      + L + +  +  +P A+PE++ TSS
Sbjct: 141 VKAVDDEIMKLLDTSAVTFQCVLTKADKVKAAERDKVLAQVRAALAKHPAAYPEIVLTSS 200

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 201 EKGDGIATLRSII 213


>gi|75677252|ref|YP_319673.1| GTPase EngB [Nitrobacter winogradskyi Nb-255]
 gi|119369225|sp|Q3SN20|ENGB_NITWN RecName: Full=Probable GTP-binding protein EngB
 gi|74422122|gb|ABA06321.1| GTPase [Nitrobacter winogradskyi Nb-255]
          Length = 217

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 123/200 (61%), Gaps = 7/200 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+   P I  LP     E+AF+GRSNVGKSSLIN L  R  LARTS  PGRTQ L FF
Sbjct: 21  WQFIWASPSIETLPPMSGLEVAFAGRSNVGKSSLINALTGRSALARTSRTPGRTQELIFF 80

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                 +++       LVDMPGYG+A APK  + SW  LI ++L  R+TL  VY+LID R
Sbjct: 81  EGPKGVDVR-------LVDMPGYGFASAPKARIASWTSLIHQFLLGRATLARVYVLIDAR 133

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K ID+ V   LD+ AVSYQ+VLTK D++  T   E ++ T+  + ++P A P+V+ T
Sbjct: 134 HGIKDIDKTVLGALDRSAVSYQVVLTKADEVKVTEMAERIDITRTQLASHPAAFPDVLVT 193

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS    GI  LR A+   I 
Sbjct: 194 SSRTGNGIPELRAAMARLIG 213


>gi|307943176|ref|ZP_07658521.1| ribosome biogenesis GTP-binding protein YsxC [Roseibium sp.
           TrichSKD4]
 gi|307773972|gb|EFO33188.1| ribosome biogenesis GTP-binding protein YsxC [Roseibium sp.
           TrichSKD4]
          Length = 215

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 97/195 (49%), Positives = 121/195 (62%), Gaps = 8/195 (4%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F   V E+  LP++   EIAF+GRSNVGKSSLIN L  RK LARTS+ PGRTQ LNFF
Sbjct: 23  WTFQTSVTEMVNLPESADTEIAFAGRSNVGKSSLINALTGRKGLARTSSTPGRTQMLNFF 82

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
              D          + +VDMPGYGYA+APK  VD+W  L+  YL  R  LR V+LLID R
Sbjct: 83  HAPD--------TPITIVDMPGYGYAQAPKGLVDAWTKLVFSYLRGRPNLRRVFLLIDSR 134

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K+ D +    LDK AV YQ+VLTK DK+      + L  T+  +     A+PE+I T
Sbjct: 135 HGLKKNDLETMDLLDKAAVVYQVVLTKSDKIKKPQLAKLLTDTQTALAKRIAAYPEIIAT 194

Query: 192 SSVKRKGIEVLRKAI 206
           SS K   I++L+  I
Sbjct: 195 SSEKDLCIDLLKAEI 209


>gi|159042882|ref|YP_001531676.1| ribosome biogenesis GTP-binding protein YsxC [Dinoroseobacter
           shibae DFL 12]
 gi|157910642|gb|ABV92075.1| GTP-binding protein [Dinoroseobacter shibae DFL 12]
          Length = 217

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 120/193 (62%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+GV  +  LP A   E+ F+GRSNVGKSSLIN L  RK LARTSN PGRTQ +N+F  
Sbjct: 30  FLKGVVAMSGLPPADRLEVCFAGRSNVGKSSLINALTGRKALARTSNTPGRTQEINYFCL 89

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +   L         VD+PGYG+A AP   V  W  L+  YL+ R TLR  ++LID RHG
Sbjct: 90  GEDRYL---------VDVPGYGFAEAPVAVVQKWQALLKAYLTGRPTLRRAFVLIDARHG 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D ++ S LD  AV++Q+VLTK DK+      +TL + +  +  +P A PE++ TSS
Sbjct: 141 IKAVDHEIMSLLDTAAVTFQVVLTKADKIKTAEQDKTLAQVRKELARHPAAFPELLLTSS 200

Query: 194 VKRKGIEVLRKAI 206
            K  GIE LR  +
Sbjct: 201 AKGDGIETLRATV 213


>gi|83854935|ref|ZP_00948465.1| GTP-binding protein [Sulfitobacter sp. NAS-14.1]
 gi|83941458|ref|ZP_00953920.1| GTP-binding protein [Sulfitobacter sp. EE-36]
 gi|83842778|gb|EAP81945.1| GTP-binding protein [Sulfitobacter sp. NAS-14.1]
 gi|83847278|gb|EAP85153.1| GTP-binding protein [Sulfitobacter sp. EE-36]
          Length = 216

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 93/199 (46%), Positives = 126/199 (63%), Gaps = 10/199 (5%)

Query: 13  IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           +F++GV  +  LP A   E+ F+GRSNVGKS+LIN L   K LAR SN PGRTQ +N+F 
Sbjct: 28  LFVKGVVAMDGLPPADRMEVCFAGRSNVGKSTLINALTGTKALARASNTPGRTQEINYFT 87

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
             D   L         VD+PGYGYA AP   V+ W  L+ +YLS R TLR  ++LID RH
Sbjct: 88  AADDHYL---------VDLPGYGYANAPLPVVEKWQRLLKQYLSGRQTLRRAFVLIDARH 138

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
           GVK++D ++ S LD  AV++Q VLTK DK+     Q+ L++ +  +  +P A+PE++ TS
Sbjct: 139 GVKKVDDEIMSLLDSSAVTFQCVLTKADKVKEVERQKVLDQVRGALAKHPAAYPEIVVTS 198

Query: 193 SVKRKGIEVLRKAILETIN 211
           S K  GI  LR AI+ T+ 
Sbjct: 199 SEKGWGIPTLR-AIIATLE 216


>gi|149203000|ref|ZP_01879971.1| GTP-binding protein [Roseovarius sp. TM1035]
 gi|149143546|gb|EDM31582.1| GTP-binding protein [Roseovarius sp. TM1035]
          Length = 216

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 122/193 (63%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKSSLIN L  RK LAR SN PGRTQ +NFF  
Sbjct: 29  FVKGVVAMSGLPPADRLEVCFAGRSNVGKSSLINALTGRKALARASNTPGRTQEINFFAL 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +         +  LVD+PGYGYA AP   V  W  L+ +YLS R TLR  ++L+D RHG
Sbjct: 89  GE---------SHYLVDLPGYGYANAPLAVVQKWQALLKQYLSGRQTLRRAFVLVDARHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D+++ S LD  AV++Q VLTK DK++       L++ +  +  +P A+PE+I TSS
Sbjct: 140 IKTVDEEIMSLLDASAVTFQCVLTKTDKINAADRDRVLDQVRAKLAPHPAAYPELILTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K +G+  LR  I
Sbjct: 200 EKSEGLATLRATI 212


>gi|110678769|ref|YP_681776.1| ribosome biogenesis GTP-binding protein YsxC [Roseobacter
           denitrificans OCh 114]
 gi|119369250|sp|Q16AA3|ENGB_ROSDO RecName: Full=Probable GTP-binding protein EngB
 gi|109454885|gb|ABG31090.1| GTP-binding protein [Roseobacter denitrificans OCh 114]
          Length = 216

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 124/195 (63%), Gaps = 9/195 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP     E+ F+GRSNVGKSSLIN L  RK LAR SN PGRTQ +NFF  
Sbjct: 29  FVKGVVAMSGLPDPDRLEVCFAGRSNVGKSSLINALTGRKGLARASNTPGRTQEINFFTA 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +         +  LVD+PGYGYA AP   V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 89  GE---------SHYLVDLPGYGYANAPVPVVEKWQRLLKQYLSGRQTLRRAFVLIDARHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK++D+++ S LD  AV++Q+VLTK DK+     ++ L++ +  +  +P A PE++ TSS
Sbjct: 140 VKKVDEEILSLLDSAAVTFQVVLTKADKVKEKEREKVLDQVRTALSKHPAAFPELVITSS 199

Query: 194 VKRKGIEVLRKAILE 208
            K  GI  LR  I +
Sbjct: 200 EKGWGIPTLRSIITD 214


>gi|126724908|ref|ZP_01740751.1| GTP-binding protein [Rhodobacterales bacterium HTCC2150]
 gi|126706072|gb|EBA05162.1| GTP-binding protein [Rhodobacterales bacterium HTCC2150]
          Length = 216

 Score =  177 bits (450), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 123/193 (63%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+GV  +  +P A   E+ F+GRSNVGKS+LIN L  RK LARTSN PGRTQ +NFF  
Sbjct: 29  FLKGVVAMDGMPPADRLEVCFAGRSNVGKSTLINALTGRKALARTSNTPGRTQEINFFTV 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +         +  LVD+PGYG+A+AP   V  W  L+  YLS R  LR  ++LID RHG
Sbjct: 89  AE---------SHYLVDLPGYGFAKAPLPTVKKWQALLKAYLSGRQNLRRAFVLIDFRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D ++   L+  AV++Q++LTK DK+     ++ L +T+  +  +P A+PE++ TSS
Sbjct: 140 VKDVDDEIMQLLNSSAVTFQVILTKADKVKEADREKILAQTRAALAKHPAAYPEILVTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K +GIE LR  +
Sbjct: 200 EKGEGIENLRSIV 212


>gi|323137576|ref|ZP_08072653.1| ribosome biogenesis GTP-binding protein YsxC [Methylocystis sp.
           ATCC 49242]
 gi|322397202|gb|EFX99726.1| ribosome biogenesis GTP-binding protein YsxC [Methylocystis sp.
           ATCC 49242]
          Length = 217

 Score =  177 bits (450), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 93/183 (50%), Positives = 117/183 (63%), Gaps = 4/183 (2%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP  GPPEIAF+GRSNVGKSSL+N L NRK LAR S+ PGRTQ LNFF        +   
Sbjct: 30  LPPLGPPEIAFAGRSNVGKSSLLNALTNRKTLARVSHTPGRTQQLNFFALGGAPGAER-- 87

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + LVDMPGYGYA   K+ V SW  L+  YL  R++L  V++L+D R GVK +D ++F 
Sbjct: 88  --LRLVDMPGYGYAAVGKEKVASWSVLMRDYLRGRASLARVFVLVDGRRGVKPVDAEMFD 145

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
            LD+ AVSYQ++LTK D+L      E L  T   +   P A+PE+I TSS   +GI  LR
Sbjct: 146 LLDQSAVSYQVILTKHDELKVAERAEVLAATAEALSRRPAAYPEIIFTSSHTGEGIAELR 205

Query: 204 KAI 206
            A+
Sbjct: 206 GAV 208


>gi|89053125|ref|YP_508576.1| ribosome biogenesis GTP-binding protein YsxC [Jannaschia sp. CCS1]
 gi|119369206|sp|Q28UR1|ENGB_JANSC RecName: Full=Probable GTP-binding protein EngB
 gi|88862674|gb|ABD53551.1| GTP-binding protein [Jannaschia sp. CCS1]
          Length = 218

 Score =  177 bits (450), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 119/193 (61%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+GV  +  LP A   E+ F+GRSNVGKS+LIN L  RK LAR SN PGRTQ +N+F  
Sbjct: 30  FLKGVVAMDGLPPADRIEVCFAGRSNVGKSTLINALTGRKGLARASNTPGRTQEINYFTL 89

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D         +  LVD+PGYGYA AP   V  W  L+  YL  R+TLR  ++LID RHG
Sbjct: 90  LD---------SHYLVDLPGYGYAEAPLHVVQQWQALLKSYLQGRATLRRAFVLIDARHG 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D+++   LD  AV +Q VLTK DK+       +L +T+  + N+P A+PE+I TSS
Sbjct: 141 VKAVDEEIMKLLDIAAVPFQTVLTKSDKVKGRDRDASLARTRKALANHPAAYPEIILTSS 200

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 201 EKGDGIPTLRATI 213


>gi|218530581|ref|YP_002421397.1| ribosome biogenesis GTP-binding protein YsxC [Methylobacterium
           chloromethanicum CM4]
 gi|240138938|ref|YP_002963413.1| putative GTP-binding protein engB [Methylobacterium extorquens AM1]
 gi|254561546|ref|YP_003068641.1| GTP-binding protein engB [Methylobacterium extorquens DM4]
 gi|218522884|gb|ACK83469.1| GTP-binding protein HSR1-related [Methylobacterium chloromethanicum
           CM4]
 gi|240008910|gb|ACS40136.1| putative GTP-binding protein engB [Methylobacterium extorquens AM1]
 gi|254268824|emb|CAX24785.1| putative GTP-binding protein engB [Methylobacterium extorquens DM4]
          Length = 219

 Score =  177 bits (449), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 120/201 (59%), Gaps = 10/201 (4%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +F  SA  F    P +G LP     EIAF+GRSNVGKSSL+N L  R  LARTS+ PGRT
Sbjct: 20  LFAGSA-DFATAAPALGALPPMEGVEIAFAGRSNVGKSSLVNALTGRNTLARTSHTPGRT 78

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LNFF   +          + LVDMPGYGYA   K  V++W  LI  YL  RS L  VY
Sbjct: 79  QQLNFFRIGER---------LTLVDMPGYGYAAVEKAKVEAWTKLIHAYLKGRSNLARVY 129

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           LLID RHG+K+ID D+   LDK AVSYQIVLTK D L     ++ +      +   P A+
Sbjct: 130 LLIDSRHGLKEIDTDLLDGLDKAAVSYQIVLTKGDALKKAEIEKRIAGIHAALAKRPAAY 189

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
           PEV+ TSS   +G+  LR +I
Sbjct: 190 PEVLLTSSRDDRGVAELRASI 210


>gi|163733768|ref|ZP_02141210.1| GTPase EngB [Roseobacter litoralis Och 149]
 gi|161392879|gb|EDQ17206.1| GTPase EngB [Roseobacter litoralis Och 149]
          Length = 216

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 123/195 (63%), Gaps = 9/195 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP     E+ F+GRSNVGKSSLIN L  RK LAR SN PGRTQ +NFF  
Sbjct: 29  FVKGVVAMSGLPDPDRMEVCFAGRSNVGKSSLINALTGRKGLARASNTPGRTQEINFFTA 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +         +  LVD+PGYGYA AP   V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 89  GE---------SHYLVDLPGYGYANAPVPVVEKWQRLLKQYLSGRQTLRRAFVLIDARHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            K++D+++ S LD  AV++Q+VLTK DK+     ++ L++ +  +  +P A PE++ TSS
Sbjct: 140 AKKVDEEILSLLDSAAVTFQVVLTKADKVKEKEREKVLDQVRNALSKHPAAFPELVVTSS 199

Query: 194 VKRKGIEVLRKAILE 208
            K  GI  LR  I +
Sbjct: 200 EKGWGIPTLRSIITD 214


>gi|114770123|ref|ZP_01447661.1| GTP-binding protein [alpha proteobacterium HTCC2255]
 gi|114548960|gb|EAU51843.1| GTP-binding protein [alpha proteobacterium HTCC2255]
          Length = 216

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 123/193 (63%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+GV  +  +P A   E+ F+GRSNVGKSSLIN L  RK+LARTSN PGRTQ +NFF  
Sbjct: 29  FLKGVVGMDGMPPADRMEVCFAGRSNVGKSSLINALTGRKSLARTSNTPGRTQEINFFTL 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +         +  LVD+PGYG+A AP   V  W  L+  YLS R++LR V+LLID RHG
Sbjct: 89  SE---------SHYLVDVPGYGFANAPLPVVKKWQTLLKAYLSGRASLRRVFLLIDSRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D+++   L + AV++Q+VLTK DK      ++ + +T  ++  YP A+PE + TSS
Sbjct: 140 VKSVDEEIMELLGRSAVTFQVVLTKSDKPKKNDLEKVISETGRIVAKYPAAYPEFVLTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 200 EKGDGIPTLRHII 212


>gi|83859292|ref|ZP_00952813.1| GTP-binding protein [Oceanicaulis alexandrii HTCC2633]
 gi|83852739|gb|EAP90592.1| GTP-binding protein [Oceanicaulis alexandrii HTCC2633]
          Length = 192

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 118/190 (62%), Gaps = 9/190 (4%)

Query: 17  GVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDF 76
           GV  +  LP    PE+AF+GRSNVGKSSLIN L  RK LAR S  PGRT+ LNFF     
Sbjct: 3   GVVSMDTLPDTHVPEVAFAGRSNVGKSSLINALTGRKQLARASTEPGRTRELNFF----- 57

Query: 77  SNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQ 136
            ++   L    +VD+PGYG+A+APK+    W  L   YL  R  L+ V+LLID RHG+K 
Sbjct: 58  -DMHGRL---RIVDLPGYGFAKAPKEVAARWTRLTQNYLRGRVNLKRVFLLIDSRHGIKP 113

Query: 137 IDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKR 196
            D+ +   LD  AV YQIVLTK DKL P+ AQ+ LE+T+  +   P A P +  TSS KR
Sbjct: 114 SDEAIMKVLDSAAVVYQIVLTKTDKLKPSEAQKRLEETQAKVARRPAAFPVISATSSAKR 173

Query: 197 KGIEVLRKAI 206
            G++ LR  I
Sbjct: 174 DGLDELRGEI 183


>gi|163851773|ref|YP_001639816.1| GTPase EngB [Methylobacterium extorquens PA1]
 gi|163663378|gb|ABY30745.1| GTP-binding protein HSR1-related [Methylobacterium extorquens PA1]
          Length = 256

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 120/201 (59%), Gaps = 10/201 (4%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +F  SA  F    P +G LP     EIAF+GRSNVGKSSL+N L  R  LARTS+ PGRT
Sbjct: 57  LFAGSA-DFATAAPALGALPPMEGVEIAFAGRSNVGKSSLVNALTGRNTLARTSHTPGRT 115

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LNFF   +          + LVDMPGYGYA   K  V++W  LI  YL  RS L  VY
Sbjct: 116 QQLNFFRIGER---------LTLVDMPGYGYAAVEKAKVEAWTKLIHAYLKGRSNLARVY 166

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           LLID RHG+K+ID D+   LDK AVSYQIVLTK D L     ++ +      +   P A+
Sbjct: 167 LLIDSRHGLKEIDTDLLDGLDKAAVSYQIVLTKGDALKKAEIEKRIAGIHAALAKRPAAY 226

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
           PEV+ TSS   +G+  LR +I
Sbjct: 227 PEVLLTSSRDDRGVAELRASI 247


>gi|84685376|ref|ZP_01013274.1| GTP-binding protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84666533|gb|EAQ13005.1| GTP-binding protein [Rhodobacterales bacterium HTCC2654]
          Length = 218

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 121/193 (62%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+GV  +  LP     E+ F+GRSNVGKSSLIN L  RK LAR SN PGRTQ +NFF  
Sbjct: 31  FLKGVVAMNGLPPDDRIEVCFAGRSNVGKSSLINALTGRKGLARASNTPGRTQEINFFTT 90

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYG+A AP   V+ W  L+  YLS R++LR  ++LID RHG
Sbjct: 91  TD---------GPYLVDLPGYGFANAPVAVVEKWQKLLKSYLSGRASLRRAFVLIDTRHG 141

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D+++ + LDK AV++Q VLTK DK+      + L++ +  +  +P A+PE++ TSS
Sbjct: 142 IKAVDEEIMTLLDKSAVTFQAVLTKADKVKAADRDKILKQVREKLSKHPAAYPELVMTSS 201

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 202 EKGDGIATLRAII 214


>gi|254461126|ref|ZP_05074542.1| GTP-binding protein [Rhodobacterales bacterium HTCC2083]
 gi|206677715|gb|EDZ42202.1| GTP-binding protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 217

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 124/197 (62%), Gaps = 10/197 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKS+LIN L   K LAR SN PGRTQ +NFF  
Sbjct: 30  FVKGVVAMSGLPDADRMEVCFAGRSNVGKSTLINALTGHKALARASNTPGRTQEINFFTA 89

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +         +  LVD+PGYGYA AP   V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 90  AE---------SHYLVDLPGYGYANAPLPVVEKWQRLLKQYLSGRQTLRRAFVLIDARHG 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D ++ S LD  AV++Q VLTK DK+     ++ L + +  +  +P A PE++ TSS
Sbjct: 141 VKAVDHEIMSLLDSSAVTFQCVLTKADKVKLVDREKVLNQVRGELAKHPAAFPEMVLTSS 200

Query: 194 VKRKGIEVLRKAILETI 210
            K  GIE LR AI+ T+
Sbjct: 201 EKGDGIEQLR-AIIATL 216


>gi|85374953|ref|YP_459015.1| ribosome biogenesis GTP-binding protein YsxC [Erythrobacter
           litoralis HTCC2594]
 gi|84788036|gb|ABC64218.1| probable GTPase [Erythrobacter litoralis HTCC2594]
          Length = 213

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 122/194 (62%), Gaps = 7/194 (3%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++  LP+   PEIAF GRSNVGKSSL+N L  R+++ARTS  PGRTQ LNFF  
Sbjct: 23  FLLSAPQLKFLPEPTVPEIAFCGRSNVGKSSLLNALTGRRSIARTSVTPGRTQELNFFEV 82

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            + +  +       LVDMPGYG+A+AP K V+ W  L+  YL  R  L    +L+D RHG
Sbjct: 83  GEPTQFR-------LVDMPGYGFAKAPVKVVERWKNLVRTYLKGRQVLARTLVLVDARHG 135

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D+++ + LD+ AVSY++VLTK DK+  +  + T  K     R +P A PE+  TSS
Sbjct: 136 LKDVDREMMTMLDETAVSYRVVLTKADKIKASELEATAAKVAEEARKHPAAFPELHITSS 195

Query: 194 VKRKGIEVLRKAIL 207
            K  GI  LR A++
Sbjct: 196 EKGLGIAALRAAVV 209


>gi|85705861|ref|ZP_01036957.1| GTP-binding protein [Roseovarius sp. 217]
 gi|85669449|gb|EAQ24314.1| GTP-binding protein [Roseovarius sp. 217]
          Length = 216

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 121/193 (62%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKSSLIN L  RK LAR SN PGRTQ +NFF  
Sbjct: 29  FVKGVVAMSGLPPADRLEVCFAGRSNVGKSSLINALTGRKALARASNTPGRTQEINFFAL 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +         +  LVD+PGYGYA AP   V  W  L+ +YLS R TLR  ++L+D RHG
Sbjct: 89  GE---------SHYLVDLPGYGYANAPLAVVQKWQALLKQYLSGRQTLRRAFVLVDARHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D+++ + LD  AV++Q VLTK DK++       L++ +  +  +P A PE+I TSS
Sbjct: 140 IKTVDEEIMTLLDGAAVTFQCVLTKTDKINAADRDRVLDQVRSKLAPHPAAFPELILTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K +G+  LR  I
Sbjct: 200 EKSEGLATLRATI 212


>gi|83594669|ref|YP_428421.1| ribosome biogenesis GTP-binding protein YsxC [Rhodospirillum rubrum
           ATCC 11170]
 gi|119369247|sp|Q2RP11|ENGB_RHORT RecName: Full=Probable GTP-binding protein EngB
 gi|83577583|gb|ABC24134.1| GTP-binding [Rhodospirillum rubrum ATCC 11170]
          Length = 231

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 95/187 (50%), Positives = 115/187 (61%), Gaps = 4/187 (2%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   +  LP     EIAF+GRSNVGKSSL+N L  RK LARTSN PGRTQ LN+F  
Sbjct: 37  FVMGCVSLDTLPDHDLSEIAFAGRSNVGKSSLVNALTGRKTLARTSNTPGRTQELNYF-- 94

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                 +   PA+ +VD+PGYG+A APK  V  W  LI+ YL  R  LR V LLID RHG
Sbjct: 95  --RLGPEAQDPALMMVDLPGYGFAEAPKDAVKRWTRLIMAYLRGRPALRRVCLLIDSRHG 152

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K+ D+DV   LD+ AVSYQIVLTK DKL      + L +       +  AHP+VI TSS
Sbjct: 153 IKENDRDVMRMLDEAAVSYQIVLTKADKLKAAEITDVLARVVAETAKHVAAHPDVIVTSS 212

Query: 194 VKRKGIE 200
               GI+
Sbjct: 213 QSGAGID 219


>gi|46201109|ref|ZP_00055731.2| COG0218: Predicted GTPase [Magnetospirillum magnetotacticum MS-1]
          Length = 228

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/190 (50%), Positives = 117/190 (61%), Gaps = 9/190 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++G   +  LP A   E+AF+GRSNVGKSSLIN L  R  LARTSN PGRTQ LNFF  
Sbjct: 41  FMQGASGLDHLPAATLTEVAFAGRSNVGKSSLINALTGRNTLARTSNTPGRTQELNFF-- 98

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               NL   L    LVDMPGYG+A+APK  V+ W  L+  +L  RS LR   +L+D RHG
Sbjct: 99  ----NLGGRL---VLVDMPGYGFAQAPKGLVEKWTRLVNGFLKGRSVLRRAVVLVDSRHG 151

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K  D+D+   LDK AV YQ+VLTK DKL  +       +T   I++   AHP +I TSS
Sbjct: 152 LKDSDRDMMKMLDKAAVVYQVVLTKADKLKASELDAVQARTLEEIKSRVAAHPSLIVTSS 211

Query: 194 VKRKGIEVLR 203
            K  GI  LR
Sbjct: 212 EKGTGIPELR 221


>gi|83950485|ref|ZP_00959218.1| GTP-binding protein [Roseovarius nubinhibens ISM]
 gi|83838384|gb|EAP77680.1| GTP-binding protein [Roseovarius nubinhibens ISM]
          Length = 216

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 119/193 (61%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+GV  +  LP A   E+ F+GRSNVGKSSLIN L  RK LAR SN PGRTQ +NFF  
Sbjct: 29  FLKGVVAMSGLPPADRIEVCFAGRSNVGKSSLINALTGRKALARASNTPGRTQEVNFFTM 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D         +  LVD+PGYGYA AP   V  W  L+  YLS R+ LR  ++LID RHG
Sbjct: 89  AD---------SHYLVDLPGYGYANAPLPIVAKWQALLKSYLSGRANLRRAFVLIDARHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D+++ + LD  AV++Q VLTK DK+     ++ L + +  +  +P A PE+I TSS
Sbjct: 140 VKAVDEEIMALLDSSAVTFQTVLTKADKVKEAEREKILTQVRSRLATHPAAFPELIVTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 200 EKGWGIPTLRATI 212


>gi|254293246|ref|YP_003059269.1| GTP-binding protein HSR1-related [Hirschia baltica ATCC 49814]
 gi|254041777|gb|ACT58572.1| GTP-binding protein HSR1-related [Hirschia baltica ATCC 49814]
          Length = 213

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 121/194 (62%), Gaps = 9/194 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A  PEIAF+GRSNVGKSSLIN L NRK LAR S  PGRTQ +NFF  
Sbjct: 26  FVKGVVNMQGLPPADRPEIAFAGRSNVGKSSLINALFNRKQLARASGQPGRTQEINFFTI 85

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                    L A+ +VD+PGYG+A+APK  VD W      YL  R+ L+ V+LLID R G
Sbjct: 86  ---------LEALYVVDLPGYGFAKAPKAVVDKWTNFTQTYLRGRTNLQRVFLLIDSRRG 136

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           V  +D+ +   LD+ A++YQIVLTK DKL  +   + ++     I+  P AHP ++ TS+
Sbjct: 137 VGDVDRGIMKVLDRAALNYQIVLTKADKLKKSELDKVIDDAVVAIKKNPAAHPRIMLTSA 196

Query: 194 VKRKGIEVLRKAIL 207
            K  G+  L+  I+
Sbjct: 197 EKNIGLPELKAEIV 210


>gi|254475298|ref|ZP_05088684.1| hypothetical protein RR11_1134 [Ruegeria sp. R11]
 gi|214029541|gb|EEB70376.1| hypothetical protein RR11_1134 [Ruegeria sp. R11]
          Length = 216

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 119/193 (61%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKSSLIN L   K LAR SN PGRTQ +N+F  
Sbjct: 29  FVKGVVAMSGLPDADRMEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINYF-- 86

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P + LVD+PGYGYA AP   V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 87  -------TQGPELYLVDLPGYGYANAPLPVVEKWQRLLKQYLSGRQTLRRAFVLIDSRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K++D ++   LD  AV++Q+V+TK DK+        L + +  +  +P A+PE++ TSS
Sbjct: 140 IKKVDAEIMKLLDSSAVTFQVVMTKADKVKEKDRAAVLSQVREALSKHPAAYPEIVLTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 200 EKGDGIPTLRAII 212


>gi|298290370|ref|YP_003692309.1| ribosome biogenesis GTP-binding protein YsxC [Starkeya novella DSM
           506]
 gi|296926881|gb|ADH87690.1| ribosome biogenesis GTP-binding protein YsxC [Starkeya novella DSM
           506]
          Length = 233

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 117/196 (59%), Gaps = 9/196 (4%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W FL   P I  +P     EIA +GRSNVGKSSL+N L  RK LARTS  PGRTQ L FF
Sbjct: 36  WNFLSAAPTIPTMPPMRGIEIALAGRSNVGKSSLVNALTGRKALARTSVTPGRTQELIFF 95

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                       P + LVDMPGYG+A+APK  VD+W   I  YL  R+ L  V++LID R
Sbjct: 96  ---------GLGPELTLVDMPGYGFAKAPKDKVDAWTATIHAYLRGRANLARVFVLIDSR 146

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K ID +V   LDK AVSY IVLTK D+L      + +E T+  +   P A P V PT
Sbjct: 147 HGLKPIDTEVLDGLDKAAVSYAIVLTKADQLKKGELAQRVEATQAALLRRPAAFPIVFPT 206

Query: 192 SSVKRKGIEVLRKAIL 207
           SS +  GI  LR A++
Sbjct: 207 SSREGWGIPELRAAVV 222


>gi|163745581|ref|ZP_02152941.1| GTPase EngB [Oceanibulbus indolifex HEL-45]
 gi|161382399|gb|EDQ06808.1| GTPase EngB [Oceanibulbus indolifex HEL-45]
          Length = 216

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 124/197 (62%), Gaps = 10/197 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP     E+ F+GRSNVGKS+LIN L   K LAR SN PGRTQ +NFF  
Sbjct: 29  FVKGVVAMDGLPPPDRMEVCFAGRSNVGKSTLINALTGMKALARASNTPGRTQEINFFTA 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            LVD+PGYGYA AP   V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 89  GE---------EHYLVDLPGYGYANAPLPVVEKWQRLLKQYLSGRQTLRRAFVLIDARHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK++D ++ S LD  AV++Q+VLTK DK+      + LE+ K  +  +P A+PE++ TSS
Sbjct: 140 VKKVDNEIMSLLDSSAVTFQVVLTKGDKVKEAERTKILEQVKEALSKHPAAYPEIVVTSS 199

Query: 194 VKRKGIEVLRKAILETI 210
            K  GI  LR AI+ T+
Sbjct: 200 EKGWGIPTLR-AIIATL 215


>gi|85717143|ref|ZP_01048102.1| GTP-binding protein [Nitrobacter sp. Nb-311A]
 gi|85696034|gb|EAQ33933.1| GTP-binding protein [Nitrobacter sp. Nb-311A]
          Length = 249

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 124/200 (62%), Gaps = 7/200 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+   P I  LP     E+AF+GRSNVGKSSLIN L  R  LARTS  PGRTQ L FF
Sbjct: 53  WQFIWASPSIETLPPMAGLEVAFAGRSNVGKSSLINALTGRNALARTSRTPGRTQELIFF 112

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                ++++       LVDMPGYG+A APK  + SW  LI R+L  R+TL  VY+LID R
Sbjct: 113 EGPKGTDVR-------LVDMPGYGFASAPKDRIASWTSLIHRFLLGRATLARVYVLIDSR 165

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K  D++V + LD+ AVSYQ+VLTK D++     ++ ++ T+  + ++  A P+V+ T
Sbjct: 166 HGIKDTDRNVLTTLDRAAVSYQVVLTKADEVKAAELEKRIDATRTQLLSHSAAFPDVLAT 225

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS    G+  LR A+   I 
Sbjct: 226 SSRTGYGMPELRAAMARLIG 245


>gi|260427039|ref|ZP_05781018.1| ribosome biogenesis GTP-binding protein YsxC [Citreicella sp. SE45]
 gi|260421531|gb|EEX14782.1| ribosome biogenesis GTP-binding protein YsxC [Citreicella sp. SE45]
          Length = 217

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 123/193 (63%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+GV  +  LP     E+ F+GRSNVGKSSLIN L  RK LAR SN PGRTQ +NFF  
Sbjct: 30  FLKGVVAMDGLPPDDRTEVCFAGRSNVGKSSLINALTGRKALARASNTPGRTQEINFFTL 89

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            LVD+PGYG+A AP   V+ W  L+ +YLS R++LR  ++LID RHG
Sbjct: 90  GE---------ERYLVDLPGYGFANAPVAVVEKWQRLLKQYLSGRASLRRAFVLIDSRHG 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D+++ + LD+ AV++Q VLTK DK+     ++ L++ +  +  +P A+PE++ TSS
Sbjct: 141 VKAVDEEIMTLLDRSAVTFQAVLTKSDKIREKEREKVLDQVREKLSKHPAAYPELVLTSS 200

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 201 EKGDGIATLRAII 213


>gi|254509788|ref|ZP_05121855.1| GTP-binding protein [Rhodobacteraceae bacterium KLH11]
 gi|221533499|gb|EEE36487.1| GTP-binding protein [Rhodobacteraceae bacterium KLH11]
          Length = 217

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 119/193 (61%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP     E+ F+GRSNVGKSSLIN L   K LAR SN PGRTQ +NFF  
Sbjct: 30  FVKGVVAMNGLPVPDRLEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINFF-- 87

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P + LVD+PGYGYA AP K V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 88  -------TQGPELYLVDLPGYGYANAPVKVVEKWQRLLKQYLSGRQTLRRAFVLIDSRHG 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D ++   LD  AV++Q VLTK DK+     ++ L++ +  +  +P A PE++ TSS
Sbjct: 141 VKPVDAEIMKLLDTSAVTFQCVLTKADKVKAKDQEKVLDQVRASLAKHPAAFPEIVLTSS 200

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 201 EKGDGIPTLRSII 213


>gi|326386368|ref|ZP_08207991.1| GTPase EngB [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209029|gb|EGD59823.1| GTPase EngB [Novosphingobium nitrogenifigens DSM 19370]
          Length = 221

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 123/195 (63%), Gaps = 7/195 (3%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+  P +  +P    PEIAF+GRSNVGKSSLIN +  RK++AR S  PGRTQ LN+F  
Sbjct: 30  FLKSAPSLQFIPDPEEPEIAFAGRSNVGKSSLINAITGRKSIARASVTPGRTQELNWFEV 89

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            + ++++       LVDMPGYG+A+AP K V+ W  L+  +L  R+ L+   LLID RHG
Sbjct: 90  GNPTSIR-------LVDMPGYGFAKAPPKVVEQWRRLVRDFLRGRTVLKRTLLLIDARHG 142

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D ++   LD+ AV Y++VLTK DK+           T+ + R +  A+P V+ TS+
Sbjct: 143 VKPVDVEMMQMLDEAAVGYRLVLTKADKIKAEELAAVHAATEAVARKHIAAYPGVLVTSA 202

Query: 194 VKRKGIEVLRKAILE 208
            KR GI  LR AILE
Sbjct: 203 EKRSGIAALRAAILE 217


>gi|254467073|ref|ZP_05080484.1| hypothetical protein RBY4I_3686 [Rhodobacterales bacterium Y4I]
 gi|206687981|gb|EDZ48463.1| hypothetical protein RBY4I_3686 [Rhodobacterales bacterium Y4I]
          Length = 215

 Score =  175 bits (443), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 119/193 (61%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F +GV  +  LP A   E+ F+GRSNVGKSS+IN +   K +AR SN PGRTQ +NFF  
Sbjct: 29  FDKGVVAMNGLPDADRVEVCFAGRSNVGKSSVINAVTGTKGIARASNTPGRTQEINFFTQ 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P + LVD+PGYGYA AP   V+ W  L+ +YLS R  LR  ++LID RHG
Sbjct: 89  G---------PDLYLVDLPGYGYANAPLAVVEKWQKLLKQYLSGRQNLRRAFVLIDSRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK++D+D+   LD  AV++Q V+TK DK+      + LE+ +  +  +P A+PE++ TSS
Sbjct: 140 VKKVDEDIMKLLDSAAVTFQCVMTKADKVKEKDRAKVLEQVRGALARHPAAYPEIVLTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 200 EKGDGIPTLRSII 212


>gi|260577137|ref|ZP_05845114.1| GTP-binding protein HSR1-related protein [Rhodobacter sp. SW2]
 gi|259020611|gb|EEW23930.1| GTP-binding protein HSR1-related protein [Rhodobacter sp. SW2]
          Length = 216

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 91/198 (45%), Positives = 125/198 (63%), Gaps = 10/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKSSLIN L  RK+LAR SN PGRTQ +N+F  
Sbjct: 29  FVKGVVAMPGLPPADRLEVCFAGRSNVGKSSLINALTGRKSLARASNTPGRTQEINYFAL 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                         LVD+PGYGYA AP   V+ W  L+  YL  R TLR  ++LID RHG
Sbjct: 89  GT---------ERYLVDLPGYGYAEAPVAVVEKWQRLLKNYLQGRQTLRRAFVLIDTRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D+++ + LD+ AV++Q VLTK DK+S       +++ +  +  +P A+PE++ TS+
Sbjct: 140 VKAVDEEILTLLDRSAVTFQAVLTKADKVSKAERDAIIDQVRGALAKHPAAYPELVVTSA 199

Query: 194 VKRKGIEVLRKAILETIN 211
            K  GIE LR AI+ T+ 
Sbjct: 200 EKGDGIETLR-AIIATLQ 216


>gi|154244318|ref|YP_001415276.1| ribosome biogenesis GTP-binding protein YsxC [Xanthobacter
           autotrophicus Py2]
 gi|154158403|gb|ABS65619.1| small GTP-binding protein [Xanthobacter autotrophicus Py2]
          Length = 217

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 118/195 (60%), Gaps = 9/195 (4%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+   P + +LP     EIA +GRSNVGKSSL+N L  RK LARTS  PGRTQ L FF
Sbjct: 24  WQFVTAAPTVEVLPPMVGMEIALAGRSNVGKSSLVNALTGRKALARTSVTPGRTQELIFF 83

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                       P ++LVDMPGYG+A+APK+ V++W   I  YL  R  L  V++LID R
Sbjct: 84  ---------RVGPELSLVDMPGYGFAKAPKEKVEAWTHTIKAYLRGRVNLARVFVLIDSR 134

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K +D+++   LDK AVSY I+LTK D++ P+     +   +  I+  P A+P V PT
Sbjct: 135 HGIKPVDEEILDLLDKAAVSYAIILTKSDQVKPSALPHVIASVQEKIKRRPAAYPVVFPT 194

Query: 192 SSVKRKGIEVLRKAI 206
           SS    G   LR A+
Sbjct: 195 SSQTGAGFPELRAAV 209


>gi|163740283|ref|ZP_02147677.1| GTP-binding protein [Phaeobacter gallaeciensis 2.10]
 gi|161386141|gb|EDQ10516.1| GTP-binding protein [Phaeobacter gallaeciensis 2.10]
          Length = 216

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKSSLIN L   K LAR SN PGRTQ +N+F  
Sbjct: 29  FVKGVVAMSGLPPADRIEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINYF-- 86

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P + LVD+PGYGYA AP   V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 87  -------TQGPELYLVDLPGYGYANAPLPVVEKWQRLLKQYLSGRQTLRRAFVLIDSRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K++D ++ + LD  AV++Q V+TK DK+        +E+ +  +  +P A+PE++ TSS
Sbjct: 140 IKKVDDEIMTRLDSSAVTFQCVMTKADKVKDKDRAVVMEQVRSALSKHPAAYPEIVMTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 200 EKGDGIATLRSII 212


>gi|260432490|ref|ZP_05786461.1| ribosome biogenesis GTP-binding protein YsxC [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416318|gb|EEX09577.1| ribosome biogenesis GTP-binding protein YsxC [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 214

 Score =  174 bits (441), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 119/193 (61%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP     E+ F+GRSNVGKSSLIN L   K LAR SN PGRTQ +NFF  
Sbjct: 27  FVKGVVAMNGLPAPDRLEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINFF-- 84

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P + LVD+PGYGYA AP K V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 85  -------TQGPDLYLVDLPGYGYANAPVKVVEKWQRLLKQYLSGRQTLRRAFVLIDSRHG 137

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D ++   LD  AV++Q V+TK DK+     ++ L + +  +  +P A+PE++ TSS
Sbjct: 138 VKPVDDEIMKLLDTSAVTFQCVMTKADKVKAKDREKVLGQVRGALSKHPAAYPEIVLTSS 197

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 198 EKGDGIPTLRSII 210


>gi|288957365|ref|YP_003447706.1| GTP-binding protein [Azospirillum sp. B510]
 gi|288909673|dbj|BAI71162.1| GTP-binding protein [Azospirillum sp. B510]
          Length = 227

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 121/193 (62%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   +  LP+A  PE+AF+GRSNVGKSSL+N L  RK LARTSN PGRTQ LNFF  
Sbjct: 36  FVWGANALNQLPEADLPEVAFAGRSNVGKSSLVNALTGRKTLARTSNTPGRTQQLNFF-- 93

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               NL + L    LVDMPGYGYA+  K+ V++W  ++ R+L  R TLR   +LID RHG
Sbjct: 94  ----NLGDRLK---LVDMPGYGYAKESKEKVEAWNDMVRRFLRGRVTLRRALVLIDSRHG 146

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K  D ++   LD+ AV Y +VLTK DK+      +    T+  ++ +P A P++  TSS
Sbjct: 147 LKPNDHEIMEMLDRTAVPYVVVLTKADKVKEADLDKVRRATELGLKKHPAAFPDIHVTSS 206

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR ++
Sbjct: 207 EKGLGIAELRASL 219


>gi|254487465|ref|ZP_05100670.1| GTP-binding protein [Roseobacter sp. GAI101]
 gi|214044334|gb|EEB84972.1| GTP-binding protein [Roseobacter sp. GAI101]
          Length = 216

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/198 (45%), Positives = 125/198 (63%), Gaps = 10/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKS+LIN L   K LAR SN PGRTQ +N+F  
Sbjct: 29  FVKGVVAMDGLPPADRMEVCFAGRSNVGKSTLINALTGMKALARASNTPGRTQEINYFTA 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +   L         VD+PGYGYA AP   V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 89  GEDHYL---------VDLPGYGYANAPLPIVEKWQRLLKQYLSGRQTLRRAFVLIDARHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK++D+++ S LD  AV++Q VLTK DK+      + L++ +  +  +P A+PE++ TSS
Sbjct: 140 VKKVDEEIMSLLDSSAVTFQCVLTKADKVKEVERAKILDQVRGALAKHPAAYPEIVVTSS 199

Query: 194 VKRKGIEVLRKAILETIN 211
            K  GI  LR AI+ T+ 
Sbjct: 200 EKGWGIPTLR-AIIATLE 216


>gi|163739490|ref|ZP_02146900.1| GTP-binding protein [Phaeobacter gallaeciensis BS107]
 gi|161387243|gb|EDQ11602.1| GTP-binding protein [Phaeobacter gallaeciensis BS107]
          Length = 216

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 120/193 (62%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP A   E+ F+GRSNVGKSSLIN L   K LAR SN PGRTQ +N+F  
Sbjct: 29  FVKGVVAMSGLPPADRIEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINYF-- 86

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P + LVD+PGYGYA AP   V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 87  -------TQGPELYLVDLPGYGYANAPLPIVEKWQRLLKQYLSGRQTLRRSFVLIDSRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K++D ++ + LD  AV++Q V+TK DK+        +E+ +  +  +P A+PE++ TSS
Sbjct: 140 IKKVDDEIMTRLDSSAVTFQCVMTKADKVKDKDRAVVMEQVRSALSKHPAAYPEIVMTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 200 EKGDGIATLRSII 212


>gi|162319777|ref|YP_423720.2| ribosome biogenesis GTP-binding protein YsxC [Magnetospirillum
           magneticum AMB-1]
          Length = 187

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 114/189 (60%), Gaps = 9/189 (4%)

Query: 15  LRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPK 74
           ++G   +  LP A   E+AF+GRSNVGKSSLIN L  R  LARTSN PGRTQ LNFF   
Sbjct: 1   MQGASGLDHLPAATLTEVAFAGRSNVGKSSLINALTGRNTLARTSNTPGRTQELNFF--- 57

Query: 75  DFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGV 134
              NL   L    LVDMPGYG+A+APK  V+ W  L+  +L  RS LR   +L+D RHG+
Sbjct: 58  ---NLGGRL---ILVDMPGYGFAQAPKGLVEKWTRLVNGFLKGRSVLRRAVVLVDSRHGL 111

Query: 135 KQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSV 194
           K  D+D+   LDK AV YQ+VLTK DKL          +T   I+    AHP +I TSS 
Sbjct: 112 KDSDRDMMKMLDKAAVVYQVVLTKADKLKAAELDAVQARTLEEIKGRVAAHPHLIVTSSE 171

Query: 195 KRKGIEVLR 203
           K  GI  LR
Sbjct: 172 KGTGIPELR 180


>gi|91974552|ref|YP_567211.1| ribosome biogenesis GTP-binding protein YsxC [Rhodopseudomonas
           palustris BisB5]
 gi|119369246|sp|Q13F29|ENGB_RHOPS RecName: Full=Probable GTP-binding protein EngB
 gi|91681008|gb|ABE37310.1| GTP-binding [Rhodopseudomonas palustris BisB5]
          Length = 217

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 123/200 (61%), Gaps = 7/200 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+   P I  LP     E+AF+GRSNVGKSSLIN L  R  LARTSN PGRTQ L FF
Sbjct: 21  WHFIWASPSIETLPPMAGIEVAFAGRSNVGKSSLINALTGRNALARTSNTPGRTQELIFF 80

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                + L+       LVDMPGYGYA A K  V SW  LI ++L  R+TL  VY+LID R
Sbjct: 81  DGPTDAGLR-------LVDMPGYGYAAASKAKVASWTSLIHKFLQGRATLARVYVLIDGR 133

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K +D D+   LDK AVSYQIV TK D++     ++ +  TK ++  +P A PE++ T
Sbjct: 134 HGLKDVDLDILKTLDKSAVSYQIVFTKADQVKAAELEQRIAATKTVLAKHPAAFPELLMT 193

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS    G+  LR A++  ++
Sbjct: 194 SSRTGAGMPELRAAMIRLLD 213


>gi|316932099|ref|YP_004107081.1| ribosome biogenesis GTP-binding protein YsxC [Rhodopseudomonas
           palustris DX-1]
 gi|315599813|gb|ADU42348.1| ribosome biogenesis GTP-binding protein YsxC [Rhodopseudomonas
           palustris DX-1]
          Length = 216

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 121/200 (60%), Gaps = 7/200 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+   P I  LP  G  EIAF+GRSNVGKSSLIN L  R  LARTS+ PGRTQ L FF
Sbjct: 21  WHFIWASPSIETLPPMGSVEIAFAGRSNVGKSSLINALTGRNALARTSHTPGRTQELIFF 80

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                + L+       LVDMPGYGYA A K  V SW  LI  +L  R+TL  VY+LID R
Sbjct: 81  EGPPNAGLR-------LVDMPGYGYAAASKAKVASWTSLIHHFLQGRATLARVYVLIDGR 133

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K +D D+   LDK AVSYQIVLTK D++      E +  T   +  +P A PEV+ T
Sbjct: 134 HGLKDVDLDILKTLDKAAVSYQIVLTKADQVKAAELSERVTATVAALTKHPAAFPEVLTT 193

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS    G+  LR A++  ++
Sbjct: 194 SSRTGAGMPELRAAMIRLLD 213


>gi|182680231|ref|YP_001834377.1| ribosome biogenesis GTP-binding protein YsxC [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182636114|gb|ACB96888.1| GTP-binding protein HSR1-related [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 244

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 95/195 (48%), Positives = 117/195 (60%), Gaps = 8/195 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F  G      LP  G PEIAF+GRSNVGKSSL+N L  RK LARTS+ PGRTQ LNFF  
Sbjct: 40  FFWGAAARSQLPPEGAPEIAFAGRSNVGKSSLLNALTGRKTLARTSHTPGRTQELNFFA- 98

Query: 74  KDFSNLKNNLPA--MALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                L   + +  M LVDMPGYGYA A K+ + +W  L   +L  R  L  VY+LID R
Sbjct: 99  -----LGPTIESARMRLVDMPGYGYAAASKEKIAAWTSLCRDFLRGRVPLLRVYVLIDGR 153

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K ID +    LD+ A+SYQIVLTK D++  +     +   K  +   P A+P+VI T
Sbjct: 154 HGLKPIDSETLDLLDQSAISYQIVLTKRDEVKKSEQAARIASVKAALAKRPAAYPDVIFT 213

Query: 192 SSVKRKGIEVLRKAI 206
           SS   +GI  LR AI
Sbjct: 214 SSQSGEGIADLRAAI 228


>gi|255262598|ref|ZP_05341940.1| ribosome biogenesis GTP-binding protein YsxC [Thalassiobium sp.
           R2A62]
 gi|255104933|gb|EET47607.1| ribosome biogenesis GTP-binding protein YsxC [Thalassiobium sp.
           R2A62]
          Length = 217

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 120/193 (62%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++GV  +  LP     E+ F+GRSNVGKS+LIN L  RK LAR SN PGRTQ +N+F  
Sbjct: 30  FVKGVVAMSGLPDPDRIEVCFAGRSNVGKSTLINALTGRKGLARASNTPGRTQEINYFTM 89

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +   L         VD+PGYG+A AP   V+ W  L+ +YLS R TLR  ++LID RHG
Sbjct: 90  GEHGYL---------VDLPGYGFANAPLTVVEKWQRLLKQYLSGRQTLRRAFVLIDARHG 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D ++ S LD  AV++Q VLTK DK+     +  +++ +  +  +P A+PE++ TSS
Sbjct: 141 VKPVDDEIMSLLDSAAVTFQAVLTKADKVKLKERERIMDQVRGALAKHPAAYPEIVLTSS 200

Query: 194 VKRKGIEVLRKAI 206
            K  GI+ LR  I
Sbjct: 201 EKGDGIKTLRSII 213


>gi|192289065|ref|YP_001989670.1| ribosome biogenesis GTP-binding protein YsxC [Rhodopseudomonas
           palustris TIE-1]
 gi|238692588|sp|B3QCI1|ENGB_RHOPT RecName: Full=Probable GTP-binding protein EngB
 gi|192282814|gb|ACE99194.1| GTP-binding protein HSR1-related [Rhodopseudomonas palustris TIE-1]
          Length = 216

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 121/200 (60%), Gaps = 7/200 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+   P I  LP  G  EIAF+GRSNVGKSSLIN L  R  LARTS+ PGRTQ L FF
Sbjct: 21  WHFIWASPSIETLPPMGSVEIAFAGRSNVGKSSLINALTGRNALARTSHTPGRTQELIFF 80

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                + L+       LVDMPGYGYA A K  V SW  LI  +L  R+TL  VY+LID R
Sbjct: 81  EGPPNAGLR-------LVDMPGYGYAAASKAKVASWTSLIHHFLQGRATLARVYVLIDGR 133

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K +D D+   LDK AVSYQIVLTK D++      E +  T   +  +P A PEV+ T
Sbjct: 134 HGLKDVDLDILKTLDKAAVSYQIVLTKADQVKAAELAERVTATVAALAKHPAAFPEVLTT 193

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS    G+  LR A++  ++
Sbjct: 194 SSRTGAGMPELRAAMIRLLD 213


>gi|217977386|ref|YP_002361533.1| ribosome biogenesis GTP-binding protein YsxC [Methylocella
           silvestris BL2]
 gi|217502762|gb|ACK50171.1| GTP-binding protein HSR1-related [Methylocella silvestris BL2]
          Length = 226

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 120/195 (61%), Gaps = 8/195 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL     +  LP  G PEIAF+GRSNVGKSSL+N L NRK+LARTS+ PGRT+ LNFF  
Sbjct: 29  FLWAASSVASLPPPGAPEIAFAGRSNVGKSSLLNALTNRKSLARTSHTPGRTRELNFF-- 86

Query: 74  KDFSNLKNNL--PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                L   +    + LVDMPGYGYA A K+ + SW  L+  YL  R+ L   ++LID R
Sbjct: 87  ----GLGGGIDDARLRLVDMPGYGYAAASKEQIASWTQLMQDYLRGRAPLLRAFVLIDGR 142

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K  D ++   LD+ A+SYQIVLTK D++    A   +E+T   I   P A+P+ I T
Sbjct: 143 HGLKPPDYEMMDLLDRCALSYQIVLTKQDEVKEADAARRIEETLKAIEKRPAAYPQAIFT 202

Query: 192 SSVKRKGIEVLRKAI 206
           SS    G+  LR AI
Sbjct: 203 SSRTADGVAELRAAI 217


>gi|39933708|ref|NP_945984.1| ribosome biogenesis GTP-binding protein YsxC [Rhodopseudomonas
           palustris CGA009]
 gi|81564114|sp|Q6NC42|ENGB_RHOPA RecName: Full=Probable GTP-binding protein EngB
 gi|39647554|emb|CAE26075.1| possible GTPases [Rhodopseudomonas palustris CGA009]
          Length = 216

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 121/200 (60%), Gaps = 7/200 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+   P I  LP  G  EIAF+GRSNVGKSSLIN L  R  LARTS+ PGRTQ L FF
Sbjct: 21  WHFIWASPSIETLPPMGSVEIAFAGRSNVGKSSLINALTGRNALARTSHTPGRTQELIFF 80

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                + L+       LVDMPGYGYA A K  V SW  LI  +L  R+TL  VY+LID R
Sbjct: 81  EGPPNAGLR-------LVDMPGYGYAAASKAKVASWTSLIHHFLQGRATLARVYVLIDGR 133

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K +D D+   LDK AVSYQIVLTK D++      E +  T   +  +P A PEV+ T
Sbjct: 134 HGLKDVDLDILKTLDKAAVSYQIVLTKADQVKAAELAERVTATVAALAKHPAAFPEVLTT 193

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS    G+  LR A++  ++
Sbjct: 194 SSRTGAGMPELRAAMIRLLD 213


>gi|188581559|ref|YP_001925004.1| ribosome biogenesis GTP-binding protein YsxC [Methylobacterium
           populi BJ001]
 gi|179345057|gb|ACB80469.1| GTP-binding protein HSR1-related protein [Methylobacterium populi
           BJ001]
          Length = 218

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 112/176 (63%), Gaps = 9/176 (5%)

Query: 31  EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVD 90
           EIAF+GRSNVGKSSLIN L  R  LARTS+ PGRTQ LNFF       +   L    LVD
Sbjct: 43  EIAFAGRSNVGKSSLINALTGRNTLARTSHTPGRTQQLNFF------RIGGRL---MLVD 93

Query: 91  MPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAV 150
           MPGYGYA   K  V++W  LI  YL  RS L  VYLLID RHG+K+ID D+   LDK AV
Sbjct: 94  MPGYGYAAVEKAKVEAWTKLIHAYLKGRSNLARVYLLIDSRHGLKEIDTDLLDGLDKAAV 153

Query: 151 SYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAI 206
           SYQ+VLTK D L  +  ++ +   +  +   P A+PEV+ TSS   +G+  LR +I
Sbjct: 154 SYQVVLTKGDALKKSEIEKRIAGIQAALAKRPAAYPEVLLTSSRDDRGVAELRASI 209


>gi|329848428|ref|ZP_08263456.1| ribosome biogenesis GTP-binding protein YsxC [Asticcacaulis
           biprosthecum C19]
 gi|328843491|gb|EGF93060.1| ribosome biogenesis GTP-binding protein YsxC [Asticcacaulis
           biprosthecum C19]
          Length = 215

 Score =  171 bits (433), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 94/202 (46%), Positives = 124/202 (61%), Gaps = 10/202 (4%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +F ++A  F+ G  ++  LP    PE+AF+GRSNVGKSSLIN +V  K LAR SN PGRT
Sbjct: 17  LFARAA-TFVMGAAKVEQLPDTSQPEVAFAGRSNVGKSSLINAVVGMKALARASNEPGRT 75

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           + +NFF      N+   L    LVD+PGYG+A+A K  V  +  L   YL  R  L+  Y
Sbjct: 76  REVNFF------NVNGQL---HLVDLPGYGWAKASKVTVKKFQNLGRDYLRGRPNLKRAY 126

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           LLID RHG+K++D++    LD  AVSYQIVLTK DK+ P    + +E T+  ++  P AH
Sbjct: 127 LLIDARHGLKEVDKEPMDALDVAAVSYQIVLTKADKIKPAELAKVIEATQAGVKKRPAAH 186

Query: 186 PEVIPTSSVKRKGIEVLRKAIL 207
           P V+ TSS    GI  LR  I+
Sbjct: 187 PLVLATSSETGFGIAELRAEIM 208


>gi|209965569|ref|YP_002298484.1| ribosome biogenesis GTP-binding protein YsxC [Rhodospirillum
           centenum SW]
 gi|209959035|gb|ACI99671.1| GTP-binding protein, putative [Rhodospirillum centenum SW]
          Length = 224

 Score =  171 bits (432), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 111/193 (57%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F  G P    LP+A  PE+ F+GRSNVGKSSL+N L  R  LARTS  PGRTQ LNFF  
Sbjct: 33  FFWGAPAASELPEADLPEVCFAGRSNVGKSSLVNALTGRVTLARTSQTPGRTQQLNFF-- 90

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               NL + L    LVDMPGYGYA+  K+   +W      YL  R TLR   +L+D RHG
Sbjct: 91  ----NLGDRL---VLVDMPGYGYAKVSKETSSAWTDFAKSYLKGRVTLRRALVLVDSRHG 143

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K  D D+   +D+ AV+YQIVLTK DKL+              +  +P AHPEV+ TSS
Sbjct: 144 LKPQDIDMMKMMDQAAVAYQIVLTKADKLTDKALVHARAAVAAALVKHPAAHPEVMATSS 203

Query: 194 VKRKGIEVLRKAI 206
               GI  LR  +
Sbjct: 204 ESGLGIAELRATL 216


>gi|126728215|ref|ZP_01744031.1| GTP-binding protein [Sagittula stellata E-37]
 gi|126711180|gb|EBA10230.1| GTP-binding protein [Sagittula stellata E-37]
          Length = 216

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 118/193 (61%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+GV  +  LP     E+ F+GRSNVGKSSLIN L  RK LAR SN PGRTQ +N+F  
Sbjct: 29  FLKGVVAMDGLPPDDRAEVCFAGRSNVGKSSLINALTGRKGLARASNTPGRTQEINYFTL 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                         LVD+PGYG+A AP   V  W  L+  YL+ R +LR  ++LID RHG
Sbjct: 89  GS---------ERYLVDLPGYGFANAPVAVVAKWQALLKAYLAGRVSLRRAFVLIDHRHG 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D ++ + LD+ AV++Q+V+TK DK+      + LE+ +  +  +P A+PE++ TSS
Sbjct: 140 VKAVDNEIMTLLDRSAVTFQVVMTKADKVKGAEHDKILEQVRGQLAKHPAAYPEIVVTSS 199

Query: 194 VKRKGIEVLRKAI 206
            K  GI  LR  I
Sbjct: 200 EKGDGIGTLRSII 212


>gi|85709447|ref|ZP_01040512.1| GTP-binding protein [Erythrobacter sp. NAP1]
 gi|85688157|gb|EAQ28161.1| GTP-binding protein [Erythrobacter sp. NAP1]
          Length = 229

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 116/194 (59%), Gaps = 3/194 (1%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++  LP    PE+AF GRSNVGKSSL+N L  RK +AR S  PGRTQ LNFF  
Sbjct: 27  FLLSAPQLKFLPDPICPEVAFCGRSNVGKSSLLNALTGRKAIARASVTPGRTQELNFF-- 84

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D        P   LVDMPGYG+A+AP K V+ W  L+  YL  R  L    +L+D RHG
Sbjct: 85  -DVGGEPGGKPLFRLVDMPGYGFAKAPVKVVERWKNLVKSYLRGRPVLARNLVLVDSRHG 143

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D+++   LD+ AV Y+IVLTK DK+  +  +    K     R +  A+PE+  TSS
Sbjct: 144 LKDVDREMMKMLDEAAVGYRIVLTKTDKIKASELERVANKVADEARKHVAAYPELHLTSS 203

Query: 194 VKRKGIEVLRKAIL 207
            K  GIE LR A++
Sbjct: 204 EKGMGIEALRAAVV 217


>gi|114765425|ref|ZP_01444540.1| GTP-binding protein [Pelagibaca bermudensis HTCC2601]
 gi|114542268|gb|EAU45298.1| GTP-binding protein [Roseovarius sp. HTCC2601]
          Length = 217

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 121/193 (62%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+GV  +  LP     E+ F+GRSNVGKSSLIN L  RK +AR SN PGRTQ +NFF  
Sbjct: 30  FLKGVVGMDGLPPDDRVEVCFAGRSNVGKSSLINALTGRKGIARASNTPGRTQEINFFTL 89

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            LVD+PGYG+A AP   V+ W  L+ +YLS R +LR  ++LID RHG
Sbjct: 90  GE---------ERYLVDLPGYGFANAPVAVVEKWQRLLKQYLSGRVSLRRAFVLIDARHG 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK +D+++ + LD+ AV++Q VLTK DK+     ++ L + +  +  +P A PE++ TSS
Sbjct: 141 VKPVDEEIMTLLDRSAVTFQAVLTKADKVKEKGREKVLAQVREKLAKHPAAFPELVLTSS 200

Query: 194 VKRKGIEVLRKAI 206
            K  GI +LR  I
Sbjct: 201 EKGDGIALLRAII 213


>gi|167644607|ref|YP_001682270.1| ribosome biogenesis GTP-binding protein YsxC [Caulobacter sp. K31]
 gi|167347037|gb|ABZ69772.1| GTP-binding protein HSR1-related [Caulobacter sp. K31]
          Length = 214

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 119/195 (61%), Gaps = 9/195 (4%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
            +F+ G  ++  +P A  PE+AF+GRSNVGKSSLIN LV + +LAR SN+PGRT+ +NFF
Sbjct: 23  CLFMMGAVKMDGMPTADFPEVAFAGRSNVGKSSLINGLVGQNHLARASNSPGRTREVNFF 82

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
           V  +          + LVD+PGYG+AR  K   D +  L   YL  R  L+ VYLLID R
Sbjct: 83  VLAE---------KLRLVDLPGYGFARVSKTVADKFQDLGRAYLRGRVNLKRVYLLIDAR 133

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K +D +    LD  AVSYQIVLTK DK+ P   +  +  T+  I   P A P+V+ T
Sbjct: 134 HGLKSVDTEALDALDVAAVSYQIVLTKADKIKPAEVEAVVAATQKAIAKRPAAFPKVLAT 193

Query: 192 SSVKRKGIEVLRKAI 206
           SS K  G+  LR  I
Sbjct: 194 SSEKGDGLPELRAEI 208


>gi|197103855|ref|YP_002129232.1| GTP-binding protein CgpA [Phenylobacterium zucineum HLK1]
 gi|196477275|gb|ACG76803.1| GTP-binding protein CgpA [Phenylobacterium zucineum HLK1]
          Length = 213

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 116/194 (59%), Gaps = 9/194 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL G   I  LP    PE+AF+GRSNVGKSSLIN +  RK+LAR SN PGRT+ +NFFV 
Sbjct: 24  FLMGAVAISGLPDPDLPEVAFAGRSNVGKSSLINAVTGRKDLARASNEPGRTREVNFFVA 83

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +          + LVD+PGYG+ARA K     +  L   YL  R  L+ VYLLID RHG
Sbjct: 84  DE---------KLRLVDLPGYGWARASKSVARKFQNLGRDYLRGRPNLKRVYLLIDARHG 134

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D++    LD  AVSYQIVLTK DKL     ++ + +T   +   P A P V+ TSS
Sbjct: 135 LKDVDKEALDALDVAAVSYQIVLTKADKLRAAEVEKVVAETLQKVSKRPAAFPRVLATSS 194

Query: 194 VKRKGIEVLRKAIL 207
            K  GI  LR  IL
Sbjct: 195 EKGTGIPELRAEIL 208


>gi|86747808|ref|YP_484304.1| ribosome biogenesis GTP-binding protein YsxC [Rhodopseudomonas
           palustris HaA2]
 gi|119369244|sp|Q2J2B7|ENGB_RHOP2 RecName: Full=Probable GTP-binding protein EngB
 gi|86570836|gb|ABD05393.1| GTP-binding [Rhodopseudomonas palustris HaA2]
          Length = 216

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 123/200 (61%), Gaps = 7/200 (3%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           W F+   P I  LP     E+AF+GRSNVGKSSLIN L  R  LARTS+ PGRTQ L FF
Sbjct: 21  WHFIWASPSIETLPPMDGLEVAFAGRSNVGKSSLINALTGRNALARTSHTPGRTQELIFF 80

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                + L+       LVDMPGYGYA A K  V SW  LI ++L  R+TL  VY+LID R
Sbjct: 81  DGPPGAGLR-------LVDMPGYGYAAASKAKVASWTSLIHKFLQGRATLARVYVLIDGR 133

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
           HG+K +D D+   LDK AVSYQIVLTK D++      E ++ T+  +  +P A PE++ T
Sbjct: 134 HGLKDVDLDILKTLDKAAVSYQIVLTKADQVKAAELAERVDATRTALAKHPAAFPELLTT 193

Query: 192 SSVKRKGIEVLRKAILETIN 211
           SS    G+  LR A++  ++
Sbjct: 194 SSRTGAGMPELRAAMIRLLD 213


>gi|114569008|ref|YP_755688.1| ribosome biogenesis GTP-binding protein YsxC [Maricaulis maris
           MCS10]
 gi|119369211|sp|Q0ASI7|ENGB_MARMM RecName: Full=Probable GTP-binding protein EngB
 gi|114339470|gb|ABI64750.1| GTP-binding protein [Maricaulis maris MCS10]
          Length = 191

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 116/184 (63%), Gaps = 8/184 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+    E+AF+GRSNVGKSSLIN L N+K LAR S  PGRT+ LNFF      N++   
Sbjct: 9   LPEPDRLEVAFAGRSNVGKSSLINALTNQKGLARASGEPGRTRELNFF------NVEGG- 61

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + +VD+PGYGYA+APK  V+ W  L   +L  R  L+ VYLLID RHG+K +D  +  
Sbjct: 62  -DLRIVDLPGYGYAKAPKPVVEKWTRLTKAFLRGRVNLKRVYLLIDSRHGLKDVDLKIMD 120

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
             D+ AVSYQ+VLTK DK+ P   +  + +T   I   P A P VI TSS K+ G++ LR
Sbjct: 121 VFDEAAVSYQVVLTKTDKIKPPAVKRLIGETGEKIARRPAAFPRVIATSSAKQDGVDQLR 180

Query: 204 KAIL 207
             I+
Sbjct: 181 AEIV 184


>gi|296444655|ref|ZP_06886619.1| ribosome biogenesis GTP-binding protein YsxC [Methylosinus
           trichosporium OB3b]
 gi|296257923|gb|EFH04986.1| ribosome biogenesis GTP-binding protein YsxC [Methylosinus
           trichosporium OB3b]
          Length = 219

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 91/183 (49%), Positives = 113/183 (61%), Gaps = 4/183 (2%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP  GPPEIAF+GRSNVGKSSL+N L  RK LAR SN PGRTQ LNFF        +   
Sbjct: 32  LPPIGPPEIAFAGRSNVGKSSLLNALTGRKTLARVSNTPGRTQQLNFFA----VGAEPGA 87

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + LVDMPGYGYA   K+ V SW  L+  +L  R++L  V++LID R G+K++D+++  
Sbjct: 88  EPLRLVDMPGYGYAAVGKEKVASWTRLMEDFLRGRASLARVFVLIDSRRGIKEMDEEMLD 147

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
            LDK AVSYQIVLTK D+L        L   +  +   P A P+V  TSS   +GI  LR
Sbjct: 148 LLDKSAVSYQIVLTKRDELKLAERAAALAAAEAALAKRPAAFPQVAATSSRDGEGIAELR 207

Query: 204 KAI 206
             I
Sbjct: 208 AGI 210


>gi|296283113|ref|ZP_06861111.1| ribosome biogenesis GTP-binding protein YsxC [Citromicrobium
           bathyomarinum JL354]
          Length = 218

 Score =  167 bits (423), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 87/194 (44%), Positives = 117/194 (60%), Gaps = 7/194 (3%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++  LP+   PEIA +GRSNVGKSSL+N L  RK +AR S  PGRTQ LN F  
Sbjct: 26  FLLSAPQLKFLPEPTVPEIALAGRSNVGKSSLLNALTMRKGIARASVTPGRTQELNIFEV 85

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
              +  +       LVDMPGYG+A+APK  V+ W  ++  YL  R  L    +L+D RHG
Sbjct: 86  GQPTQFR-------LVDMPGYGFAKAPKSVVEKWQNVVRTYLRGRPVLARALVLVDSRHG 138

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K  D+ +   LD+ AV Y+IVLTK DK+  +   ET +K     + +P A+PE+  TS+
Sbjct: 139 LKDTDRAMMKMLDEAAVGYRIVLTKSDKIKASALAETHDKVAAEAKKHPAAYPEIHLTSA 198

Query: 194 VKRKGIEVLRKAIL 207
            K +GI  LR AI+
Sbjct: 199 EKGQGIAALRAAIV 212


>gi|163795446|ref|ZP_02189413.1| acetylglutamate kinase [alpha proteobacterium BAL199]
 gi|159179432|gb|EDP63963.1| acetylglutamate kinase [alpha proteobacterium BAL199]
          Length = 214

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 89/183 (48%), Positives = 110/183 (60%), Gaps = 9/183 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP  G PE+AF+GRSNVGKSSL+N L  RK+LARTSN PGRTQ L FF      +L + L
Sbjct: 36  LPPLGLPEVAFAGRSNVGKSSLVNALTGRKSLARTSNTPGRTQELIFF------DLGSRL 89

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYA+  K  V  W   +  YL  R++L  V LLID RHG K ID +   
Sbjct: 90  ---QLVDLPGYGYAKVSKTKVQLWTDTLFAYLRGRTSLHRVNLLIDSRHGPKDIDNEAMD 146

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
             D+ A+SYQI+LTK DK  P+   E +E     +   P AHP++  TSS    GI  LR
Sbjct: 147 LFDRAALSYQIILTKADKPKPSELAELIESLGAALAKRPAAHPQIRATSSFSGDGIAELR 206

Query: 204 KAI 206
             +
Sbjct: 207 AEL 209


>gi|329888536|ref|ZP_08267134.1| ribosome biogenesis GTP-binding protein YsxC [Brevundimonas
           diminuta ATCC 11568]
 gi|328847092|gb|EGF96654.1| ribosome biogenesis GTP-binding protein YsxC [Brevundimonas
           diminuta ATCC 11568]
          Length = 222

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 99/208 (47%), Positives = 122/208 (58%), Gaps = 10/208 (4%)

Query: 2   VSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNA 61
            +  +F + A  F+ G  +I  LP    PEIAF+GRSNVGKSSLIN LV    LAR SN 
Sbjct: 19  AARVLFARQAS-FVLGCAKIEQLPTPDLPEIAFAGRSNVGKSSLINGLVGMHKLARASNE 77

Query: 62  PGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTL 121
           PGRT+ +NFF      +L      M LVD+PGYG+A+A K  V  +  L   YL  R TL
Sbjct: 78  PGRTREVNFF------DLDGR---MRLVDLPGYGWAKASKTTVKKFQDLGRDYLRGRVTL 128

Query: 122 RCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY 181
           + VYLLID RHG+K++D +    LD  AVSYQIVLTK DKL    A++    T   I   
Sbjct: 129 KRVYLLIDSRHGLKKVDDEALDALDLSAVSYQIVLTKADKLKKGEAEKVQAATLKAISKR 188

Query: 182 PTAHPEVIPTSSVKRKGIEVLRKAILET 209
           P A+P V  TSS K  G+  LR  I+ T
Sbjct: 189 PAAYPHVAVTSSEKGFGLPELRAEIMRT 216


>gi|170749902|ref|YP_001756162.1| ribosome biogenesis GTP-binding protein YsxC [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656424|gb|ACB25479.1| GTP-binding protein HSR1-related [Methylobacterium radiotolerans
           JCM 2831]
          Length = 217

 Score =  166 bits (419), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 109/183 (59%), Gaps = 9/183 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP     EIAF+GRSNVGKSSLIN L  R  LARTS+ PGRTQ LNFF   +        
Sbjct: 35  LPPMEGVEIAFAGRSNVGKSSLINALTGRNTLARTSHTPGRTQQLNFFRIGE-------- 86

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             ++LVDMPGYGYA   K  V++W  LI  YL  R+ L  V++LID RHG K ID DV  
Sbjct: 87  -RLSLVDMPGYGYAAVEKAKVEAWTRLIHSYLKGRTNLARVFMLIDARHGFKSIDTDVLD 145

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
            LDK AVSYQ+VLTK D L        +   +  +   P A+P+VI TSS    G+  LR
Sbjct: 146 GLDKAAVSYQVVLTKGDSLKKGEVASRIAGIEAGLAKRPAAYPQVILTSSRDDSGVPDLR 205

Query: 204 KAI 206
            AI
Sbjct: 206 AAI 208


>gi|149186359|ref|ZP_01864672.1| GTP-binding protein [Erythrobacter sp. SD-21]
 gi|148829948|gb|EDL48386.1| GTP-binding protein [Erythrobacter sp. SD-21]
          Length = 217

 Score =  166 bits (419), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 85/194 (43%), Positives = 120/194 (61%), Gaps = 7/194 (3%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++  LP+   PEIAF+GRSNVGKSSL+N L  R+ +AR S  PGRTQ LNFF  
Sbjct: 26  FLLSAPQLKFLPEPTVPEIAFAGRSNVGKSSLLNALTGRRKIARASVTPGRTQELNFFEV 85

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            + +  +       LVDMPGYG+A+AP K V+ W  L+  YL  R  L    +L+D RHG
Sbjct: 86  GEPTQFR-------LVDMPGYGFAKAPVKVVEKWKNLVKTYLRGRQVLVRNLVLVDSRHG 138

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D+++   LD+ AV Y++VLTK DK+  +   +T+   +   + +  A+P++  TSS
Sbjct: 139 LKDVDREMMKMLDEAAVGYRVVLTKADKIKASELAKTVAAVEAEAKKHVAAYPQIHVTSS 198

Query: 194 VKRKGIEVLRKAIL 207
            K  GI  LR A+L
Sbjct: 199 EKGMGIGELRAALL 212


>gi|254419207|ref|ZP_05032931.1| GTPase, putative [Brevundimonas sp. BAL3]
 gi|196185384|gb|EDX80360.1| GTPase, putative [Brevundimonas sp. BAL3]
          Length = 217

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 99/208 (47%), Positives = 120/208 (57%), Gaps = 10/208 (4%)

Query: 2   VSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNA 61
            +  +F + A  F+ G  +I  LP    PEIAF+GRSNVGKSSLIN LV    LAR SN 
Sbjct: 14  AARILFARPA-TFIMGAAKIEQLPDPDLPEIAFAGRSNVGKSSLINGLVGMHKLARASNE 72

Query: 62  PGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTL 121
           PGRT+ +NFF      +L      M LVD+PGYG+A+A K  V  +  L   YL  R TL
Sbjct: 73  PGRTREVNFF------DLDGR---MRLVDLPGYGWAKASKTTVRKFQDLGRDYLRGRVTL 123

Query: 122 RCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY 181
           + VYLLID RHG+K +D++    LD  AVSYQIVLTK DKL     +   E T   I   
Sbjct: 124 KRVYLLIDSRHGLKSVDKEALDALDLAAVSYQIVLTKADKLKKGEGEAVQEATLKAISKR 183

Query: 182 PTAHPEVIPTSSVKRKGIEVLRKAILET 209
           P A P V  TSS K  G+  LR  I+ T
Sbjct: 184 PAAFPVVALTSSEKGLGLPELRAEIMRT 211


>gi|58040259|ref|YP_192223.1| ribosome biogenesis GTP-binding protein YsxC [Gluconobacter oxydans
           621H]
 gi|81556980|sp|Q5FPX9|ENGB_GLUOX RecName: Full=Probable GTP-binding protein EngB
 gi|58002673|gb|AAW61567.1| Probable GTP-binding protein EngB [Gluconobacter oxydans 621H]
          Length = 227

 Score =  164 bits (416), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 117/193 (60%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F  G  +I  LP  G PE+AF+GRSNVGKSS+IN L  R+ LAR S+ PGRT+ LNFF  
Sbjct: 27  FFFGSQKIDQLPPVGRPEVAFAGRSNVGKSSIINALTGRRALARASSEPGRTKQLNFF-- 84

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               NL + L   +LVDMPGYG+A+A K   + W  ++  YL  R+TL  V LL+D R  
Sbjct: 85  ----NLADRL---SLVDMPGYGFAKAAKSVKEDWQDMMFAYLRGRTTLERVILLLDARIE 137

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K  D+DV   LD+ AV +QIVLTK D++ P      + + + L   +  A+P +I TSS
Sbjct: 138 LKASDKDVMELLDRAAVVFQIVLTKCDQVKPKALAAKIAEVEALALKHAAAYPRIIATSS 197

Query: 194 VKRKGIEVLRKAI 206
               GIE LR  I
Sbjct: 198 ETGFGIEDLRAEI 210


>gi|304570792|ref|YP_002516178.2| ribosome biogenesis GTP-binding protein YsxC [Caulobacter
           crescentus NA1000]
          Length = 229

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 121/202 (59%), Gaps = 9/202 (4%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +F      F+ G   +  +P +  PE+AF+GRSNVGKSSLIN LVN+K LAR SN PGRT
Sbjct: 31  VFFAQPVSFIMGAVRMDAMPPSDLPEVAFAGRSNVGKSSLINGLVNQKYLARASNEPGRT 90

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           + +NFF+  +          + LVD+PGYG+AR  +   D +  L   YL  R+ L+ VY
Sbjct: 91  REINFFLLAE---------KVRLVDLPGYGFARVSRSIADKFQDLGRAYLRGRANLKRVY 141

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K++D +    LD  AVSYQIVLTK DK+ P    + + +T+  I     A 
Sbjct: 142 VLIDARHGLKKVDLEALDALDVAAVSYQIVLTKADKIKPAEVDKVVAETQKAIAKRAAAF 201

Query: 186 PEVIPTSSVKRKGIEVLRKAIL 207
           P V+ TSS K  G+  LR  I+
Sbjct: 202 PRVLATSSEKGLGMPELRAEIV 223


>gi|3820578|gb|AAC69623.1| GTP-binding protein [Caulobacter vibrioides]
          Length = 199

 Score =  164 bits (414), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 119/194 (61%), Gaps = 9/194 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   +  +P +  PE+AF+GRSNVGKSSLIN LVN+K LAR SN PGRT+ +NFF+ 
Sbjct: 9   FIMGAVRMDAMPPSDLPEVAFAGRSNVGKSSLINGLVNQKYLARASNEPGRTRQINFFLL 68

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +          + LVD+PGYG+AR  +   D +  L   YL  R+ L+ VY+LID RHG
Sbjct: 69  AE---------KVRLVDLPGYGFARVSRSIADKFQDLGRAYLRGRANLKRVYVLIDARHG 119

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K++D +    LD  AVSYQIVLTK DK+ P    + + +T+  I     A P V+ TSS
Sbjct: 120 LKKVDLEALDALDVAAVSYQIVLTKADKIKPAEVDKVVAETQKAIAKRAAAFPRVLATSS 179

Query: 194 VKRKGIEVLRKAIL 207
            K  G+  LR  I+
Sbjct: 180 EKGLGMPELRAEIV 193


>gi|16125019|ref|NP_419583.1| GTPase EngB [Caulobacter crescentus CB15]
 gi|13638031|sp|Q9ZG89|ENGB_CAUCR RecName: Full=GTP-binding protein EngB; AltName: Full=GTP-binding
           protein CgpA
 gi|254783191|sp|B8H1E7|ENGB_CAUCN RecName: Full=Probable GTP-binding protein EngB
 gi|13422003|gb|AAK22751.1| GTP-binding protein CgpA [Caulobacter crescentus CB15]
 gi|220962914|gb|ACL94270.1| GTP-binding protein YihA [Caulobacter crescentus NA1000]
          Length = 199

 Score =  164 bits (414), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 119/194 (61%), Gaps = 9/194 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   +  +P +  PE+AF+GRSNVGKSSLIN LVN+K LAR SN PGRT+ +NFF+ 
Sbjct: 9   FIMGAVRMDAMPPSDLPEVAFAGRSNVGKSSLINGLVNQKYLARASNEPGRTREINFFLL 68

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +          + LVD+PGYG+AR  +   D +  L   YL  R+ L+ VY+LID RHG
Sbjct: 69  AE---------KVRLVDLPGYGFARVSRSIADKFQDLGRAYLRGRANLKRVYVLIDARHG 119

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K++D +    LD  AVSYQIVLTK DK+ P    + + +T+  I     A P V+ TSS
Sbjct: 120 LKKVDLEALDALDVAAVSYQIVLTKADKIKPAEVDKVVAETQKAIAKRAAAFPRVLATSS 179

Query: 194 VKRKGIEVLRKAIL 207
            K  G+  LR  I+
Sbjct: 180 EKGLGMPELRAEIV 193


>gi|295690948|ref|YP_003594641.1| ribosome biogenesis GTP-binding protein YsxC [Caulobacter segnis
           ATCC 21756]
 gi|295432851|gb|ADG12023.1| ribosome biogenesis GTP-binding protein YsxC [Caulobacter segnis
           ATCC 21756]
          Length = 220

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 90/202 (44%), Positives = 119/202 (58%), Gaps = 9/202 (4%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +F      F+ G   +  +P    PE+AF+GRSNVGKSSLIN LVN+K LAR SN PGRT
Sbjct: 22  VFFAQPVSFIMGAVRMDAMPAPDLPEVAFAGRSNVGKSSLINGLVNQKYLARASNEPGRT 81

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           + +NFF+  +          + LVD+PGYG+AR  +   D +  L   YL  R+ L+ VY
Sbjct: 82  REINFFLLAE---------QVRLVDLPGYGFARVSRSIADKFQDLGRAYLRGRANLKRVY 132

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           +LID RHG+K++D +    LD  AVSYQIVLTK DK+ P    + +  T   I   P A 
Sbjct: 133 VLIDARHGLKKVDLEALDALDVAAVSYQIVLTKSDKIKPAEVDKVVADTLKAIAKRPAAF 192

Query: 186 PEVIPTSSVKRKGIEVLRKAIL 207
           P V+ TSS K  G+  LR  I+
Sbjct: 193 PRVLATSSEKGLGLPELRAEIV 214


>gi|294085068|ref|YP_003551828.1| GTP-binding protein, HSR1-like protein [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664643|gb|ADE39744.1| GTP-binding protein, HSR1-related protein [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 219

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/183 (46%), Positives = 114/183 (62%), Gaps = 9/183 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP  G PEI F+GRSNVGKSSL+N L  R+ LARTS  PGRT+ L FF      +L   L
Sbjct: 39  LPPMGLPEICFAGRSNVGKSSLVNALTGRRMLARTSQTPGRTRQLIFF------DLGQRL 92

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYA APK ++++W  L  ++L+ R +L+ V+LLID R GV + D ++  
Sbjct: 93  ---GLVDLPGYGYASAPKTDIEAWTKLTRKFLAGRQSLQRVFLLIDARRGVGKGDSEIMK 149

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
            LD+ AVS+  VLTK DKL P   ++    T+  +  +  A+PE+  TSS    GIE LR
Sbjct: 150 LLDESAVSWAAVLTKADKLKPEALEKVCRATEATVATHVAAYPELFVTSSQAGDGIEHLR 209

Query: 204 KAI 206
             I
Sbjct: 210 GHI 212


>gi|258541763|ref|YP_003187196.1| ribosome biogenesis GTP-binding protein YsxC [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256632841|dbj|BAH98816.1| GTP-binding protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635898|dbj|BAI01867.1| GTP-binding protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638953|dbj|BAI04915.1| GTP-binding protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642007|dbj|BAI07962.1| GTP-binding protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645062|dbj|BAI11010.1| GTP-binding protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648117|dbj|BAI14058.1| GTP-binding protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651170|dbj|BAI17104.1| GTP-binding protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654161|dbj|BAI20088.1| GTP-binding protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 227

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 117/195 (60%), Gaps = 9/195 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G  ++G LP    PEIAF+GRSNVGKSSL+N L  RK LAR S+ PGRT+ LNFF  
Sbjct: 35  FVFGAQKLGQLPPQTLPEIAFAGRSNVGKSSLVNALTGRKTLARASSEPGRTKQLNFF-- 92

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               NL + L    LVDMPGYGYA+A K   + W  ++  YL  R +L+ V LL+D R  
Sbjct: 93  ----NLADRL---MLVDMPGYGYAKAAKSVKEDWQDMMFDYLRGRPSLQRVVLLLDARVE 145

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K  D +V   LDK AVS+Q+VLTK D + P        + +  IR +P A P +  TSS
Sbjct: 146 MKAHDLEVMDLLDKAAVSFQVVLTKCDSVKPGPLARKQAEVEAEIRRHPAAFPYLSLTSS 205

Query: 194 VKRKGIEVLRKAILE 208
              +GIE LR  + E
Sbjct: 206 QTGEGIEGLRAELAE 220


>gi|329114453|ref|ZP_08243215.1| Putative GTP-binding protein EngB [Acetobacter pomorum DM001]
 gi|326696529|gb|EGE48208.1| Putative GTP-binding protein EngB [Acetobacter pomorum DM001]
          Length = 227

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 91/195 (46%), Positives = 116/195 (59%), Gaps = 9/195 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   +G LP    PEIAF+GRSNVGKSSL+N L  RK LAR S+ PGRT+ LNFF  
Sbjct: 35  FVFGAQRLGQLPPQTLPEIAFAGRSNVGKSSLVNALTGRKTLARASSEPGRTKQLNFF-- 92

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               NL + L    LVDMPGYGYA+A K   + W  ++  YL  R +L+ V LL+D R  
Sbjct: 93  ----NLADRL---MLVDMPGYGYAKAAKSVKEDWQDMMFDYLRGRPSLQRVVLLLDARVE 145

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K  D +V   LDK AVS+Q+VLTK D + P        + +  IR +P A P +  TSS
Sbjct: 146 MKAHDLEVMDLLDKAAVSFQVVLTKCDSVKPGPLARKQAEVEAEIRRHPAAFPYLSLTSS 205

Query: 194 VKRKGIEVLRKAILE 208
              +GIE LR  + E
Sbjct: 206 QTGEGIEGLRAELAE 220


>gi|220925224|ref|YP_002500526.1| ribosome biogenesis GTP-binding protein YsxC [Methylobacterium
           nodulans ORS 2060]
 gi|219949831|gb|ACL60223.1| GTP-binding protein HSR1-related [Methylobacterium nodulans ORS
           2060]
          Length = 216

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 95/183 (51%), Positives = 111/183 (60%), Gaps = 9/183 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP     EIAF+GRSNVGKSSLIN L  R  LARTS+ PGRTQ LNFF      +L   L
Sbjct: 35  LPPMQGHEIAFAGRSNVGKSSLINSLTGRTTLARTSHTPGRTQQLNFF------DLGGKL 88

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVDMPGYGYA   K  V +W  LI  YL  R+ L  VY+LID RHG+K  D +V  
Sbjct: 89  ---TLVDMPGYGYAAVSKAKVAAWTELIHAYLQGRANLARVYVLIDARHGIKPNDGEVLD 145

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
            LD  AVSYQIVLTK D L  +  Q  L+ T   +   P A+PE+I TSS   +GI  LR
Sbjct: 146 ELDAAAVSYQIVLTKGDALKKSEIQARLDATSAALARRPAAYPEIILTSSRTGEGIAELR 205

Query: 204 KAI 206
            ++
Sbjct: 206 ASV 208


>gi|302381827|ref|YP_003817650.1| ribosome biogenesis GTP-binding protein YsxC [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192455|gb|ADL00027.1| ribosome biogenesis GTP-binding protein YsxC [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 213

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 96/209 (45%), Positives = 119/209 (56%), Gaps = 12/209 (5%)

Query: 2   VSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNA 61
            +  +F + A  F+ G  +I  LP+   PEIAF+GRSNVGKSSLIN LV    LAR SN 
Sbjct: 11  AARVLFARPA-TFVMGAAKIEQLPEPDLPEIAFAGRSNVGKSSLINGLVGMHKLARASNE 69

Query: 62  PGRTQHLNFFVPKDFSNLKNNLPA-MALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST 120
           PGRT+ +NFF          +L A + LVD+PGYG+A+A K  V  +  L   YL  R T
Sbjct: 70  PGRTREVNFF----------DLDAKLRLVDLPGYGWAKASKSTVRQFQNLGRDYLRGRVT 119

Query: 121 LRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
           L+ VYLLID RHG+K +D +    LD  AVSYQIVLTK DK+           T   I  
Sbjct: 120 LKRVYLLIDARHGLKSVDTEALDALDLAAVSYQIVLTKADKIKAHERDTVQAATLKAISK 179

Query: 181 YPTAHPEVIPTSSVKRKGIEVLRKAILET 209
            P A P V  TS+ K  G+  LR  I+ T
Sbjct: 180 RPAAFPAVAVTSAEKGLGLPELRAEIMRT 208


>gi|330993394|ref|ZP_08317329.1| putative GTP-binding protein engB [Gluconacetobacter sp. SXCC-1]
 gi|329759424|gb|EGG75933.1| putative GTP-binding protein engB [Gluconacetobacter sp. SXCC-1]
          Length = 221

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/198 (43%), Positives = 116/198 (58%), Gaps = 9/198 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G  ++G LP    PEIAF+GRSNVGKSSLIN L  R+ LAR S+ PGRT+ LNFF  
Sbjct: 30  FVFGAQKLGQLPDPILPEIAFAGRSNVGKSSLINALTGRRALARASSEPGRTKQLNFF-- 87

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                + + L    LVDMPGYG+A+A +   + W G++  YL  R TLR V LL+D R  
Sbjct: 88  ----EMAHRL---TLVDMPGYGFAKAARAVKEDWQGMMFSYLRGRPTLRRVVLLLDSRVE 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           VK  D+++   LD+ AV++Q+VLTK D   P      L +   ++  +  A P V+ TSS
Sbjct: 141 VKASDREIMKMLDRAAVTFQVVLTKCDVPKPNALAAKLREVSEIVATHAAAFPHVLATSS 200

Query: 194 VKRKGIEVLRKAILETIN 211
               GIE LR  +    N
Sbjct: 201 ETGLGIEDLRAELARLAN 218


>gi|162147918|ref|YP_001602379.1| ribosome biogenesis GTP-binding protein YsxC [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209542535|ref|YP_002274764.1| ribosome biogenesis GTP-binding protein YsxC [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786495|emb|CAP56077.1| GTP-binding protein engB [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530212|gb|ACI50149.1| GTP-binding protein HSR1-related [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 223

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 111/186 (59%), Gaps = 9/186 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F  G  ++  LP  G PEIAF+GRSNVGKSSLIN L  R+ LAR S+ PGRT+ LNFF  
Sbjct: 31  FFFGAQKLEQLPPPGAPEIAFAGRSNVGKSSLINALTGRRALARASSEPGRTKQLNFF-- 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               +L   L    LVDMPGYGYARA K   + W G++  YL  R TL+ V LL+D R  
Sbjct: 89  ----DLGGRL---TLVDMPGYGYARAAKDVKEDWQGMMFAYLRGRPTLQRVILLLDSRIE 141

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K  D+++ + LD+ AV++QIVLTK D   P   +    +   L R +P A+P    TSS
Sbjct: 142 LKASDREIMTLLDRAAVTFQIVLTKCDAPRPGALEAKRSQAADLARQHPAAYPGTFATSS 201

Query: 194 VKRKGI 199
               GI
Sbjct: 202 DTGLGI 207


>gi|296115060|ref|ZP_06833702.1| ribosome biogenesis GTP-binding protein YsxC [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295978397|gb|EFG85133.1| ribosome biogenesis GTP-binding protein YsxC [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 235

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 85/195 (43%), Positives = 119/195 (61%), Gaps = 9/195 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G  ++G LP    PEIAF+GRSNVGKSSL+N L  R+ LAR S+ PGRT+ LNFF  
Sbjct: 41  FVFGAQKLGQLPDPLLPEIAFAGRSNVGKSSLVNALTGRRTLARASSEPGRTKQLNFF-- 98

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L   L    LVDMPGYG+A+A K   + W G++  +L  R TL+ V LL+D R  
Sbjct: 99  ----ELAGRL---TLVDMPGYGFAKAAKAVKEDWQGMMFSFLRGRPTLKRVVLLLDSRVE 151

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K+ D+++   LD+ AV++QIVLTK D   P      L +T+ +  ++  A+P V+ TSS
Sbjct: 152 IKESDREIMKLLDRAAVTFQIVLTKCDIPKPPVLAAKLRETREIAASHAAAYPLVLVTSS 211

Query: 194 VKRKGIEVLRKAILE 208
              +GI  LR  + +
Sbjct: 212 ANGEGIVELRAELAQ 226


>gi|170743187|ref|YP_001771842.1| ribosome biogenesis GTP-binding protein YsxC [Methylobacterium sp.
           4-46]
 gi|168197461|gb|ACA19408.1| GTP-binding protein HSR1-related [Methylobacterium sp. 4-46]
          Length = 216

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 107/176 (60%), Gaps = 9/176 (5%)

Query: 31  EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVD 90
           EIAF+GRSNVGKSSLIN L  R  LARTS+ PGRTQ LNFF      +L   L    LVD
Sbjct: 42  EIAFAGRSNVGKSSLINALTGRNTLARTSHTPGRTQQLNFF------DLGGKL---TLVD 92

Query: 91  MPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAV 150
           MPGYGYA   K  V SW  LI  YL  R+ L  VY+LID RHG+K  D +V   LD  AV
Sbjct: 93  MPGYGYAAVSKAKVASWTELIHAYLQGRANLARVYVLIDARHGIKPNDGEVLDELDAAAV 152

Query: 151 SYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAI 206
           SYQ+VLTK D L        L+ T   +   P A+PE+I TSS   +GI  LR ++
Sbjct: 153 SYQVVLTKGDDLKKGEVASRLDATAAALARRPAAYPEIILTSSRTGEGIPALRASV 208


>gi|296535612|ref|ZP_06897792.1| ribosome biogenesis GTP-binding protein YsxC [Roseomonas cervicalis
           ATCC 49957]
 gi|296264067|gb|EFH10512.1| ribosome biogenesis GTP-binding protein YsxC [Roseomonas cervicalis
           ATCC 49957]
          Length = 221

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 109/183 (59%), Gaps = 9/183 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+A  PE+AF GRSNVGKSSL+N L  + +LAR S+ PGRT+ LNFF      +L   L
Sbjct: 41  LPEARLPEVAFCGRSNVGKSSLVNALTGQNSLARVSSTPGRTKQLNFF------DLGGRL 94

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
              ALVDMPGYGYA+A K   + W GL+  +L  R  LR V LL+D R   K  D+    
Sbjct: 95  ---ALVDMPGYGYAQASKSVKEDWQGLMFEFLRGRPVLRRVVLLLDARIETKASDRAAME 151

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
            L+  AV++QIVLTK D   P   ++  E+   L++ +  AHP VI TSS    GI  LR
Sbjct: 152 LLNNAAVNFQIVLTKADSAKPYWLKQRQEEAAALVKQHTAAHPLVITTSSETGAGIPELR 211

Query: 204 KAI 206
             +
Sbjct: 212 AEL 214


>gi|218670936|ref|ZP_03520607.1| GTPase EngB [Rhizobium etli GR56]
          Length = 120

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 69/108 (63%), Positives = 82/108 (75%)

Query: 12  WIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF 71
           WIF+RGVP +  LP  GP E+AF+GRSNVGKSSLIN LV +K LARTSN PGRTQ LN+F
Sbjct: 13  WIFIRGVPSLTFLPPEGPSEVAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYF 72

Query: 72  VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERS 119
           VP  +S    +LP MA+VDMPGYGYA+APK+ VD W  L+  YL  R+
Sbjct: 73  VPDGYSGEGGDLPPMAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRA 120


>gi|82948297|dbj|BAE53161.1| GTP-binding protein engB [Magnetospirillum magneticum AMB-1]
          Length = 162

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 83/164 (50%), Positives = 98/164 (59%), Gaps = 9/164 (5%)

Query: 40  VGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARA 99
           +GKSSLIN L  R  LARTSN PGRTQ LNFF      NL   L    LVDMPGYG+A+A
Sbjct: 1   MGKSSLINALTGRNTLARTSNTPGRTQELNFF------NLGGRL---ILVDMPGYGFAQA 51

Query: 100 PKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKI 159
           PK  V+ W  L+  +L  RS LR   +L+D RHG+K  D+D+   LDK AV YQ+VLTK 
Sbjct: 52  PKGLVEKWTRLVNGFLKGRSVLRRAVVLVDSRHGLKDSDRDMMKMLDKAAVVYQVVLTKA 111

Query: 160 DKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           DKL          +T   I+    AHP +I TSS K  GI  LR
Sbjct: 112 DKLKAAELDAVQARTLEEIKGRVAAHPHLIVTSSEKGTGIPELR 155


>gi|148261133|ref|YP_001235260.1| GTPase EngB [Acidiphilium cryptum JF-5]
 gi|326404534|ref|YP_004284616.1| GTP-binding protein EngB [Acidiphilium multivorum AIU301]
 gi|146402814|gb|ABQ31341.1| tRNA modification GTPase trmE [Acidiphilium cryptum JF-5]
 gi|325051396|dbj|BAJ81734.1| GTP-binding protein EngB [Acidiphilium multivorum AIU301]
          Length = 209

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 108/201 (53%), Gaps = 9/201 (4%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +F + A  F       GL P+    EIA +GRSNVGKS+LIN +  +  LAR + APGRT
Sbjct: 13  LFARGARFFHAAQTAEGL-PEPEGIEIALAGRSNVGKSTLINAITGQVALARVAQAPGRT 71

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           + LNFF   D          + +VDMPGYGYA APK     W GL+ RYL  R  LR V 
Sbjct: 72  RQLNFFRIGDGP--------LTIVDMPGYGYAAAPKAVKRDWQGLMFRYLRGRPNLRRVL 123

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
           LL+D R   K  D  V   LD+ AVS+Q+VLTK DK+ P      L     + R +P A 
Sbjct: 124 LLMDARIEDKPADHAVMELLDQAAVSFQVVLTKADKMKPEALASKLASIGAIARRHPAAL 183

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
            EV+ TS     GI  LR  I
Sbjct: 184 NEVLVTSGETGAGIAELRAVI 204


>gi|114797282|ref|YP_759145.1| ribosome biogenesis GTP-binding protein YsxC [Hyphomonas neptunium
           ATCC 15444]
 gi|119369205|sp|Q0C548|ENGB_HYPNA RecName: Full=Probable GTP-binding protein EngB
 gi|114737456|gb|ABI75581.1| GTP-binding protein [Hyphomonas neptunium ATCC 15444]
          Length = 220

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 112/194 (57%), Gaps = 8/194 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ GV  +  LP A   E+ F+GRSNVGKSSLIN L  R  LAR+S  PGRT+ LN+F  
Sbjct: 27  FVMGVVSLSGLPPADRSEVCFAGRSNVGKSSLINALTGRAKLARSSAEPGRTRELNYFDI 86

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D   L        LVD+PG+GYA+  K    +W  LI  YL  R +LR V+LL+D R G
Sbjct: 87  GDEGKLY-------LVDLPGFGYAKVSKTQTAAWTKLIKSYLRGRPSLRRVFLLVDARRG 139

Query: 134 -VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
            +   D++V   +D  AV+YQ+VLTK+DK+     ++ + K    ++    AHP V  TS
Sbjct: 140 DLMDTDEEVMDLMDGAAVTYQVVLTKVDKVPKGEVEKIVVKIADKLKKRGAAHPVVRMTS 199

Query: 193 SVKRKGIEVLRKAI 206
           + K  GI  LR  I
Sbjct: 200 AEKGFGIPELRAEI 213


>gi|114327391|ref|YP_744548.1| ribosome biogenesis GTP-binding protein YsxC [Granulibacter
           bethesdensis CGDNIH1]
 gi|119369200|sp|Q0BU77|ENGB_GRABC RecName: Full=Probable GTP-binding protein EngB
 gi|114315565|gb|ABI61625.1| GTP-binding protein YihA [Granulibacter bethesdensis CGDNIH1]
          Length = 223

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 110/193 (56%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F  G   +  LP     EIAF+GRSNVGKS+L+N L  RK LAR S+ PGRT+ LNFF  
Sbjct: 35  FFHGTQRLDQLPPPMGVEIAFAGRSNVGKSTLVNALTGRKTLARASSQPGRTKQLNFF-- 92

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               NL + L    LVDMPGYGYA+A K   + W GL+  YL  R  LR V LL+D R  
Sbjct: 93  ----NLADQL---VLVDMPGYGYAQAAKDVKEDWQGLMFSYLRGRPNLRRVMLLVDARVE 145

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            K  D  V   LDK AV++Q+V+TK D + PT  Q  +       R +P AHP V  TSS
Sbjct: 146 FKASDIAVMELLDKAAVTFQLVVTKADAVKPTPLQRRVADVYAAARAHPAAHPHVFVTSS 205

Query: 194 VKRKGIEVLRKAI 206
               GI  LR A+
Sbjct: 206 DTGSGIAELRAAL 218


>gi|317057122|ref|YP_004105589.1| ribosome biogenesis GTP-binding protein YsxC [Ruminococcus albus 7]
 gi|315449391|gb|ADU22955.1| ribosome biogenesis GTP-binding protein YsxC [Ruminococcus albus 7]
          Length = 255

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 86/205 (41%), Positives = 118/205 (57%), Gaps = 16/205 (7%)

Query: 7   FTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ 66
           F K+ +I   G  ++  +P++  PE AFSGRSNVGKSSLIN + NRKN+AR S+ PG+T 
Sbjct: 26  FNKAEFITSYG--KLSQIPESDRPEFAFSGRSNVGKSSLINKIFNRKNMARVSSVPGKTV 83

Query: 67  HLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSE-RSTLRCVY 125
            +NFF  +D          +  VD+PGYGYA   K     WG LI  YL++    L  V+
Sbjct: 84  TINFFSVED----------VYFVDLPGYGYANVSKGEKKGWGDLIGGYLADFDRDLELVF 133

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
            LID RH   + D  + ++L    + + IVLTK DKL PT  +E +E  K  I  +   H
Sbjct: 134 QLIDMRHAPSKDDIQMINYLIDNEIPFVIVLTKADKLKPTARKERMEAFKDEIPYFEDIH 193

Query: 186 PEVIPTSSVKRKGIEVLRKAILETI 210
              IP S+V  +G++ L KAI+E I
Sbjct: 194 --CIPFSAVTGEGVDEL-KAIIEEI 215


>gi|320353916|ref|YP_004195255.1| ribosome biogenesis GTP-binding protein YsxC [Desulfobulbus
           propionicus DSM 2032]
 gi|320122418|gb|ADW17964.1| ribosome biogenesis GTP-binding protein YsxC [Desulfobulbus
           propionicus DSM 2032]
          Length = 209

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 99/150 (66%), Gaps = 9/150 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL     IG LP    P+IAF+GRSNVGKSSL+N LV+R NL +TS+ PG+TQ LN+F+ 
Sbjct: 9   FLLSAHAIGQLPAPVYPDIAFAGRSNVGKSSLLNRLVDRSNLVKTSSKPGKTQSLNYFLV 68

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           ++         ++ LVD+PGYGYA+  ++   SW GLI  Y++ RSTL CV ++ID RH 
Sbjct: 69  EE---------SLYLVDLPGYGYAQVSQQTRQSWQGLITEYVTTRSTLACVVVIIDLRHE 119

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
           +KQ+D+++  +L      Y  V TK DKLS
Sbjct: 120 LKQLDRELVDWLRYLDTPYLPVYTKADKLS 149


>gi|225573069|ref|ZP_03781824.1| hypothetical protein RUMHYD_01260 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039575|gb|EEG49821.1| hypothetical protein RUMHYD_01260 [Blautia hydrogenotrophica DSM
           10507]
          Length = 202

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/177 (42%), Positives = 110/177 (62%), Gaps = 11/177 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PEIAF+G+SNVGKSSLIN L+NRK+LARTS+ PG+TQ +NF+   D        
Sbjct: 18  LPENEWPEIAFAGKSNVGKSSLINALMNRKSLARTSSQPGKTQTINFYNIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             M LVD+PGYGYA+  +   + WG LI RYL     LR V+LLID RH   + D+ ++ 
Sbjct: 70  -CMYLVDLPGYGYAKVAQSEKEKWGKLIERYLHSSKMLRAVFLLIDIRHEPSKNDKMMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
           ++  +     I+ TK+DKL  +  Q+ ++  +  +   P +  +VIP S+V ++G E
Sbjct: 129 WIVAQGYEPIIIATKLDKLKRSQVQKHVKMVRQGLSLLPGS--QVIPFSAVTKQGRE 183


>gi|325180055|emb|CCA14457.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 318

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 112/188 (59%), Gaps = 13/188 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PE+AF+GRSN GKSSLIN ++ +  L RTS  PGRTQ LNFF        K +L
Sbjct: 123 LPAWNIPEVAFAGRSNCGKSSLINAILGQPGLVRTSKTPGRTQLLNFF---SVGGKKGSL 179

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST--LRCVYLLIDCRHGVKQIDQDV 141
           PAM++VDMPGYG+A+ PK  VD+W  L+  Y+  R    L+ +++L+D R G+  +DQ+ 
Sbjct: 180 PAMSVVDMPGYGFAKPPKDVVDTWDKLVGGYIERRQAGLLKNLFVLLDARRGITTLDQEF 239

Query: 142 FSFLDKKAVSYQIVLTKIDKLSPTTA-----QETLEKTKYLIRNYPTAHPEVIPTSSVKR 196
             FL++    YQI+ TKID + PT       +E L   +   R     +P V+ TS+ + 
Sbjct: 240 LDFLEEMESLYQIIFTKIDAV-PTAELEKNIREVLNMKELFSRR--GMNPIVLATSTKES 296

Query: 197 KGIEVLRK 204
            GI  +++
Sbjct: 297 FGIRQMQQ 304


>gi|299473548|emb|CBN77943.1| YihA5, YihA/EngB-like GTPase [Ectocarpus siliculosus]
          Length = 690

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 79/183 (43%), Positives = 111/183 (60%), Gaps = 10/183 (5%)

Query: 26  KAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPA 85
           KA  PE+ F GRSNVGKSSL+N+LVNRK LA TS  PG TQH N++     +  +   P+
Sbjct: 469 KAALPEVVFVGRSNVGKSSLVNMLVNRKTLAPTSAVPGFTQHFNYYA---VNKGRRKSPS 525

Query: 86  MALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFL 145
             LVD+PG GYARA    +DSW   + RYL  R  LR V+ LID R G+++ D+ + S +
Sbjct: 526 FFLVDVPGLGYARADDGRMDSWKSTLQRYLGVRENLRVVFHLIDGRTGLQKADEQLISLM 585

Query: 146 ---DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLI--RNYPTAHPEVIPTSSVKRKG-I 199
              ++   SY +V+TK DK++    +   EK +  +    +P   P VIPTS+  R+G +
Sbjct: 586 MNENEGRSSYVVVVTKCDKVNDKKLKGVTEKVRQTLDKNGFPKTTP-VIPTSAKSRQGRV 644

Query: 200 EVL 202
           E+L
Sbjct: 645 ELL 647


>gi|327404186|ref|YP_004345024.1| GTP-binding protein engB [Fluviicola taffensis DSM 16823]
 gi|327319694|gb|AEA44186.1| GTP-binding protein engB [Fluviicola taffensis DSM 16823]
          Length = 204

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 115/198 (58%), Gaps = 13/198 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    +I L P  G PE AF GRSNVGKSSLIN+LV +K++A+TS  PG+TQ +N F  
Sbjct: 8   FIISNTDIKLCPTDGKPEYAFIGRSNVGKSSLINMLVEKKDMAKTSGRPGKTQLINHF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L NN     LVD+PGYGYA+A K + + W   I ++L+ R TL   ++LID R  
Sbjct: 66  -----LINN--EWYLVDLPGYGYAKASKSSRNQWEKFISQFLTRRETLINTFVLIDSRLE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID +  S+  ++ + + IV TKIDKLS +  Q+ L   K  +  Y  A P V  TSS
Sbjct: 119 PQKIDIEFMSWCAEEQLPFSIVFTKIDKLSSSALQKNLAAYKKEMLKYWEALPPVFTTSS 178

Query: 194 VKRKGIEVLRKAILETIN 211
               G    R+ IL  I+
Sbjct: 179 ESHFG----REKILNYID 192


>gi|150388895|ref|YP_001318944.1| GTP-binding protein, HSR1-related [Alkaliphilus metalliredigens
           QYMF]
 gi|166920106|sp|A6TM67|ENGB_ALKMQ RecName: Full=Probable GTP-binding protein EngB
 gi|149948757|gb|ABR47285.1| GTP-binding protein, HSR1-related [Alkaliphilus metalliredigens
           QYMF]
          Length = 208

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 81/185 (43%), Positives = 112/185 (60%), Gaps = 17/185 (9%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-VPKDFSNLKNNL 83
           P+ G PEIA +GRSNVGKSSLIN ++NRK LAR S++PG+T+ LNF+ + K+F       
Sbjct: 19  PEEGLPEIALAGRSNVGKSSLINTILNRKKLARVSSSPGKTRTLNFYLINKEFH------ 72

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYAR  K    SWG ++  YLS R  L  V LLID RH   + DQ ++ 
Sbjct: 73  ----LVDLPGYGYARVSKGEKSSWGKMLETYLSNRPNLYEVVLLIDIRHEPSEQDQQMYQ 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEV 201
           ++        +V TK DK++ +  Q+  +    +IR+     PE  +IP SS+K+ GIE 
Sbjct: 129 WIRHYGYGTIVVATKSDKIARSQHQKHFK----MIRDTLGMSPEDRLIPISSLKKLGIEQ 184

Query: 202 LRKAI 206
           L  A+
Sbjct: 185 LWGAL 189


>gi|307546852|ref|YP_003899331.1| GTPase EngB [Halomonas elongata DSM 2581]
 gi|307218876|emb|CBV44146.1| GTPase EngB [Halomonas elongata DSM 2581]
          Length = 206

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 107/187 (57%), Gaps = 8/187 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P +   P     E+AF+GRSN GKSS IN+L  +K LARTS  PGRTQ +NFF  
Sbjct: 11  FLTSAPTLAQCPADTGAEVAFAGRSNAGKSSAINVLTRQKALARTSKTPGRTQLINFFTL 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D + L+       LVD+PGYGYA+ P      W   +  YL  R++LR + LL+D RH 
Sbjct: 71  GDDTELR-------LVDLPGYGYAKVPDSVKLEWQRHLADYLQRRTSLRGLVLLMDVRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           + + DQ +  + D++ +   I+LTK DKL    A+  L++ +  +R +      +   S+
Sbjct: 124 LTEFDQTMLGWADEQDMPVHILLTKADKLKSGAAKNALQQVRSQLREWEDL-VSIQLFSA 182

Query: 194 VKRKGIE 200
           +K++GIE
Sbjct: 183 LKKQGIE 189


>gi|332828393|gb|EGK01102.1| GTP-binding protein engB [Dysgonomonas gadei ATCC BAA-286]
          Length = 198

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 111/188 (59%), Gaps = 12/188 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G PE AF GRSNVGKSSLIN+L NRK LA TS+ PG+TQ +N F+  D         
Sbjct: 19  PQDGKPEYAFIGRSNVGKSSLINMLTNRKGLAMTSSKPGKTQLINHFIIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  K+  D    +I  Y+  R+ L C++LL+DCRH  +QID +  ++
Sbjct: 70  EWYLVDLPGYGYAQRGKEGRDQIRKIIDSYIINRAELTCLFLLLDCRHEPQQIDIEFMNW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI-EVLR 203
           L ++ V + IV TKIDKLS    ++ +E     ++      P +  +S+  R G  E+L 
Sbjct: 130 LGEEGVPFVIVFTKIDKLSKGALKKNMEAYTDTLKETWEEIPPIFYSSAEHRLGADEIL- 188

Query: 204 KAILETIN 211
              +E IN
Sbjct: 189 -GYIEQIN 195


>gi|42520140|ref|NP_966055.1| GTPase EngB [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|81652806|sp|Q73IC3|ENGB_WOLPM RecName: Full=Probable GTP-binding protein EngB
 gi|42409877|gb|AAS13989.1| GTP-binding protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 197

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 102/167 (61%), Gaps = 8/167 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G  +I  LP    PEIAF+GRSNVGKSSLIN+L+N K  AR S+ PG T+ +NF+  
Sbjct: 11  FIFGASDIKSLPNESAPEIAFAGRSNVGKSSLINLLINSKKAARVSSKPGCTRQINFYSM 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGY+ A K+ +  +  LI  YL +R  LR V++LID + G
Sbjct: 71  YD--------DKFRLVDLPGYGYSHAGKEEIIQYLNLIEYYLIQRENLRRVFVLIDSKVG 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
           +K+ID+D   +L    +++ IVLTKIDK+S  +    +E  +  I N
Sbjct: 123 LKEIDKDFIYWLIYNNINFNIVLTKIDKVSQKSLGAVIEDIQKWINN 169


>gi|86140633|ref|ZP_01059192.1| GTP-binding protein [Leeuwenhoekiella blandensis MED217]
 gi|85832575|gb|EAQ51024.1| GTP-binding protein [Leeuwenhoekiella blandensis MED217]
          Length = 202

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/162 (43%), Positives = 92/162 (56%), Gaps = 9/162 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL     +   PK   PE AF GRSNVGKSSLIN+L +RKNLA+TS  PG+TQ +N FV 
Sbjct: 8   FLVSNSNVAKCPKNKMPEYAFIGRSNVGKSSLINMLTDRKNLAKTSGRPGKTQLINHFVI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                         LVD+PGYGYAR  KK    +   I +Y  ER  L   ++LIDCRH 
Sbjct: 68  NQ---------TWYLVDLPGYGYARVSKKVKKEFQKFITQYFEEREQLVSAFVLIDCRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK 175
            + ID++   +L +K + + I+ TK DKL P   +  +E  K
Sbjct: 119 PQPIDREFMQYLGEKQIPFSIIFTKADKLKPKALERNIENYK 160


>gi|224368192|ref|YP_002602355.1| EngB [Desulfobacterium autotrophicum HRM2]
 gi|259645891|sp|C0QLA5|ENGB_DESAH RecName: Full=Probable GTP-binding protein EngB
 gi|223690908|gb|ACN14191.1| EngB [Desulfobacterium autotrophicum HRM2]
          Length = 194

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 96/141 (68%), Gaps = 9/141 (6%)

Query: 31  EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVD 90
           E+AF+GRSNVGKSSLIN L+NRK+L +TS+ PG TQ +NFF+      L  NL   +LVD
Sbjct: 25  EVAFAGRSNVGKSSLINTLINRKSLVKTSSKPGCTQLINFFL------LNGNL---SLVD 75

Query: 91  MPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAV 150
           +PGYGYA+  KK    WG +I RYL+ R TLR + LLID R   ++ + D+ ++    A+
Sbjct: 76  LPGYGYAKVSKKIRAQWGPMIERYLTVRETLRAIVLLIDMRREPQREELDLINWFTAHAI 135

Query: 151 SYQIVLTKIDKLSPTTAQETL 171
            Y+IVLTK DKLS T  Q+ +
Sbjct: 136 PYRIVLTKADKLSKTKQQKNI 156


>gi|88658079|ref|YP_507406.1| GTPase EngB [Ehrlichia chaffeensis str. Arkansas]
 gi|119369195|sp|Q2GGM7|ENGB_EHRCR RecName: Full=Probable GTP-binding protein EngB
 gi|88599536|gb|ABD45005.1| GTP-binding protein EngB [Ehrlichia chaffeensis str. Arkansas]
          Length = 200

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 119/207 (57%), Gaps = 14/207 (6%)

Query: 5   TIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGR 64
           TI +K    F+ G   I  LP    PEIA +GRSNVGKSSLIN + N K  A+TS+ PG 
Sbjct: 5   TIMSKCE--FMIGATHIKSLPDFSIPEIAIAGRSNVGKSSLINAITNNKKNAKTSSKPGC 62

Query: 65  TQHLNFF-VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRC 123
           T+ +NF+ + KDF         M LVD+PGYGY++A K  ++++  L+  YL     L  
Sbjct: 63  TKQINFYLINKDF---------MVLVDLPGYGYSKADKTTINNYLCLMEYYLLNSRNLLK 113

Query: 124 VYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT 183
           V LLID + G K+ID D  ++L+   + YQ+VLTKIDK+        +   K L  ++  
Sbjct: 114 VILLIDAKVGFKEIDLDFINWLELHQIHYQLVLTKIDKIKKEMLDVNVNYIKNLNLDF-I 172

Query: 184 AHPEVIPTSSVKRKGIEVLRKAILETI 210
            +P +I TSS  ++GIE L   I + I
Sbjct: 173 MYP-IISTSSQCKQGIEELIYEIAQCI 198


>gi|302335290|ref|YP_003800497.1| ribosome biogenesis GTP-binding protein YsxC [Olsenella uli DSM
           7084]
 gi|301319130|gb|ADK67617.1| ribosome biogenesis GTP-binding protein YsxC [Olsenella uli DSM
           7084]
          Length = 194

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 110/189 (58%), Gaps = 13/189 (6%)

Query: 21  IGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK 80
           +G LP+   PE+AF+GRSNVGKSSL+N LV RK LAR S+ PG+T ++NFF         
Sbjct: 17  VGQLPEPTTPEVAFAGRSNVGKSSLLNRLVGRKALARVSSQPGKTANINFF--------- 67

Query: 81  NNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQD 140
            ++  +  VD+PGYG+A+  ++    W  LI  Y ++  +   V  L+D RH  +Q+D+D
Sbjct: 68  -DVDGVRFVDLPGYGFAKVSQRERRRWADLIGGYFAQGRSFNLVVSLVDIRHDAQQLDRD 126

Query: 141 VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
           +  FL +  + Y + LTK DKLS   A+++ ++   L R +      +I TSS    GI 
Sbjct: 127 MLGFLTENELPYVVALTKADKLS--RARQS-QQAAALARQFGIDRTRMIVTSSETGLGIG 183

Query: 201 VLRKAILET 209
            LR+ I E 
Sbjct: 184 ELRRVIEEA 192


>gi|223939366|ref|ZP_03631245.1| GTP-binding protein HSR1-related [bacterium Ellin514]
 gi|223891970|gb|EEF58452.1| GTP-binding protein HSR1-related [bacterium Ellin514]
          Length = 196

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 109/199 (54%), Gaps = 9/199 (4%)

Query: 13  IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           +F    P +   P+   PE AF GRSNVGKSSL+N+L  RK+LAR S  PG T+ +NFF 
Sbjct: 7   VFEVSAPNLETCPEETLPEFAFIGRSNVGKSSLVNLLAGRKDLARVSKVPGYTKLINFFT 66

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
                       A  LVD+PGYGYA   ++N   +   +  YL++RS L CV++LID RH
Sbjct: 67  INK---------AWRLVDLPGYGYAHIARENSARFNDAVSNYLAKRSNLYCVFVLIDSRH 117

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
             ++ID +   +L +++    ++ TK DK+     Q  ++  K  I  +    PE++  S
Sbjct: 118 KPQKIDLEFVQWLGEQSAPCALIFTKTDKVKAAQLQTNMDLFKESISGWFENVPEILSCS 177

Query: 193 SVKRKGIEVLRKAILETIN 211
           SV + G+  +   I E ++
Sbjct: 178 SVTKNGVREILNVIDEALS 196


>gi|126700919|ref|YP_001089816.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           630]
 gi|260684844|ref|YP_003216129.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           CD196]
 gi|260688502|ref|YP_003219636.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           R20291]
 gi|115252356|emb|CAJ70197.1| GTP-binding protein EngB; putative endoglucanase [Clostridium
           difficile]
 gi|260211007|emb|CBA66315.1| probable GTP-binding protein [Clostridium difficile CD196]
 gi|260214519|emb|CBE07030.1| probable GTP-binding protein [Clostridium difficile R20291]
          Length = 194

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 110/187 (58%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA +GRSNVGKSS+IN L+NR+N ARTS  PG+T+ +NF+       L NN  
Sbjct: 10  PAEGIPEIALAGRSNVGKSSIINTLLNRRNFARTSQTPGKTRTINFY-------LINN-- 60

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K   + WGG++ RYL  R  L  ++LL+D RH     D+ ++ +
Sbjct: 61  EFYFVDLPGYGYAKIAKSEKEKWGGIMERYLESRQELCSIFLLVDIRHEPTADDKLMYEW 120

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           +     +  ++ TK DK+S    Q+ +   +  ++    +  +VIP SS+K+ G+E L +
Sbjct: 121 IKHFGYNCVVIATKADKISRGQYQKHISIIRKKLQ--MESSEKVIPVSSLKKTGVEELWE 178

Query: 205 AILETIN 211
            I+   N
Sbjct: 179 EIVNQYN 185


>gi|254976899|ref|ZP_05273371.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           QCD-66c26]
 gi|255094286|ref|ZP_05323764.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           CIP 107932]
 gi|255102467|ref|ZP_05331444.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           QCD-63q42]
 gi|255308372|ref|ZP_05352543.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           ATCC 43255]
 gi|255316039|ref|ZP_05357622.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           QCD-76w55]
 gi|255518696|ref|ZP_05386372.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           QCD-97b34]
 gi|255651818|ref|ZP_05398720.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           QCD-37x79]
 gi|255657258|ref|ZP_05402667.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           QCD-23m63]
 gi|306521606|ref|ZP_07407953.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           QCD-32g58]
 gi|119369184|sp|Q180E5|ENGB_CLOD6 RecName: Full=Probable GTP-binding protein EngB
          Length = 203

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 110/187 (58%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA +GRSNVGKSS+IN L+NR+N ARTS  PG+T+ +NF+       L NN  
Sbjct: 19  PAEGIPEIALAGRSNVGKSSIINTLLNRRNFARTSQTPGKTRTINFY-------LINN-- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K   + WGG++ RYL  R  L  ++LL+D RH     D+ ++ +
Sbjct: 70  EFYFVDLPGYGYAKIAKSEKEKWGGIMERYLESRQELCSIFLLVDIRHEPTADDKLMYEW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           +     +  ++ TK DK+S    Q+ +   +  ++    +  +VIP SS+K+ G+E L +
Sbjct: 130 IKHFGYNCVVIATKADKISRGQYQKHISIIRKKLQ--MESSEKVIPVSSLKKTGVEELWE 187

Query: 205 AILETIN 211
            I+   N
Sbjct: 188 EIVNQYN 194


>gi|296451903|ref|ZP_06893619.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           NAP08]
 gi|296879704|ref|ZP_06903679.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           NAP07]
 gi|296259217|gb|EFH06096.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           NAP08]
 gi|296429293|gb|EFH15165.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium difficile
           NAP07]
          Length = 206

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 110/187 (58%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA +GRSNVGKSS+IN L+NR+N ARTS  PG+T+ +NF+       L NN  
Sbjct: 22  PAEGIPEIALAGRSNVGKSSIINTLLNRRNFARTSQTPGKTRTINFY-------LINN-- 72

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K   + WGG++ RYL  R  L  ++LL+D RH     D+ ++ +
Sbjct: 73  EFYFVDLPGYGYAKIAKSEKEKWGGIMERYLESRQELCSIFLLVDIRHEPTADDKLMYEW 132

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           +     +  ++ TK DK+S    Q+ +   +  ++    +  +VIP SS+K+ G+E L +
Sbjct: 133 IKHFGYNCVVIATKADKISRGQYQKHISIIRKKLQ--MESSEKVIPVSSLKKTGVEELWE 190

Query: 205 AILETIN 211
            I+   N
Sbjct: 191 EIVNQYN 197


>gi|92115232|ref|YP_575160.1| cell division checkpoint GTPase YihA [Chromohalobacter salexigens
           DSM 3043]
 gi|119369183|sp|Q1QSU7|ENGB_CHRSD RecName: Full=Probable GTP-binding protein EngB
 gi|91798322|gb|ABE60461.1| cell division checkpoint GTPase YihA [Chromohalobacter salexigens
           DSM 3043]
          Length = 207

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 108/190 (56%), Gaps = 8/190 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P +   P     E+AF+GRSN GKSS IN L  +K LARTS  PGRTQ +NFF  
Sbjct: 14  FLTSAPGLAQCPPDQGAEVAFAGRSNAGKSSAINTLTQQKALARTSKTPGRTQLINFFT- 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L N+     LVD+PGYG+A+ P +    W   +  YL ER+TLR + L++D RH 
Sbjct: 73  -----LAND-ETYRLVDLPGYGFAKVPDQVKLEWQRHLSEYLYERATLRGLMLVMDVRHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           + + DQ +  + D+KA+   I+LTK DKL P  A+  L   +  + ++      V   S+
Sbjct: 127 LSEFDQMMLGWADEKAMPVHILLTKADKLKPGAAKSALLAVRRQLADWEDL-VSVQLFSA 185

Query: 194 VKRKGIEVLR 203
           +KR+G++  R
Sbjct: 186 LKRQGVDEAR 195


>gi|317499960|ref|ZP_07958196.1| ribosome biogenesis GTP-binding protein YsxC [Lachnospiraceae
           bacterium 8_1_57FAA]
 gi|316898677|gb|EFV20712.1| ribosome biogenesis GTP-binding protein YsxC [Lachnospiraceae
           bacterium 8_1_57FAA]
          Length = 202

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 75/183 (40%), Positives = 110/183 (60%), Gaps = 11/183 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PE+AF+G+SNVGKSSLIN L+NRK+ AR S  PG+TQ +NF+   D        
Sbjct: 18  LPENDKPEVAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFYNIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             M LVD+PGYGYAR  +K  + WG +I RYL     L+ V+LLID RH     D+ ++ 
Sbjct: 70  -EMYLVDLPGYGYARVSEKEKEQWGRMIERYLHSSKQLKAVFLLIDIRHDPSANDRMMYQ 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           ++ ++     I+ TK+DK+  +  Q+ ++  K  +   P    +VIP SSV ++G E + 
Sbjct: 129 WIVEQGYHPIIIATKLDKIKRSQIQKHVKMLKQGLDLVPGT--KVIPFSSVSKQGKEDIW 186

Query: 204 KAI 206
           + I
Sbjct: 187 ELI 189


>gi|255037700|ref|YP_003088321.1| GTP-binding protein HSR1-related [Dyadobacter fermentans DSM 18053]
 gi|254950456|gb|ACT95156.1| GTP-binding protein HSR1-related [Dyadobacter fermentans DSM 18053]
          Length = 202

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 104/187 (55%), Gaps = 10/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE AF GRSNVGKSSLIN+L ++K LA+TS  PG+TQ +N F+  D         
Sbjct: 19  PEPVLPEYAFIGRSNVGKSSLINMLTSKKALAKTSQQPGKTQMINHFIIDD--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A  LVD+PGYGYA+  K   + W  +I  YL  R  L C ++L+D RH    +D +  + 
Sbjct: 70  AWYLVDLPGYGYAKVSKVEREKWEKMIHDYLHYRENLICTFVLVDVRHSAMAVDLNFMAA 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L +  + ++I+ TK DKL P      +E  K  +       PE+  TS+ K +G E +  
Sbjct: 130 LGEAGIPFEIIFTKADKLKPAQVASQVEAYKRKMAELWEEVPEMYVTSAEKNEGREPILT 189

Query: 205 AILETIN 211
           AI ET N
Sbjct: 190 AI-ETYN 195


>gi|58697268|ref|ZP_00372648.1| GTP-binding protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|225630063|ref|YP_002726854.1| GTP-binding protein [Wolbachia sp. wRi]
 gi|254783220|sp|C0R5M1|ENGB_WOLWR RecName: Full=Probable GTP-binding protein EngB
 gi|58536385|gb|EAL59835.1| GTP-binding protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|225592044|gb|ACN95063.1| GTP-binding protein [Wolbachia sp. wRi]
          Length = 197

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 102/167 (61%), Gaps = 8/167 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G  +I  LP    PEIAF+GRSNVGKSSLIN+L+N K  AR S+ PG T+ +NF+  
Sbjct: 11  FIFGASDIKSLPNESAPEIAFAGRSNVGKSSLINLLINSKKAARVSSKPGCTRQINFYSM 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            LVD+PGYGY+ A K+ +  +  LI  YL +R  LR V++LID + G
Sbjct: 71  YN--------DKFRLVDLPGYGYSHAGKEEIIQYLNLIEYYLIQRRNLRRVFVLIDSKVG 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
           +K+ID+D   +L    +++ +VLTKIDK+S  +    +E  +  I N
Sbjct: 123 LKEIDKDFIYWLICNNINFNVVLTKIDKVSQKSLGAVIEDIQRWINN 169


>gi|301099279|ref|XP_002898731.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262104804|gb|EEY62856.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 272

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 92/159 (57%), Gaps = 5/159 (3%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PEIAF+GRSN GKSSLIN L  +K L RTS  PGRTQ L+F         K +L
Sbjct: 105 LPDWDVPEIAFAGRSNAGKSSLINALTRQKGLVRTSKTPGRTQQLHFL---SVGGKKGSL 161

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSER--STLRCVYLLIDCRHGVKQIDQDV 141
           P ++LVDMPG+G+A APKK VD W  L+  Y+  R  + L+   LLID R G+   D D 
Sbjct: 162 PELSLVDMPGFGFATAPKKVVDEWHTLVGGYIDNRRGNNLKTTMLLIDARRGLGPADHDF 221

Query: 142 FSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
             FL      YQ+V TK D +S    ++ + K + +  N
Sbjct: 222 MDFLHDLGALYQVVFTKADAVSRGDLEKQIHKAQDVALN 260


>gi|227540053|ref|ZP_03970102.1| GTP-binding protein [Sphingobacterium spiritivorum ATCC 33300]
 gi|227240069|gb|EEI90084.1| GTP-binding protein [Sphingobacterium spiritivorum ATCC 33300]
          Length = 207

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 103/188 (54%), Gaps = 13/188 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PE AF GRSNVGKSSLIN + N+K LA+TS  PG+TQ +N F+  D        
Sbjct: 18  LPDPTLPEYAFIGRSNVGKSSLINAMTNKKGLAKTSQKPGKTQLINHFIIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYG+A+  K N   W   I RYL+ R  L+CV++LID RH  ++ID D   
Sbjct: 70  -EWFLVDLPGYGFAQTSKTNRSEWQKFIRRYLTHRDNLQCVFVLIDSRHEPQKIDLDFCC 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +L +  + + +V TK DK S   +   + K +  +  +    P    TS+  + G E   
Sbjct: 129 WLGECGLPFMLVFTKADKQSAVKSDVNIAKFRKSLLQWFEEVPPHFLTSAEAKTGCE--- 185

Query: 204 KAILETIN 211
             ILE IN
Sbjct: 186 -PILEMIN 192


>gi|225631246|ref|ZP_03787933.1| GTP-binding protein [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225591057|gb|EEH12252.1| GTP-binding protein [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 197

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 104/167 (62%), Gaps = 8/167 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G  +I  LP    PEIAF+GRSNVGKSSLIN+L+N K  AR S+ PG T+ +NF+  
Sbjct: 11  FIFGASDIKTLPDESAPEIAFAGRSNVGKSSLINLLINSKKAARVSSKPGCTRQINFY-- 68

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               ++ N+     LVD+PGYGY+ A K+ +  +  LI  YL +R  LR V++LID + G
Sbjct: 69  ----SMYND--KFRLVDLPGYGYSHAGKEEIIQYLNLIEYYLIQRRNLRRVFVLIDSKVG 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
           +K+ID+D   +L    ++  IVLTKIDK+S  +    +E  +  I N
Sbjct: 123 LKEIDKDFIYWLIYNNINLNIVLTKIDKVSQKSLGAVIEDIQKWINN 169


>gi|300771784|ref|ZP_07081655.1| ribosome biogenesis GTP-binding protein YsxC [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300761170|gb|EFK57995.1| ribosome biogenesis GTP-binding protein YsxC [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 207

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 103/188 (54%), Gaps = 13/188 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PE AF GRSNVGKSSLIN + N+K LA+TS  PG+TQ +N F+  D        
Sbjct: 18  LPDPTLPEYAFIGRSNVGKSSLINAMTNKKGLAKTSQKPGKTQLINHFIIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYG+A+  K N   W   I RYL+ R  L+CV++LID RH  ++ID D   
Sbjct: 70  -EWFLVDLPGYGFAQTSKTNRSEWQKFIRRYLTHRDNLQCVFVLIDSRHEPQKIDLDFCC 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +L +  + + ++ TK DK S   +   + K +  +  +    P    TS+  + G E   
Sbjct: 129 WLGECGLPFMLIFTKADKQSAVKSDVNIAKFRKSLLQWFEEVPPHFLTSAETKTGCE--- 185

Query: 204 KAILETIN 211
             ILE IN
Sbjct: 186 -PILEMIN 192


>gi|153814162|ref|ZP_01966830.1| hypothetical protein RUMTOR_00371 [Ruminococcus torques ATCC 27756]
 gi|331087817|ref|ZP_08336742.1| GTP-binding protein engB [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145848558|gb|EDK25476.1| hypothetical protein RUMTOR_00371 [Ruminococcus torques ATCC 27756]
 gi|330409512|gb|EGG88953.1| GTP-binding protein engB [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 202

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 110/183 (60%), Gaps = 11/183 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PE+AF+G+SNVGKSSLIN L+NRK+ AR S  PG+TQ +NF+   D        
Sbjct: 18  LPENDKPEVAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFYNIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             M LVD+PGYGYAR  +K  + WG +I RYL     L+ V+LLID RH     D+ ++ 
Sbjct: 70  -EMYLVDLPGYGYARVSEKEKEQWGRMIERYLHSSKQLKAVFLLIDIRHDPSANDRMMYQ 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           ++ ++     I+ TK+DK+  +  Q+ ++  K  +   P    +V+P SSV ++G E + 
Sbjct: 129 WIVEQGYHPIIIATKLDKIKRSQIQKHVKMLKQGLDLVPGT--KVLPFSSVSKQGKEDIW 186

Query: 204 KAI 206
           + I
Sbjct: 187 ELI 189


>gi|315224700|ref|ZP_07866523.1| ribosome biogenesis GTP-binding protein YsxC [Capnocytophaga
           ochracea F0287]
 gi|314945328|gb|EFS97354.1| ribosome biogenesis GTP-binding protein YsxC [Capnocytophaga
           ochracea F0287]
          Length = 201

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 106/198 (53%), Gaps = 10/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    ++   PK   PE AF GRSNVGKSSLIN+L N KNLA+TS  PG+TQ +N F  
Sbjct: 7   FVMSNSQVSKCPKENLPEYAFIGRSNVGKSSLINMLTNHKNLAKTSGRPGKTQLINHFKI 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +         +  LVD+PGYGYAR  K+    +   I +Y  ER  L C ++L+D RH 
Sbjct: 67  DN---------SWFLVDLPGYGYARVSKETKKVFQQFITKYFEERQQLVCAFVLVDVRHE 117

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID +   +L + ++ + IV TK DKL P   +  +   + ++       P    TS+
Sbjct: 118 PQKIDVEFMQWLGEHSIPFAIVFTKADKLKPLAIERNIAAYQQVLLETWEEFPPYFVTSA 177

Query: 194 VKRKGIEVLRKAILETIN 211
             + G E L   I E IN
Sbjct: 178 ENKTGKEELTHYI-EQIN 194


>gi|94270231|ref|ZP_01291683.1| GTP-binding [delta proteobacterium MLMS-1]
 gi|93450888|gb|EAT01901.1| GTP-binding [delta proteobacterium MLMS-1]
          Length = 199

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 98/155 (63%), Gaps = 9/155 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+  V ++  LP    PEIAF+GRSNVGKSSLIN L+ RKNL + S  PG+T+ LNF++ 
Sbjct: 12  FVDSVFDLAKLPAGELPEIAFAGRSNVGKSSLINCLLGRKNLVKVSAKPGKTRSLNFYLV 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +          + LVD+PGYGYA+  K+  + W  L+  YL +R  LRCV ++ID RH 
Sbjct: 72  DE---------RLHLVDLPGYGYAKVDKRMQEQWRQLVGGYLEKRDNLRCVVVIIDLRHE 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQ 168
           +K++D+ +  +L    V++ +V TK+DKLS    Q
Sbjct: 123 LKELDRLLAQWLRDIGVAFLLVYTKMDKLSRNQQQ 157


>gi|66818499|ref|XP_642909.1| hypothetical protein DDB_G0276985 [Dictyostelium discoideum AX4]
 gi|60471024|gb|EAL68994.1| hypothetical protein DDB_G0276985 [Dictyostelium discoideum AX4]
          Length = 743

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 109/201 (54%), Gaps = 11/201 (5%)

Query: 7   FTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ 66
           F  S   F+     I        PE+AF GRSNVGKSSLIN L  R  LA+TS+ PG+TQ
Sbjct: 253 FFDSKMKFIGAAKNIDSFLPETLPEVAFIGRSNVGKSSLINALTQR-GLAKTSDKPGQTQ 311

Query: 67  HLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYL 126
            +N+F              + LVD+PGYG+A A +  V+ W  + + YL+ER  + CV++
Sbjct: 312 SINWFELG---------STLYLVDLPGYGFAFAKETLVEQWSDITIHYLTERKCISCVFI 362

Query: 127 LIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR-NYPTAH 185
           LID RHG+K  D+++   LDKK +   I+LTK D   P    + +  T   I+ NY  + 
Sbjct: 363 LIDSRHGLKDSDRNLLLELDKKKIKTHIILTKADLTKPEDLVKRISITNQEIQTNYRYST 422

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
             V+P SS    GI  L K I
Sbjct: 423 TPVLPISSKNLSGISDLSKLI 443


>gi|313203549|ref|YP_004042206.1| ribosome biogenesis GTP-binding protein ysxc [Paludibacter
           propionicigenes WB4]
 gi|312442865|gb|ADQ79221.1| ribosome biogenesis GTP-binding protein YsxC [Paludibacter
           propionicigenes WB4]
          Length = 198

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/175 (42%), Positives = 102/175 (58%), Gaps = 11/175 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLN-FFVPKDFSNLKNNL 83
           P +  PE AF GRSNVGKSSLIN+L NRK+LA TS+ PG+T  +N F + K++       
Sbjct: 19  PDSKLPEYAFIGRSNVGKSSLINMLCNRKDLAMTSSRPGKTLLINHFLINKNWH------ 72

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYA A KK  D    +I  Y+  R  L C++LLIDCRH  ++ID +   
Sbjct: 73  ----LVDLPGYGYATAGKKMRDQLQDIIESYILNREQLTCLFLLIDCRHEPQKIDLEFME 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           +L +  V + IV TK+DKL+    +  ++  K  +       P +  TSS KR G
Sbjct: 129 WLGENGVPFSIVFTKLDKLTHAKGKSNVQAYKDKLSEQWEELPPIFLTSSEKRTG 183


>gi|213963255|ref|ZP_03391512.1| ribosome biogenesis GTP-binding protein YsxC [Capnocytophaga
           sputigena Capno]
 gi|213954117|gb|EEB65442.1| ribosome biogenesis GTP-binding protein YsxC [Capnocytophaga
           sputigena Capno]
          Length = 201

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 105/198 (53%), Gaps = 10/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    ++   PK   PE AF GRSNVGKSSLIN+L N KNLA+TS  PG+TQ +N F  
Sbjct: 7   FVMSNSQVSKCPKENLPEYAFIGRSNVGKSSLINMLTNHKNLAKTSGRPGKTQLINHFKI 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +         +  LVD+PGYGYAR  K+    +   I +Y  ER  L C ++L+D RH 
Sbjct: 67  DN---------SWFLVDLPGYGYARVSKETKKVFQQFITKYFEERQQLVCAFVLVDVRHE 117

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID +   +L +  + + IV TK DKL P   +  +   + ++       P    TS+
Sbjct: 118 PQKIDVEFMQWLGEHGIPFAIVFTKADKLKPLVIERNIAAYQQVLLETWEEFPPYFVTSA 177

Query: 194 VKRKGIEVLRKAILETIN 211
             + G E L   I E IN
Sbjct: 178 ENKTGKEELTHYI-EQIN 194


>gi|169832607|ref|YP_001694973.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pneumoniae Hungary19A-6]
 gi|238688373|sp|B1ICY8|ENGB_STRPI RecName: Full=Probable GTP-binding protein EngB
 gi|168995109|gb|ACA35721.1| GTP-binding protein [Streptococcus pneumoniae Hungary19A-6]
          Length = 195

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 102/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV ++G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKEGMDEAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|307244018|ref|ZP_07526137.1| ribosome biogenesis GTP-binding protein YsxC [Peptostreptococcus
           stomatis DSM 17678]
 gi|306492542|gb|EFM64576.1| ribosome biogenesis GTP-binding protein YsxC [Peptostreptococcus
           stomatis DSM 17678]
          Length = 240

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/202 (39%), Positives = 115/202 (56%), Gaps = 16/202 (7%)

Query: 9   KSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHL 68
           +SA I +  V +    P  G PEIA +GRSNVGKSSLIN L+NR+  ARTS+ PG+T+ +
Sbjct: 38  RSAEITMSAVSK-SQYPAEGIPEIALAGRSNVGKSSLINGLLNRRTFARTSSTPGKTRTI 96

Query: 69  NFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLI 128
           NF+       L NN      VD+PGYGYA+  K   D WGG++ RYL +R  L  ++LL+
Sbjct: 97  NFY-------LINN--EFYFVDLPGYGYAKVSKTEKDKWGGIMERYLEDREELCAIFLLV 147

Query: 129 DCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE- 187
           D RH     DQ ++ ++        +V TK DK++    Q    K + +IR       + 
Sbjct: 148 DVRHEPTADDQMMYDWIKHFGYDCVVVATKADKITRGQYQ----KHEAIIRRTLNMDKDD 203

Query: 188 -VIPTSSVKRKGIEVLRKAILE 208
            V+ TSS K+ G+E L + I++
Sbjct: 204 KVVITSSSKKNGLEDLWETIVD 225


>gi|270292404|ref|ZP_06198615.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus sp.
           M143]
 gi|270278383|gb|EFA24229.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus sp.
           M143]
          Length = 197

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 23  PQDDLPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 74  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 133

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 134 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKAGMDQAWD 191

Query: 205 AILETI 210
           AILE +
Sbjct: 192 AILEKL 197


>gi|306824843|ref|ZP_07458187.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus sp.
           oral taxon 071 str. 73H25AP]
 gi|304433054|gb|EFM36026.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus sp.
           oral taxon 071 str. 73H25AP]
          Length = 195

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDLPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKAGMDQAWN 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|225855010|ref|YP_002736522.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pneumoniae JJA]
 gi|254783214|sp|C1CFF1|ENGB_STRZJ RecName: Full=Probable GTP-binding protein EngB
 gi|225724050|gb|ACO19903.1| GTP-binding protein [Streptococcus pneumoniae JJA]
          Length = 195

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVDLRHAPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKAGMDEAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|149371567|ref|ZP_01890983.1| GTP-binding protein [unidentified eubacterium SCB49]
 gi|149355194|gb|EDM43754.1| GTP-binding protein [unidentified eubacterium SCB49]
          Length = 199

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 108/196 (55%), Gaps = 11/196 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLN-FFV 72
           F+    E+   PK   PE AF GRSNVGKSSLIN+LV++KN+A+TS  PG+TQ +N F +
Sbjct: 8   FIMSNSEVAKCPKDRLPEYAFIGRSNVGKSSLINMLVDQKNMAKTSGRPGKTQLINHFLI 67

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
            K++           LVD+PGYGYAR  KK   ++   I  Y  +R  L   ++L+DCRH
Sbjct: 68  NKNW----------FLVDLPGYGYARVSKKAKKTFQRFITDYFEKREQLILAFVLVDCRH 117

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
             + IDQ+   +L +  + + I+ TK DKL P   +  L+  +  +       P    TS
Sbjct: 118 EPQPIDQEFMQYLGENGIPFHIIFTKADKLKPGALERNLKAYETKMLETWEEMPRSFVTS 177

Query: 193 SVKRKGIEVLRKAILE 208
           + K +G + L   I E
Sbjct: 178 ASKYEGRDELLNYIGE 193


>gi|315613539|ref|ZP_07888446.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis ATCC 49296]
 gi|315314230|gb|EFU62275.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis ATCC 49296]
          Length = 195

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDLPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKAGMDQAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|312866664|ref|ZP_07726878.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           parasanguinis F0405]
 gi|311097745|gb|EFQ55975.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           parasanguinis F0405]
          Length = 200

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 104/190 (54%), Gaps = 15/190 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDEIPEVALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            + LVD+PGYGYAR  KK  + WG +I  YL+ R  L+ V  L+D RH     D  ++ F
Sbjct: 72  KLRLVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLKAVVSLVDFRHEPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E++ K K       T     I  SSV R+G+E  
Sbjct: 132 LKYYEIPVILVATKADKIPRGKWNKHESIIKKKLDFDPADT----FIVFSSVTREGLEKS 187

Query: 203 RKAILETINY 212
            +AILE   Y
Sbjct: 188 WEAILENAFY 197


>gi|306829877|ref|ZP_07463064.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus mitis
           ATCC 6249]
 gi|304427888|gb|EFM30981.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus mitis
           ATCC 6249]
          Length = 195

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDLPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKAGMDQAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|289168391|ref|YP_003446660.1| hypothetical protein smi_1558 [Streptococcus mitis B6]
 gi|288907958|emb|CBJ22798.1| conserved hypothetical protein [Streptococcus mitis B6]
          Length = 197

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 23  PQDDLPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 74  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDFRHDPSADDVQMYEF 133

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 134 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKAGMDEAWD 191

Query: 205 AILETI 210
           AILE +
Sbjct: 192 AILEKL 197


>gi|302386736|ref|YP_003822558.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium
           saccharolyticum WM1]
 gi|302197364|gb|ADL04935.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium
           saccharolyticum WM1]
          Length = 199

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 114/190 (60%), Gaps = 15/190 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PE AF+G+SNVGKSSLIN L+NRK+ ARTS+ PG+TQ +NF+   D        
Sbjct: 18  LPENTKPEFAFAGKSNVGKSSLINALMNRKSFARTSSQPGKTQTINFYNIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
            A+  VD+PGYGYA+  ++    WG +I  YL +   LRCV+LLID RH   + D+ ++ 
Sbjct: 70  -ALYYVDLPGYGYAKVSQEVKAKWGKMIENYLHKSPMLRCVFLLIDIRHEPSENDKTMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEV 201
           ++        I+ TK+DK+  +  Q++++    ++R       +  VIP S+  ++G E 
Sbjct: 129 WIVYNGYQPVIIATKLDKIKRSQVQKSVK----ILRQGLGLGSDVMVIPFSAETKQGREE 184

Query: 202 LRKAILETIN 211
           + + I ET+N
Sbjct: 185 IWEMISETVN 194


>gi|256819259|ref|YP_003140538.1| ribosome biogenesis GTP-binding protein YsxC [Capnocytophaga
           ochracea DSM 7271]
 gi|256580842|gb|ACU91977.1| GTP-binding protein HSR1-related [Capnocytophaga ochracea DSM 7271]
          Length = 200

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 105/198 (53%), Gaps = 10/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    ++   PK   PE AF GRSNVGKSSLIN+L N KNLA+TS  PG+TQ +N F  
Sbjct: 7   FVMSNSQVSKCPKDNLPEYAFIGRSNVGKSSLINMLTNHKNLAKTSGRPGKTQLINHFKI 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +         +  LVD+PGYGYAR  K+    +   I +Y  ER  L C ++L+D RH 
Sbjct: 67  DN---------SWFLVDLPGYGYARVSKETKKVFQQFITKYFEERQQLVCAFVLVDVRHE 117

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID +   +L +  + + IV TK DKL P   +  +   + ++       P    TS+
Sbjct: 118 PQKIDVEFMQWLGEHGIPFAIVFTKADKLKPLAIERNIAAYQQVLLETWEEFPPYFITSA 177

Query: 194 VKRKGIEVLRKAILETIN 211
             + G E L   I E IN
Sbjct: 178 ENKTGKEELTHYI-EQIN 194


>gi|182684523|ref|YP_001836270.1| GTP-binding protein [Streptococcus pneumoniae CGSP14]
 gi|322377850|ref|ZP_08052339.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus sp.
           M334]
 gi|226741185|sp|B2IR86|ENGB_STRPS RecName: Full=Probable GTP-binding protein EngB
 gi|182629857|gb|ACB90805.1| GTP-binding protein [Streptococcus pneumoniae CGSP14]
 gi|321281273|gb|EFX58284.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus sp.
           M334]
          Length = 197

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 23  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 74  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 133

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 134 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKAGMDEAWD 191

Query: 205 AILETI 210
           AILE +
Sbjct: 192 AILEKL 197


>gi|307706171|ref|ZP_07642989.1| conserved hypothetical protein [Streptococcus mitis SK321]
 gi|307618431|gb|EFN97580.1| conserved hypothetical protein [Streptococcus mitis SK321]
          Length = 195

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVNKAGMDEAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|221232329|ref|YP_002511482.1| GTP-binding protein [Streptococcus pneumoniae ATCC 700669]
 gi|225861401|ref|YP_002742910.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pneumoniae Taiwan19F-14]
 gi|307704382|ref|ZP_07641297.1| conserved hypothetical protein [Streptococcus mitis SK597]
 gi|307708345|ref|ZP_07644812.1| GTP-binding protein [Streptococcus mitis NCTC 12261]
 gi|254783212|sp|B8ZLT0|ENGB_STRPJ RecName: Full=Probable GTP-binding protein EngB
 gi|254783216|sp|C1CSI8|ENGB_STRZT RecName: Full=Probable GTP-binding protein EngB
 gi|220674790|emb|CAR69363.1| putative GTP-binding protein [Streptococcus pneumoniae ATCC 700669]
 gi|225726988|gb|ACO22839.1| GTP-binding protein [Streptococcus pneumoniae Taiwan19F-14]
 gi|307615791|gb|EFN94997.1| GTP-binding protein [Streptococcus mitis NCTC 12261]
 gi|307622067|gb|EFO01089.1| conserved hypothetical protein [Streptococcus mitis SK597]
          Length = 195

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKAGMDEAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|293365854|ref|ZP_06612559.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus oralis
           ATCC 35037]
 gi|307703277|ref|ZP_07640222.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037]
 gi|291315678|gb|EFE56126.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus oralis
           ATCC 35037]
 gi|307623143|gb|EFO02135.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037]
          Length = 195

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKAGMDQAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|323339571|ref|ZP_08079845.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus ruminis
           ATCC 25644]
 gi|323092966|gb|EFZ35564.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus ruminis
           ATCC 25644]
          Length = 202

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/178 (43%), Positives = 106/178 (59%), Gaps = 15/178 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA SGRSNVGKSSLIN L+NRK LARTS+ PG+TQ LNF+      N+++ L 
Sbjct: 23  PNEGFPEIALSGRSNVGKSSLINTLINRKGLARTSSQPGKTQTLNFY------NIESEL- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  KK+ + WG +I RY S+R  LR V  L+D RH   ++D  +  F
Sbjct: 76  --YFVDVPGYGYAKVSKKDREKWGQMIERYFSDRPVLRGVISLVDGRHEPTELDCQMIDF 133

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP--EVIPTSSVKRKGIE 200
           L    +   +  TK+DK+     +    +T+  IR     +P  E++  SSV + G E
Sbjct: 134 LHYYDLPILVCATKMDKI----PRGKWNRTESQIRKKLALNPQDEIVLFSSVTKAGKE 187


>gi|315924141|ref|ZP_07920367.1| ribosome biogenesis GTP-binding protein YsxC [Pseudoramibacter
           alactolyticus ATCC 23263]
 gi|315622543|gb|EFV02498.1| ribosome biogenesis GTP-binding protein YsxC [Pseudoramibacter
           alactolyticus ATCC 23263]
          Length = 212

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 105/182 (57%), Gaps = 12/182 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+   GRSNVGKSS +N L+ R+NLARTS+ PG+TQ +NF+   D         
Sbjct: 19  PQDHLPELVLLGRSNVGKSSFVNTLIRRRNLARTSSQPGKTQTMNFYQINDL-------- 70

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VDMPGYGYAR  KK+ + WG +I  YL +R  L  V+LL+D RH   + D+ +F++
Sbjct: 71  -FRFVDMPGYGYARVSKKSREKWGAMIETYLQKRENLAGVFLLVDSRHEPSEDDELMFNW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   +V+TK DKL+    ++ L        + PT   +VIP SSV++ G +   +
Sbjct: 130 LTYYGLVPMVVMTKFDKLNAMRKRKALNNIAATF-HLPTK--DVIPFSSVEKDGYDTAWE 186

Query: 205 AI 206
            I
Sbjct: 187 RI 188


>gi|15903469|ref|NP_359019.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pneumoniae R6]
 gi|15459080|gb|AAL00230.1| Conserved hypothetical protein [Streptococcus pneumoniae R6]
          Length = 197

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 23  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 74  KMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 133

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 134 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKAGMDEAWD 191

Query: 205 AILETI 210
           AILE +
Sbjct: 192 AILEKL 197


>gi|15901411|ref|NP_346015.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pneumoniae TIGR4]
 gi|111658474|ref|ZP_01409147.1| hypothetical protein SpneT_02000374 [Streptococcus pneumoniae
           TIGR4]
 gi|116515393|ref|YP_816858.1| GTPase EngB [Streptococcus pneumoniae D39]
 gi|148984920|ref|ZP_01818173.1| GTPase EngB [Streptococcus pneumoniae SP3-BS71]
 gi|148988622|ref|ZP_01820055.1| GTPase EngB [Streptococcus pneumoniae SP6-BS73]
 gi|148990171|ref|ZP_01821402.1| GTP-binding protein [Streptococcus pneumoniae SP6-BS73]
 gi|148993406|ref|ZP_01822923.1| GTP-binding protein [Streptococcus pneumoniae SP9-BS68]
 gi|148997364|ref|ZP_01824969.1| GTP-binding protein [Streptococcus pneumoniae SP11-BS70]
 gi|149003199|ref|ZP_01828095.1| GTP-binding protein [Streptococcus pneumoniae SP14-BS69]
 gi|149007516|ref|ZP_01831151.1| GTP-binding protein [Streptococcus pneumoniae SP18-BS74]
 gi|149007879|ref|ZP_01831466.1| GTP-binding protein [Streptococcus pneumoniae SP18-BS74]
 gi|149012699|ref|ZP_01833675.1| GTP-binding protein [Streptococcus pneumoniae SP19-BS75]
 gi|149022038|ref|ZP_01836000.1| GTPase EngB [Streptococcus pneumoniae SP23-BS72]
 gi|168483553|ref|ZP_02708505.1| GTP-binding protein [Streptococcus pneumoniae CDC1873-00]
 gi|168486831|ref|ZP_02711339.1| GTP-binding protein [Streptococcus pneumoniae CDC1087-00]
 gi|168488709|ref|ZP_02712908.1| GTP-binding protein [Streptococcus pneumoniae SP195]
 gi|168491538|ref|ZP_02715681.1| GTP-binding protein [Streptococcus pneumoniae CDC0288-04]
 gi|168493473|ref|ZP_02717616.1| GTP-binding protein [Streptococcus pneumoniae CDC3059-06]
 gi|168575234|ref|ZP_02721197.1| GTP-binding protein [Streptococcus pneumoniae MLV-016]
 gi|194397246|ref|YP_002038200.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pneumoniae G54]
 gi|225859325|ref|YP_002740835.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pneumoniae 70585]
 gi|237650251|ref|ZP_04524503.1| GTPase EngB [Streptococcus pneumoniae CCRI 1974]
 gi|237820866|ref|ZP_04596711.1| GTPase EngB [Streptococcus pneumoniae CCRI 1974M2]
 gi|298230527|ref|ZP_06964208.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pneumoniae str. Canada MDR_19F]
 gi|298255217|ref|ZP_06978803.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pneumoniae str. Canada MDR_19A]
 gi|298503306|ref|YP_003725246.1| GTPase [Streptococcus pneumoniae TCH8431/19A]
 gi|303255353|ref|ZP_07341423.1| GTPase EngB [Streptococcus pneumoniae BS455]
 gi|303260195|ref|ZP_07346167.1| GTPase EngB [Streptococcus pneumoniae SP-BS293]
 gi|303262586|ref|ZP_07348527.1| GTPase EngB [Streptococcus pneumoniae SP14-BS292]
 gi|303264988|ref|ZP_07350903.1| GTPase EngB [Streptococcus pneumoniae BS397]
 gi|303266451|ref|ZP_07352339.1| GTPase EngB [Streptococcus pneumoniae BS457]
 gi|303269033|ref|ZP_07354815.1| GTPase EngB [Streptococcus pneumoniae BS458]
 gi|307068211|ref|YP_003877177.1| putative GTPase [Streptococcus pneumoniae AP200]
 gi|307127778|ref|YP_003879809.1| GTP-binding protein [Streptococcus pneumoniae 670-6B]
 gi|54037058|sp|P64073|ENGB_STRR6 RecName: Full=Probable GTP-binding protein EngB
 gi|54040981|sp|P64072|ENGB_STRPN RecName: Full=Probable GTP-binding protein EngB
 gi|122278296|sp|Q04JI0|ENGB_STRP2 RecName: Full=Probable GTP-binding protein EngB
 gi|238690842|sp|B5E6L1|ENGB_STRP4 RecName: Full=Probable GTP-binding protein EngB
 gi|254783211|sp|C1C8F9|ENGB_STRP7 RecName: Full=Probable GTP-binding protein EngB
 gi|14973059|gb|AAK75655.1| GTP-binding protein [Streptococcus pneumoniae TIGR4]
 gi|116075969|gb|ABJ53689.1| GTP-binding protein [Streptococcus pneumoniae D39]
 gi|147756419|gb|EDK63460.1| GTP-binding protein [Streptococcus pneumoniae SP11-BS70]
 gi|147758659|gb|EDK65656.1| GTP-binding protein [Streptococcus pneumoniae SP14-BS69]
 gi|147760606|gb|EDK67580.1| GTP-binding protein [Streptococcus pneumoniae SP18-BS74]
 gi|147760875|gb|EDK67845.1| GTP-binding protein [Streptococcus pneumoniae SP18-BS74]
 gi|147763299|gb|EDK70237.1| GTP-binding protein [Streptococcus pneumoniae SP19-BS75]
 gi|147922942|gb|EDK74058.1| GTPase EngB [Streptococcus pneumoniae SP3-BS71]
 gi|147924438|gb|EDK75527.1| GTP-binding protein [Streptococcus pneumoniae SP6-BS73]
 gi|147925823|gb|EDK76898.1| GTPase EngB [Streptococcus pneumoniae SP6-BS73]
 gi|147927961|gb|EDK78981.1| GTP-binding protein [Streptococcus pneumoniae SP9-BS68]
 gi|147929882|gb|EDK80871.1| GTPase EngB [Streptococcus pneumoniae SP23-BS72]
 gi|172043175|gb|EDT51221.1| GTP-binding protein [Streptococcus pneumoniae CDC1873-00]
 gi|183570230|gb|EDT90758.1| GTP-binding protein [Streptococcus pneumoniae CDC1087-00]
 gi|183572689|gb|EDT93217.1| GTP-binding protein [Streptococcus pneumoniae SP195]
 gi|183574254|gb|EDT94782.1| GTP-binding protein [Streptococcus pneumoniae CDC0288-04]
 gi|183576321|gb|EDT96849.1| GTP-binding protein [Streptococcus pneumoniae CDC3059-06]
 gi|183578703|gb|EDT99231.1| GTP-binding protein [Streptococcus pneumoniae MLV-016]
 gi|194356913|gb|ACF55361.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pneumoniae G54]
 gi|225720438|gb|ACO16292.1| GTP-binding protein [Streptococcus pneumoniae 70585]
 gi|298238901|gb|ADI70032.1| GTPase [Streptococcus pneumoniae TCH8431/19A]
 gi|301794577|emb|CBW37021.1| putative GTP-binding protein [Streptococcus pneumoniae INV104]
 gi|301800399|emb|CBW33030.1| putative GTP-binding protein [Streptococcus pneumoniae OXC141]
 gi|301802286|emb|CBW35038.1| putative GTP-binding protein [Streptococcus pneumoniae INV200]
 gi|302597721|gb|EFL64797.1| GTPase EngB [Streptococcus pneumoniae BS455]
 gi|302636303|gb|EFL66797.1| GTPase EngB [Streptococcus pneumoniae SP14-BS292]
 gi|302638692|gb|EFL69155.1| GTPase EngB [Streptococcus pneumoniae SP-BS293]
 gi|302641423|gb|EFL71788.1| GTPase EngB [Streptococcus pneumoniae BS458]
 gi|302644029|gb|EFL74288.1| GTPase EngB [Streptococcus pneumoniae BS457]
 gi|302645507|gb|EFL75739.1| GTPase EngB [Streptococcus pneumoniae BS397]
 gi|306409748|gb|ADM85175.1| Predicted GTPase [Streptococcus pneumoniae AP200]
 gi|306484840|gb|ADM91709.1| GTP-binding protein [Streptococcus pneumoniae 670-6B]
 gi|327389756|gb|EGE88101.1| hypothetical protein SPAR5_1446 [Streptococcus pneumoniae GA04375]
 gi|332072415|gb|EGI82898.1| hypothetical protein SPAR50_1585 [Streptococcus pneumoniae GA17570]
 gi|332072738|gb|EGI83219.1| hypothetical protein SPAR148_1498 [Streptococcus pneumoniae
           GA17545]
 gi|332073905|gb|EGI84383.1| hypothetical protein SPAR68_1577 [Streptococcus pneumoniae GA41301]
 gi|332199612|gb|EGJ13687.1| hypothetical protein SPAR69_1522 [Streptococcus pneumoniae GA41317]
 gi|332200132|gb|EGJ14205.1| hypothetical protein SPAR93_1607 [Streptococcus pneumoniae GA47368]
 gi|332201009|gb|EGJ15080.1| hypothetical protein SPAR120_1514 [Streptococcus pneumoniae
           GA47901]
          Length = 195

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKAGMDEAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|225857194|ref|YP_002738705.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pneumoniae P1031]
 gi|254783215|sp|C1CLR7|ENGB_STRZP RecName: Full=Probable GTP-binding protein EngB
 gi|225725684|gb|ACO21536.1| GTP-binding protein [Streptococcus pneumoniae P1031]
          Length = 195

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKAGMDEAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|210615411|ref|ZP_03290538.1| hypothetical protein CLONEX_02754 [Clostridium nexile DSM 1787]
 gi|210150260|gb|EEA81269.1| hypothetical protein CLONEX_02754 [Clostridium nexile DSM 1787]
          Length = 205

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/177 (41%), Positives = 105/177 (59%), Gaps = 11/177 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+    EIAF+G+SNVGKSSLIN L+NRK+ ARTS  PG+TQ +NF+   D        
Sbjct: 23  LPETDKVEIAFAGKSNVGKSSLINALMNRKSFARTSATPGKTQTINFYNINDI------- 75

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             M LVD+PGYGYA+  +K    WG LI RYL     L+ V+LLID RH     D+ ++ 
Sbjct: 76  --MYLVDLPGYGYAKVSEKEKIQWGKLIERYLHSSKQLKAVFLLIDIRHDPSANDKMMYE 133

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
           ++  +  +  I+ TK+DKL  +   + ++  K  +   P    ++IP SSV ++G E
Sbjct: 134 WIVSQGYNPIIIATKLDKLKRSQVAKHVKMIKQGLDLVPGT--QIIPFSSVSKQGRE 188


>gi|197302447|ref|ZP_03167502.1| hypothetical protein RUMLAC_01175 [Ruminococcus lactaris ATCC
           29176]
 gi|197298345|gb|EDY32890.1| hypothetical protein RUMLAC_01175 [Ruminococcus lactaris ATCC
           29176]
          Length = 200

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 105/176 (59%), Gaps = 11/176 (6%)

Query: 23  LLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNN 82
           +LP+   PEIAF+G+SNVGKSSLIN L+NRK+ AR S  PG+TQ +NF+   D       
Sbjct: 17  VLPENDKPEIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFYNIND------- 69

Query: 83  LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVF 142
              M LVD+PGYGYA+  ++    WG LI RYL     LR V+LLID RH     D+ ++
Sbjct: 70  --EMYLVDLPGYGYAKVSEQEKAQWGKLIERYLHTSGQLRAVFLLIDIRHAPSANDKMMY 127

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
            ++ ++     I+ TK+DK+  +  Q+ ++  K  +   P    +VIP SS  ++G
Sbjct: 128 HWIVEQGYQPIIIATKLDKIKRSQVQKCIKILKEGLELVPGT--KVIPFSSQTKQG 181


>gi|307705962|ref|ZP_07642787.1| conserved hypothetical protein [Streptococcus mitis SK564]
 gi|307620472|gb|EFN99583.1| conserved hypothetical protein [Streptococcus mitis SK564]
          Length = 195

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKAGMDEAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|268611238|ref|ZP_06144965.1| hypothetical protein RflaF_17292 [Ruminococcus flavefaciens FD-1]
          Length = 202

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/180 (42%), Positives = 105/180 (58%), Gaps = 13/180 (7%)

Query: 31  EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVD 90
           EIAF+G SNVGKS+LIN L NRKNLAR S+ PG+T  +NF+           L  +  VD
Sbjct: 27  EIAFAGHSNVGKSTLINKLFNRKNLARVSSVPGKTATINFY----------GLENLYFVD 76

Query: 91  MPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAV 150
           +PGYGYA+  K   + W GLI  YLS    +R V++L+D RH   + D  + ++L    +
Sbjct: 77  LPGYGYAKVSKSEKERWAGLIEGYLSSDRDIRLVFMLVDMRHAPTKDDIHMINYLIDTEM 136

Query: 151 SYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI 210
            + +VLTK DKL+ T   + +E  K  I  +   H   IP SS   +G+E LR AI+E I
Sbjct: 137 PFVLVLTKADKLNKTERAKRIEAFKDEIPCFEDIHS--IPFSSQTFEGVEELR-AIVEDI 193


>gi|325117628|emb|CBZ53180.1| Ribosome biogenesis GTP-binding protein YsxC,related [Neospora
           caninum Liverpool]
          Length = 1085

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 70/183 (38%), Positives = 108/183 (59%), Gaps = 7/183 (3%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PE+AF+GRSNVGKSSL+N L  R+  +  ++ PG TQHL+FF          + 
Sbjct: 28  LPPPILPEVAFAGRSNVGKSSLLNELAGRRLTSLVTSRPGTTQHLHFFK-------AGSP 80

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P + LVD+PGYG+A+A       W    + YL  R  LR V++LID RHG+K+ D+++  
Sbjct: 81  PVLCLVDLPGYGFAKAAAATRLQWTEFSLYYLKTRKNLRRVFVLIDARHGLKESDKEMLH 140

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           FL +  VS+Q+VLTK D + P    +TL   K   + +     + +  S+++ + ++VLR
Sbjct: 141 FLHRWGVSWQLVLTKADLVKPKDLVKTLMLVKEDAKAFRHQAADPVAVSALRHQALDVLR 200

Query: 204 KAI 206
           + +
Sbjct: 201 REM 203


>gi|117926943|ref|YP_867560.1| small GTP-binding protein [Magnetococcus sp. MC-1]
 gi|117610699|gb|ABK46154.1| small GTP-binding protein [Magnetococcus sp. MC-1]
          Length = 218

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 76/183 (41%), Positives = 104/183 (56%), Gaps = 10/183 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PE+AF+GRSNVGKSSL+N L+NR+ LAR SN PGRT+ LNFF             
Sbjct: 25  PDDGLPEVAFAGRSNVGKSSLLNKLLNRRQLARVSNTPGRTRELNFFRINQ--------- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A   VD+PGYGYA+  +   + W   I  Y + R  LR V LL+D R G+ + DQ +  F
Sbjct: 76  AYYYVDLPGYGYAKVGRGQREVWDRGIGLYFNSRRDLRAVILLLDIRRGMTEQDQAMLDF 135

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLI-RNYPTAHPEVIPTSSVKRKGIEVLR 203
           + K  +    VLTK DKL+    +E ++  + ++    P A   ++ TSS K  GI  LR
Sbjct: 136 IFKMGLPVLPVLTKSDKLNANPRREAIKAMRLMVAEKVPLAVAPLLVTSSSKGDGILELR 195

Query: 204 KAI 206
           + +
Sbjct: 196 QTL 198


>gi|257063740|ref|YP_003143412.1| small GTP-binding protein domain/GTP-binding conserved hypothetical
           protein [Slackia heliotrinireducens DSM 20476]
 gi|256791393|gb|ACV22063.1| small GTP-binding protein domain/GTP-binding conserved hypothetical
           protein [Slackia heliotrinireducens DSM 20476]
          Length = 201

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 102/188 (54%), Gaps = 16/188 (8%)

Query: 21  IGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK 80
           I  LPK+  PEI+F+GRSNVGKSSL+N L NRK LA+ S+ PG+T  +NFF         
Sbjct: 15  INQLPKSVRPEISFAGRSNVGKSSLLNKLFNRKGLAKVSSTPGKTATINFFTA------- 67

Query: 81  NNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQD 140
               +   VD+PGYGYA+  K     W GLI  Y  +      V  LID RH   ++D  
Sbjct: 68  ---SSADFVDLPGYGYAKVSKTERQRWSGLIEGYFHQDRRFALVVSLIDIRHAASELDVQ 124

Query: 141 VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKG 198
           +  FL ++ + + +VLTK DKLS +     +      IR      PE  +I  SS K  G
Sbjct: 125 MIDFLMEEGLPFVVVLTKADKLSKSQVNRQVAA----IRKQLGFEPEDPIIAVSSEKGTG 180

Query: 199 IEVLRKAI 206
           I+VL++ I
Sbjct: 181 IDVLKRTI 188


>gi|296876432|ref|ZP_06900484.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           parasanguinis ATCC 15912]
 gi|296432722|gb|EFH18517.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           parasanguinis ATCC 15912]
          Length = 200

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 103/190 (54%), Gaps = 15/190 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDEIPEVALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            + LVD+PGYGYAR  KK  + WG +I  YL+ R  L+ V  L+D RH     D  ++ F
Sbjct: 72  KLRLVDVPGYGYARVSKKEREKWGRMIEEYLTSRKNLKAVVSLVDFRHEPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E++ K K       T     I  SSV R+G+E  
Sbjct: 132 LKYYEIPVILVATKADKIPRGKWNKHESIIKKKLDFDPADT----FIVFSSVTREGLEKS 187

Query: 203 RKAILETINY 212
             AILE   Y
Sbjct: 188 WDAILENTFY 197


>gi|331090539|ref|ZP_08339392.1| GTP-binding protein engB [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330405882|gb|EGG85410.1| GTP-binding protein engB [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 201

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/177 (43%), Positives = 106/177 (59%), Gaps = 11/177 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP     EIAF+G+SNVGKSSLIN L+NRK+LARTS  PG+TQ +NF+         N  
Sbjct: 18  LPDTELMEIAFAGKSNVGKSSLINALLNRKSLARTSATPGKTQTINFY---------NVN 68

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + LVD+PGYGYA+   K  + WG LI RYL+    LR V+LLID RH     D+ ++ 
Sbjct: 69  KELYLVDLPGYGYAKVSPKEKEQWGKLIERYLNTSKKLRAVFLLIDIRHEPTANDKMMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
           ++     +  I+ TK+DKL  +  Q+ ++  K  +   P    +VIP SSV ++G E
Sbjct: 129 WIVYHGYNPIIIATKLDKLKRSQIQKHVKMVKQGLNLVPGT--KVIPFSSVTKQGRE 183


>gi|268318043|ref|YP_003291762.1| small GTP-binding protein [Rhodothermus marinus DSM 4252]
 gi|262335577|gb|ACY49374.1| small GTP-binding protein [Rhodothermus marinus DSM 4252]
          Length = 198

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 108/198 (54%), Gaps = 10/198 (5%)

Query: 9   KSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHL 68
           K A  F R V     LP  G PE+AF+GRSNVGKSSL+N L+    LARTS+ PG+T+ L
Sbjct: 3   KPAARFFRSVTRWEDLPDDGLPEVAFAGRSNVGKSSLLNALLRAPGLARTSSTPGKTRQL 62

Query: 69  NFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLI 128
           NF+   +          +  VD+PGYGYAR  ++    WG LI RYL ER TL  V  LI
Sbjct: 63  NFYRVNE---------QLYFVDLPGYGYARTSQEERRLWGRLITRYLQERPTLALVVHLI 113

Query: 129 DCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEV 188
           D RH    +D+ +   +  + V Y I LTK DK+S     + + + +  ++      P +
Sbjct: 114 DSRHPPTPLDEAMMDLMRGQHVPYLIALTKADKVSGNRRAQAVREVERALQARAMEVP-I 172

Query: 189 IPTSSVKRKGIEVLRKAI 206
           IPTS+    G+  L + I
Sbjct: 173 IPTSAHTGLGLRDLWRWI 190


>gi|86132597|ref|ZP_01051190.1| GTPase of unknown function [Dokdonia donghaensis MED134]
 gi|85816839|gb|EAQ38024.1| GTPase of unknown function [Dokdonia donghaensis MED134]
          Length = 201

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 96/165 (58%), Gaps = 9/165 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    E+   P    PE AF GRSNVGKSSLIN+L NRK+LA+TS  PG+TQ +N F+ 
Sbjct: 8   FVVSNSEVSKCPNTRIPEYAFIGRSNVGKSSLINMLTNRKSLAKTSGRPGKTQLINHFLI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            LVD+PGYGYAR  KK+   +   I  Y  +R  +   ++L+DCRH 
Sbjct: 68  NE---------NWHLVDLPGYGYARVSKKDKKYFQKFITDYFEQREQMISAFVLVDCRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLI 178
            ++ID +   ++ +K + + I+ TK DKL P   +  +E+ K ++
Sbjct: 119 PQKIDMEFMEYMGEKEIPFSIIFTKADKLRPQALERNIEEYKRIM 163


>gi|322387324|ref|ZP_08060934.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           infantis ATCC 700779]
 gi|321141853|gb|EFX37348.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           infantis ATCC 700779]
          Length = 195

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPTADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVTKAGMDQAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|221487174|gb|EEE25420.1| conserved hypothetical protein [Toxoplasma gondii GT1]
          Length = 1466

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 72/185 (38%), Positives = 108/185 (58%), Gaps = 7/185 (3%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PEIAF+GRSNVGKSSL+N L  R+  +  ++ PG TQ L+FF          + 
Sbjct: 450 LPPPTLPEIAFAGRSNVGKSSLLNELAGRRLTSLVTSRPGTTQQLHFFK-------AGSP 502

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P + LVD+PGYG+A+A       W    + YL  R  LR V++L+D RHG+K+ D+++  
Sbjct: 503 PVLCLVDLPGYGFAKAAAATRLQWTEFSLYYLKTRKNLRRVFVLVDARHGLKESDKEMLH 562

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           FL +  VS+QIVLTK D + P    +TL   K   + +     + I  S+++ + ++VLR
Sbjct: 563 FLHRWGVSWQIVLTKADLVKPKDLVKTLMLVKEDAKAFRHQAADPIAVSALRHQALDVLR 622

Query: 204 KAILE 208
           + + E
Sbjct: 623 REMDE 627


>gi|237831355|ref|XP_002364975.1| GTP-binding conserved hypothetical domain-containing protein
           [Toxoplasma gondii ME49]
 gi|211962639|gb|EEA97834.1| GTP-binding conserved hypothetical domain-containing protein
           [Toxoplasma gondii ME49]
 gi|221506860|gb|EEE32477.1| conserved hypothetical protein [Toxoplasma gondii VEG]
          Length = 1466

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 72/185 (38%), Positives = 108/185 (58%), Gaps = 7/185 (3%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PEIAF+GRSNVGKSSL+N L  R+  +  ++ PG TQ L+FF          + 
Sbjct: 450 LPPPTLPEIAFAGRSNVGKSSLLNELAGRRLTSLVTSRPGTTQQLHFFK-------AGSP 502

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P + LVD+PGYG+A+A       W    + YL  R  LR V++L+D RHG+K+ D+++  
Sbjct: 503 PVLCLVDLPGYGFAKAAAATRLQWTEFSLYYLKTRKNLRRVFVLVDARHGLKESDKEMLH 562

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           FL +  VS+QIVLTK D + P    +TL   K   + +     + I  S+++ + ++VLR
Sbjct: 563 FLHRWGVSWQIVLTKADLVKPKDLVKTLMLVKEDAKAFRHQAADPIAVSALRHQALDVLR 622

Query: 204 KAILE 208
           + + E
Sbjct: 623 REMDE 627


>gi|331265986|ref|YP_004325616.1| GTP-binding protein, putative [Streptococcus oralis Uo5]
 gi|326682658|emb|CBZ00275.1| GTP-binding protein, putative [Streptococcus oralis Uo5]
          Length = 195

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVSKVGMDQAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|255004364|ref|ZP_05279165.1| ribosome biogenesis GTP-binding protein YsxC [Anaplasma marginale
           str. Virginia]
          Length = 205

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/189 (40%), Positives = 114/189 (60%), Gaps = 9/189 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ GV +   LP    PE+AF+GRSNVGKSSLIN +   K  AR S+ PG T+ +NF++ 
Sbjct: 7   FVAGVQDKHSLPDFQVPEVAFAGRSNVGKSSLINAVTKNKKGARVSSNPGSTRQINFYL- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                   N  A+ALVD+PGYGY++A K++  S+  L+  YL  R  L  + LLID + G
Sbjct: 66  --------NEGALALVDLPGYGYSKASKESASSYMSLVEHYLLTREALHRLVLLIDSKVG 117

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K++D D  S+L+++ + Y +VLTKID+L+ T   + L   +  ++        +I TSS
Sbjct: 118 LKEVDMDFISWLEERCIHYSLVLTKIDRLTCTEFNDVLSAVQSRVKGCCMLLHPIIGTSS 177

Query: 194 VKRKGIEVL 202
              KGI+ L
Sbjct: 178 KSGKGIKEL 186


>gi|322391569|ref|ZP_08065038.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus peroris
           ATCC 700780]
 gi|321145652|gb|EFX41044.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus peroris
           ATCC 700780]
          Length = 195

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 101/186 (54%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PEDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDFRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVTKAGMDQAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|226324369|ref|ZP_03799887.1| hypothetical protein COPCOM_02150 [Coprococcus comes ATCC 27758]
 gi|225206817|gb|EEG89171.1| hypothetical protein COPCOM_02150 [Coprococcus comes ATCC 27758]
          Length = 200

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 75/175 (42%), Positives = 104/175 (59%), Gaps = 11/175 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PEIAF+G+SNVGKSSLIN L+NRK LARTS  PG+TQ +NF+         N  
Sbjct: 18  LPDHTLPEIAFAGKSNVGKSSLINALMNRKALARTSAKPGKTQTINFY---------NIN 68

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             M LVD+PGYGYA+  ++    WG LI RYL     LR V+LLID RH     D+ ++ 
Sbjct: 69  EEMYLVDLPGYGYAKVSEQEKAQWGKLIERYLHGSKQLRAVFLLIDIRHDPSANDKMMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           ++  +  +  I+ TK+DKL  +  Q+ ++  K  ++  P     VIP S+  ++G
Sbjct: 129 WIVDQGFNPIIIATKLDKLKRSQVQKQVKAIKTGLKLLPGT--VVIPFSAETKQG 181


>gi|56416888|ref|YP_153962.1| GTPase EngB [Anaplasma marginale str. St. Maries]
 gi|222475253|ref|YP_002563669.1| Probable GTP-binding protein engB [Anaplasma marginale str.
           Florida]
 gi|255003237|ref|ZP_05278201.1| ribosome biogenesis GTP-binding protein YsxC [Anaplasma marginale
           str. Puerto Rico]
 gi|269958697|ref|YP_003328484.1| GTPase EngB [Anaplasma centrale str. Israel]
 gi|81359025|sp|Q5PAH3|ENGB_ANAMM RecName: Full=Probable GTP-binding protein EngB
 gi|254783183|sp|B9KIV1|ENGB_ANAMF RecName: Full=Probable GTP-binding protein EngB
 gi|56388120|gb|AAV86707.1| hypothetical protein AM764 [Anaplasma marginale str. St. Maries]
 gi|222419390|gb|ACM49413.1| Probable GTP-binding protein engB [Anaplasma marginale str.
           Florida]
 gi|269848526|gb|ACZ49170.1| GTPase EngB [Anaplasma centrale str. Israel]
          Length = 205

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 77/189 (40%), Positives = 114/189 (60%), Gaps = 9/189 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ GV +   LP    PE+AF+GRSNVGKSSLIN +   K  AR S+ PG T+ +NF++ 
Sbjct: 7   FVAGVQDKHSLPDFQVPEVAFAGRSNVGKSSLINAVTKNKKGARVSSNPGSTRQINFYL- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                   N  A+ALVD+PGYGY++A K++  S+  L+  YL  R  L  + LLID + G
Sbjct: 66  --------NEGALALVDLPGYGYSKASKESASSYMSLVEHYLLTREALHRLVLLIDSKVG 117

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K++D D  S+L+++ + Y +VLTKID+L+ T   + L   +  ++        +I TSS
Sbjct: 118 LKEVDMDFISWLEERCIHYSLVLTKIDRLACTEFNDVLSAVQSRVKGCCMLLHPIIGTSS 177

Query: 194 VKRKGIEVL 202
              KGI+ L
Sbjct: 178 KSGKGIKEL 186


>gi|166031006|ref|ZP_02233835.1| hypothetical protein DORFOR_00687 [Dorea formicigenerans ATCC
           27755]
 gi|166029273|gb|EDR48030.1| hypothetical protein DORFOR_00687 [Dorea formicigenerans ATCC
           27755]
          Length = 196

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 107/176 (60%), Gaps = 11/176 (6%)

Query: 23  LLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNN 82
           +LPK   PEIAF+G+SNVGKSSLIN L+NRK+ AR S  PG+TQ +N++   D       
Sbjct: 17  VLPKNTKPEIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINYYSIND------- 69

Query: 83  LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVF 142
              M LVD+PGYGYA+  ++    WG LI RYL   + L+ V+LLID RH   + D+ ++
Sbjct: 70  --EMYLVDLPGYGYAKVSEQEKIKWGQLIERYLHSSAQLKAVFLLIDIRHAPSENDRIMY 127

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
            ++ ++     I+ TK+DK+  +  Q+ ++  +  ++  P     +IP SS  ++G
Sbjct: 128 QWIVEQGFHPIIIATKLDKIKRSQVQKQMKVLREGLKLIPGT--TIIPFSSQTKQG 181


>gi|260589154|ref|ZP_05855067.1| ribosome biogenesis GTP-binding protein YsxC [Blautia hansenii DSM
           20583]
 gi|331082570|ref|ZP_08331695.1| GTP-binding protein engB [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260540574|gb|EEX21143.1| ribosome biogenesis GTP-binding protein YsxC [Blautia hansenii DSM
           20583]
 gi|330400548|gb|EGG80178.1| GTP-binding protein engB [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 201

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 108/178 (60%), Gaps = 11/178 (6%)

Query: 23  LLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNN 82
           +LP+   PEIAF+G+SNVGKSSLIN L+NRK+LARTS +PG+TQ +NF+         N 
Sbjct: 17  ILPENEVPEIAFAGKSNVGKSSLINALMNRKSLARTSASPGKTQTINFY---------NV 67

Query: 83  LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVF 142
              M LVD+PGYGYA+  +   + WG LI RYL +   L+ V+LLID RH   + D+ ++
Sbjct: 68  NHEMYLVDLPGYGYAKVSQSVKEQWGKLIERYLHKSKQLKAVFLLIDIRHKPSENDKTMY 127

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
            ++        I+ TK DKL  +  Q+ L+  K  +   P    ++IP S+  ++G E
Sbjct: 128 DWIVYNGYQPIIIATKSDKLKRSQIQKQLKIIKEGLE-LPKG-AQIIPFSAQTKQGRE 183


>gi|332360756|gb|EGJ38564.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK355]
          Length = 195

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 80/188 (42%), Positives = 100/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K         + + I  SSV + G++  
Sbjct: 132 LKYYDIPVILVATKADKIPRGKWNKHESAIKKKLDF----DKNDDFILFSSVTKDGLDAA 187

Query: 203 RKAILETI 210
             AIL  I
Sbjct: 188 WDAILSKI 195


>gi|297569324|ref|YP_003690668.1| ribosome biogenesis GTP-binding protein YsxC [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925239|gb|ADH86049.1| ribosome biogenesis GTP-binding protein YsxC [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 200

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 92/155 (59%), Gaps = 9/155 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+  V  +  LP    PEIAF+GRSNVGKSSL+N L+ RKNL + S  PG+TQ LNF++ 
Sbjct: 9   FVDSVFSLAQLPVGDLPEIAFAGRSNVGKSSLLNCLLRRKNLVKVSARPGKTQSLNFYLV 68

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + LVD+PGYG+AR  K+    W  LI  YL  R  LRCV L+ID RH 
Sbjct: 69  GD---------QLHLVDLPGYGFARVDKRLQAKWQELITAYLETRPNLRCVVLIIDLRHA 119

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQ 168
           +K+ D+ +  +L  + + +  V TK DKLS    Q
Sbjct: 120 LKESDRMLAGWLQAQGIPWLPVYTKKDKLSRNQQQ 154


>gi|254995072|ref|ZP_05277262.1| ribosome biogenesis GTP-binding protein YsxC [Anaplasma marginale
           str. Mississippi]
          Length = 205

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/189 (40%), Positives = 114/189 (60%), Gaps = 9/189 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ GV +   LP    PE+AF+GRSNVGKSSLIN +   K  AR S+ PG T+ +NF++ 
Sbjct: 7   FVAGVQDKHSLPDFQVPEVAFAGRSNVGKSSLINAVTKNKKGARVSSNPGSTRQINFYL- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                   N  A+ALVD+PGYGY++A K++  S+  L+  YL  R  L  + LLID + G
Sbjct: 66  --------NEGALALVDLPGYGYSKASKESASSYMSLVEHYLLTREALHRLVLLIDSKVG 117

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K++D D  S+L+++ + Y +VLTKID+L+ T   + L   +  ++        +I TSS
Sbjct: 118 LKEVDMDFISWLEERCIHYSLVLTKIDRLTCTGFNDVLSAVQSRVKGCCMLLHPIIGTSS 177

Query: 194 VKRKGIEVL 202
              KGI+ L
Sbjct: 178 KSGKGIKEL 186


>gi|154506027|ref|ZP_02042765.1| hypothetical protein RUMGNA_03569 [Ruminococcus gnavus ATCC 29149]
 gi|153793526|gb|EDN75946.1| hypothetical protein RUMGNA_03569 [Ruminococcus gnavus ATCC 29149]
          Length = 206

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 104/175 (59%), Gaps = 11/175 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PEIAF+G+SNVGKSSLIN L+NRK+ AR S  PG+TQ +NF+         N  
Sbjct: 18  LPENEKPEIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFY---------NIN 68

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + LVD+PGYGYA+  +K    WG LI RYL     L+ V+LLID RH     D+ ++ 
Sbjct: 69  EELYLVDLPGYGYAKVSEKEKIQWGNLIERYLHTSKQLKAVFLLIDIRHDPSANDKMMYQ 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           ++  +     I+ TK+DKL  +  Q+ ++  K  +   P    +VIP SSV ++G
Sbjct: 129 WIVDQGFQPIIIATKLDKLKRSQVQKHVKMLKTGLNLLPGT--KVIPFSSVTKQG 181


>gi|325295391|ref|YP_004281905.1| GTP-binding protein engB [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065839|gb|ADY73846.1| GTP-binding protein engB [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 194

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 111/182 (60%), Gaps = 13/182 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+    E+AF GRSNVGKSSL+N LVN   +A+ S+ PG+T+ +NF++  D        
Sbjct: 18  LPQTPYKEVAFVGRSNVGKSSLLNTLVNNYKIAKVSSEPGKTRSVNFYLIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               +VD+PGYG+A+ P K    W  LI +YL ER TL+ V+LL+D + G  + D+ +  
Sbjct: 70  -KFFMVDLPGYGFAKVPFKEQKRWRDLIEKYLKERDTLKGVFLLVDSKVGPTEKDKQMKD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG-IEVL 202
           +LD   + Y +V TK+DKL  +  Q+   K +  +++    + E+IP SS  R+G +EVL
Sbjct: 129 WLDFFGIPYVVVATKVDKLKSSEKQKLKRKVEEGLKD---KNLEIIPFSSKTREGRVEVL 185

Query: 203 RK 204
           ++
Sbjct: 186 KR 187


>gi|291543933|emb|CBL17042.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Ruminococcus sp.
           18P13]
          Length = 196

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 102/185 (55%), Gaps = 12/185 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           +P     EIAF+GRSNVGKS+LIN + NRKNLAR S  PG+T  +NF+           L
Sbjct: 18  IPACSRMEIAFAGRSNVGKSTLINKIFNRKNLARVSAVPGKTATINFY----------QL 67

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             +  VD+PGYGYA+  K   + W GLI  YL+    +R ++LLID RH     D  +  
Sbjct: 68  EHVYFVDLPGYGYAKVAKSEKERWAGLIEGYLNSERDIRLIFLLIDMRHAPSADDLHMID 127

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +L +  + + ++LTK DKL     Q  +E     I  +  +   VIP SS   +G+E +R
Sbjct: 128 YLVEAELPFVVILTKADKLKKMARQARMEAFAQEIPYF--SELTVIPFSSQTFEGVEQVR 185

Query: 204 KAILE 208
           + I E
Sbjct: 186 QIITE 190


>gi|255994399|ref|ZP_05427534.1| ribosome biogenesis GTP-binding protein YsxC [Eubacterium saphenum
           ATCC 49989]
 gi|255993112|gb|EEU03201.1| ribosome biogenesis GTP-binding protein YsxC [Eubacterium saphenum
           ATCC 49989]
          Length = 205

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 72/186 (38%), Positives = 108/186 (58%), Gaps = 10/186 (5%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
            P    PEIAF+GRSNVGKSSL+N+L  RK+LA+ S+ PG+T+ +NF+   D        
Sbjct: 18  FPDETLPEIAFAGRSNVGKSSLLNMLTGRKSLAKISSKPGKTRTINFYNVDD-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
            A  +VD+PGYG+ARAP+  ++ W  LI  Y+ +R  L  V  LID RH    +D+ +  
Sbjct: 70  -AFRIVDLPGYGFARAPRSEMEKWAKLIETYIEKRGNLIAVTSLIDIRHDPTDLDRQLCL 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN-YPTAHPEVIPTSSVKRKGIEVL 202
           +L +  +   +VLTK DK+  +   + L   K ++ N Y       IP S++KR+G E L
Sbjct: 129 YLKEMNLLKTVVLTKADKIPKSQVNKKLGIVKKILSNEYDINGVRFIPVSALKRQGKEEL 188

Query: 203 RKAILE 208
              +++
Sbjct: 189 MNELIK 194


>gi|322389612|ref|ZP_08063160.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           parasanguinis ATCC 903]
 gi|321143611|gb|EFX39041.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           parasanguinis ATCC 903]
          Length = 200

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 103/190 (54%), Gaps = 15/190 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDEIPEVALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            + LVD+PGYGYAR  KK  + WG +I  YL+ R  L+ V  L+D RH     D  ++ F
Sbjct: 72  KLRLVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLKAVVSLVDFRHEPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E++ K K       T     I  SSV ++G+E  
Sbjct: 132 LKYYEIPVILVATKADKIPRGKWNKHESIIKKKLDFDPSDT----FIVFSSVTKEGLEKS 187

Query: 203 RKAILETINY 212
             AILE   Y
Sbjct: 188 WDAILENAFY 197


>gi|255528414|ref|ZP_05395213.1| GTP-binding protein HSR1-related protein [Clostridium
           carboxidivorans P7]
 gi|296184881|ref|ZP_06853292.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium
           carboxidivorans P7]
 gi|255507895|gb|EET84336.1| GTP-binding protein HSR1-related protein [Clostridium
           carboxidivorans P7]
 gi|296050663|gb|EFG90086.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium
           carboxidivorans P7]
          Length = 195

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 107/188 (56%), Gaps = 13/188 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+    EIAF GRSNVGKSSLIN LVNR+ L + S  PG+T+ +NFF       L NN  
Sbjct: 19  PQDNRVEIAFVGRSNVGKSSLINTLVNRRKLVKVSGTPGKTRLVNFF-------LINN-- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K   +SWG +I RYL+ R  L+ V LL+DCRH   + D  ++ +
Sbjct: 70  EFYFVDLPGYGYAKVSKSEKESWGKVIERYLTGREQLKKVMLLVDCRHKPTEDDIIMYKW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT-SSVKRKGIEVLR 203
           +        IV TKIDKL     ++ L   K +   +  +  E I T SS+K+ G E L 
Sbjct: 130 IKHYNYDAIIVATKIDKLKKAELRKNL---KVIRETFELSDDEEILTFSSLKKLGKEELL 186

Query: 204 KAILETIN 211
            AI + IN
Sbjct: 187 DAIEQCIN 194


>gi|88607557|ref|YP_505024.1| GTPase EngB [Anaplasma phagocytophilum HZ]
 gi|119368790|sp|Q2GKS7|ENGB_ANAPZ RecName: Full=Probable GTP-binding protein EngB
 gi|88598620|gb|ABD44090.1| putative GTP-binding protein EngB [Anaplasma phagocytophilum HZ]
          Length = 193

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 96/150 (64%), Gaps = 9/150 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ GV +    P  G PE+AF+GRSNVGKSSLIN + N K  A+TS+ PG T+ +NF++ 
Sbjct: 6   FVAGVQDRKSFPDFGVPEVAFAGRSNVGKSSLINAITNNKKNAKTSSNPGSTRQINFYLN 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           K           +ALVD+PGYGY++A K+    +  ++  YL  R  L+ + LLID R G
Sbjct: 66  KGI---------VALVDLPGYGYSKASKEATRGYLDVMEHYLMSREALQRLVLLIDSRIG 116

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
           +K+ID+D   +L++  + Y IVLTK DKLS
Sbjct: 117 LKEIDRDFLCWLEEHGIYYSIVLTKADKLS 146


>gi|324992982|gb|EGC24902.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK405]
 gi|324995709|gb|EGC27621.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK678]
 gi|327462278|gb|EGF08605.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK1]
 gi|327489631|gb|EGF21423.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK1058]
          Length = 195

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/189 (41%), Positives = 101/189 (53%), Gaps = 17/189 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KLRFVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL---SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEV 201
           L    +   +V TK DK+        +  ++K     RN      + I  SSV + G++ 
Sbjct: 132 LKYYDIPVILVATKADKIPRGKWNKHESAIKKKLDFDRN-----DDFILFSSVTKDGLDA 186

Query: 202 LRKAILETI 210
              AIL  I
Sbjct: 187 AWDAILSKI 195


>gi|322375631|ref|ZP_08050143.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus sp.
           C300]
 gi|321279339|gb|EFX56380.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus sp.
           C300]
          Length = 197

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/186 (41%), Positives = 100/186 (53%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 23  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 74  KMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF 133

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 134 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVTKAGMDQAWD 191

Query: 205 AILETI 210
            ILE +
Sbjct: 192 TILEKL 197


>gi|313206541|ref|YP_004045718.1| ribosome biogenesis GTP-binding protein ysxc [Riemerella
           anatipestifer DSM 15868]
 gi|312445857|gb|ADQ82212.1| ribosome biogenesis GTP-binding protein YsxC [Riemerella
           anatipestifer DSM 15868]
 gi|315023518|gb|EFT36522.1| GTP-binding protein EngB [Riemerella anatipestifer RA-YM]
 gi|325336011|gb|ADZ12285.1| Predicted GTPase [Riemerella anatipestifer RA-GD]
          Length = 208

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 111/197 (56%), Gaps = 11/197 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++   +    P+A  PE AF GRSNVGKSSLIN +   KNLA+TS  PG+TQ +N F+ 
Sbjct: 9   FVKSSQKWQECPEANLPEYAFIGRSNVGKSSLINAITGNKNLAKTSQTPGKTQLINHFII 68

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            L D+PGYGYA+  K     +  LI  Y+  R  L  +++L+D RH 
Sbjct: 69  NE---------EWYLTDLPGYGYAKVSKTQRKDFEKLITNYILNRKNLVNLFILVDIRHT 119

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEK-TKYLIRNYPTAHPEVIPTS 192
            ++ID +   +  +  + + IV TK DKL P  A++ +E  TK L+ ++  A P++  TS
Sbjct: 120 PQKIDLEFIEWCGESGIPFSIVFTKEDKLKPNAAKKNVEDYTKTLLESWEEA-PQMYITS 178

Query: 193 SVKRKGIEVLRKAILET 209
           + K+ G E + + I +T
Sbjct: 179 AEKKTGTEAILEYIEQT 195


>gi|319947000|ref|ZP_08021234.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           australis ATCC 700641]
 gi|319747048|gb|EFV99307.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           australis ATCC 700641]
          Length = 198

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/189 (41%), Positives = 102/189 (53%), Gaps = 15/189 (7%)

Query: 22  GLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN 81
           G  P+   PE+A +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF      N+ +
Sbjct: 18  GHYPQDDIPEVALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFF------NIDD 71

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDV 141
            L     VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  +
Sbjct: 72  QL---RFVDVPGYGYARVSKKEREKWGKMIEEYLTTRENLRAVVSLVDLRHEPSADDVQM 128

Query: 142 FSFLDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI 199
           + FL    +   +V TK DK+        E++ K K       T     I  SSV + G+
Sbjct: 129 YEFLKYYEIPVILVATKADKIPRGKWNKHESMIKKKLDFDKTDT----FIIFSSVNKTGV 184

Query: 200 EVLRKAILE 208
           E    AI +
Sbjct: 185 EEAWDAIFD 193


>gi|313676939|ref|YP_004054935.1| ribosome biogenesis GTP-binding protein ysxc [Marivirga tractuosa
           DSM 4126]
 gi|312943637|gb|ADR22827.1| ribosome biogenesis GTP-binding protein YsxC [Marivirga tractuosa
           DSM 4126]
          Length = 203

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 105/187 (56%), Gaps = 10/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE AF GRSNVGKSSLIN+L +RKNLA+TS+ PG+TQ +N F+  +         
Sbjct: 20  PETDLPEYAFIGRSNVGKSSLINMLTDRKNLAKTSSKPGKTQLINHFLMDE--------- 70

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  KK  + WG +I  YL  R  L C+++LID R   ++ D +   F
Sbjct: 71  KWYLVDLPGYGYAKVSKKTNEGWGKMISDYLKNRENLVCIFVLIDSRLPPQKADVEFLDF 130

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           + K  +   ++ TK DK S    Q+ +   K  + N     P    +S+ K+ G E +  
Sbjct: 131 IGKNGLPLSLIFTKADKQSNNKTQQNIAVFKKKMLNTWEEFPPYFVSSAEKQTGKEEIL- 189

Query: 205 AILETIN 211
            I++ +N
Sbjct: 190 GIIDQMN 196


>gi|332884603|gb|EGK04860.1| GTP-binding protein engB [Dysgonomonas mossii DSM 22836]
          Length = 201

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 102/174 (58%), Gaps = 9/174 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G PE AF GRSNVGKSSLIN+L NRK LA TS+ PG+TQ +N F+  +         
Sbjct: 19  PQDGKPEYAFIGRSNVGKSSLINMLTNRKGLAMTSSKPGKTQLINHFIINN--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  K   +    +I  Y+ +R+ L C++LL+DCRH  ++ID D  ++
Sbjct: 70  EWYLVDLPGYGYAQRGKDGREQIRKIIDNYILKRTELTCLFLLLDCRHEPQKIDLDFINW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           L ++ + + IV TK DK+S    ++  E     +       P +  TSS +R G
Sbjct: 130 LGEEGIPFVIVFTKTDKISKGRLKDNSEAYINKLHETWEEIPTIFYTSSEQRAG 183


>gi|24379393|ref|NP_721348.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus mutans
           UA159]
 gi|290580605|ref|YP_003484997.1| putative GTP-binding protein [Streptococcus mutans NN2025]
 gi|81845282|sp|Q8DUH9|ENGB_STRMU RecName: Full=Probable GTP-binding protein EngB
 gi|24377323|gb|AAN58654.1|AE014935_6 putative GTP-binding protein [Streptococcus mutans UA159]
 gi|254997504|dbj|BAH88105.1| putative GTP-binding protein [Streptococcus mutans NN2025]
          Length = 197

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 84/211 (39%), Positives = 112/211 (53%), Gaps = 16/211 (7%)

Query: 2   VSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNA 61
           +S  + T +A I L  V +    P+   PEIA +GRSNVGKSS IN L+ RKNLARTS+ 
Sbjct: 1   MSEFLNTHNASILLSAVNK-SHYPQDDLPEIALAGRSNVGKSSFINTLLGRKNLARTSSK 59

Query: 62  PGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTL 121
           PG+TQ LNF+   D          +  VD+PGYGYA+  KK    WG +I  YL+ R  L
Sbjct: 60  PGKTQSLNFYNIDD---------KLRFVDVPGYGYAKVSKKERAKWGKMIEEYLTSRENL 110

Query: 122 RCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIR 179
           R V  L+D RH     D  ++ FL    +   +V TK DK+       QE+  K K    
Sbjct: 111 RAVVSLVDFRHDPSSDDVQMYDFLKYYEIPVILVATKADKVPRGKWNKQESAIKKKLDF- 169

Query: 180 NYPTAHPEVIPTSSVKRKGIEVLRKAILETI 210
               ++   I  SSV R G++    AILE++
Sbjct: 170 ---DSNDAFIIFSSVDRTGLDTSWDAILESL 197


>gi|298207894|ref|YP_003716073.1| GTP-binding protein [Croceibacter atlanticus HTCC2559]
 gi|83850535|gb|EAP88403.1| GTP-binding protein [Croceibacter atlanticus HTCC2559]
          Length = 202

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 105/198 (53%), Gaps = 10/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    ++   P+   PE AF GRSNVGKSSLIN++ N K LA+TS+ PG+TQ +N F+ 
Sbjct: 8   FVISNSDVDKCPQDKLPEYAFIGRSNVGKSSLINMMTNNKKLAKTSSTPGKTQLINHFII 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYAR  KK    +   I  Y  +RS L C ++L+D RH 
Sbjct: 68  ND---------EWYLVDLPGYGYARTSKKTKKVFQKFITDYFVKRSQLVCAFVLVDSRHA 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID +   +L   ++ + I+ TK DKL         +     +       PE   TSS
Sbjct: 119 PQKIDLEFMEWLGTNSIPFAIIFTKTDKLKKGEWDRNFKVYSSKMMETWAEMPEYFTTSS 178

Query: 194 VKRKGIEVLRKAILETIN 211
           + + G E + + I +TIN
Sbjct: 179 LHKTGAEEVLEYI-DTIN 195


>gi|225166344|ref|ZP_03728026.1| GTPase EngB [Opitutaceae bacterium TAV2]
 gi|224799414|gb|EEG17961.1| GTPase EngB [Opitutaceae bacterium TAV2]
          Length = 213

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 109/198 (55%), Gaps = 13/198 (6%)

Query: 13  IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           +F +  P +   P  G  E AF GRSNVGKSSL+N+L  +K+LA+ S  PG+T+ +NFF 
Sbjct: 23  VFEKSAPNLATSPVWGCREFAFIGRSNVGKSSLLNLLTEQKDLAKVSATPGKTRMINFF- 81

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
                 + N   A +LVD+PGYG+A+  +     +   + RYL +R  L CV++LID R 
Sbjct: 82  -----KINN---AWSLVDLPGYGFAKVAQHKRSDFNQAVARYLEKRDNLACVFVLIDSRL 133

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
             +QID D   +L+     + ++ TK DK SPT  +  +      +  + T  P ++ +S
Sbjct: 134 PPQQIDLDFIQWLEGTGRPFALIFTKTDKQSPTQTRAKISLFTEALAEWRTEPPPILTSS 193

Query: 193 SVKRKGIEVLRKAILETI 210
           S  + G    R+ ILE I
Sbjct: 194 SKTKSG----RREILEFI 207


>gi|296331634|ref|ZP_06874103.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305675407|ref|YP_003867079.1| putative ribosome biogenesis GTP-binding protein [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|296151229|gb|EFG92109.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305413651|gb|ADM38770.1| putative ribosome biogenesis GTP-binding protein [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 195

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 107/189 (56%), Gaps = 15/189 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G PEIA +GRSNVGKSS IN L+NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PEGGLPEIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQTLNFYIIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+  VD+PGYG+A+  K   ++WG +I  Y++ R  L+ V  ++D RH     D  ++ F
Sbjct: 70  ALHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP--EVIPTSSVKRKGIEVL 202
           L    +   ++ TK DK+     +   +K   ++R      P  E+I  SS  +KG +  
Sbjct: 130 LKYYGIPVIVIATKADKI----PKGKWDKHAKVVRQTLNIDPEDELILFSSETKKGKDEA 185

Query: 203 RKAILETIN 211
             AI + IN
Sbjct: 186 WGAIKKMIN 194


>gi|309799590|ref|ZP_07693816.1| GTP-binding protein [Streptococcus infantis SK1302]
 gi|308116778|gb|EFO54228.1| GTP-binding protein [Streptococcus infantis SK1302]
          Length = 195

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/186 (41%), Positives = 100/186 (53%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYAR  K   + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KMRFVDVPGYGYARVSKNEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPTADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +   P+   + I  SSV + G++    
Sbjct: 132 LKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPS--DDFILFSSVTKAGMDQAWD 189

Query: 205 AILETI 210
           AILE +
Sbjct: 190 AILEKL 195


>gi|325687396|gb|EGD29417.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK72]
          Length = 195

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 100/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KLRFVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K         + + I  SSV + G++  
Sbjct: 132 LKYYDIPVVLVATKADKIPRGKWNKHESAIKKKLDF----DKNDDFILFSSVTKDGLDAA 187

Query: 203 RKAILETI 210
             AIL  I
Sbjct: 188 WDAILSKI 195


>gi|262282293|ref|ZP_06060061.1| GTPase EngB [Streptococcus sp. 2_1_36FAA]
 gi|262261584|gb|EEY80282.1| GTPase EngB [Streptococcus sp. 2_1_36FAA]
          Length = 197

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 103/189 (54%), Gaps = 15/189 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF      N+ N L 
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFF------NIDNKL- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 74  --RFVDVPGYGYAKVSKTERAKWGRMIEEYLTSRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K    N+  A    I  SSV + GI+  
Sbjct: 132 LKYYEIPVILVATKADKIPRGKWNKHESAIKKKL---NFDPADT-FILFSSVDKTGIDAS 187

Query: 203 RKAILETIN 211
             AILE +N
Sbjct: 188 WNAILEKVN 196


>gi|325689772|gb|EGD31776.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK115]
 gi|325694580|gb|EGD36489.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK150]
 gi|325696428|gb|EGD38318.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK160]
          Length = 195

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/189 (41%), Positives = 101/189 (53%), Gaps = 17/189 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KLRFVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL---SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEV 201
           L    +   +V TK DK+        +  ++K     RN      + I  SSV + G++ 
Sbjct: 132 LKYYDIPVILVATKADKIPRGKWNKHESAIKKKLDFDRN-----DDFILFSSVTKDGLDA 186

Query: 202 LRKAILETI 210
              AIL  I
Sbjct: 187 SWDAILSKI 195


>gi|260911896|ref|ZP_05918462.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella sp. oral
           taxon 472 str. F0295]
 gi|260634012|gb|EEX52136.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella sp. oral
           taxon 472 str. F0295]
          Length = 201

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 104/195 (53%), Gaps = 9/195 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F    P IGL PK    E AF GRSNVGKSSLIN+L N K LA+TS  PG+T  +N F+ 
Sbjct: 8   FTLSAPSIGLCPKDNKIEYAFIGRSNVGKSSLINMLCNHKGLAKTSATPGKTLLINHFII 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D         +  LVD+PGYG+A+  K        +I  Y+ +R  L  +++LID RH 
Sbjct: 68  ND---------SWYLVDLPGYGFAKRSKTVQQKLQQMISSYILQREQLVNLFVLIDIRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID++   +L +  V + IV TK DKL    A++  EK    + +     P    TSS
Sbjct: 119 QQKIDREFIDWLGESGVPFTIVFTKADKLGLVKAKQNAEKWMKQLEDSWEEQPPYFITSS 178

Query: 194 VKRKGIEVLRKAILE 208
            KR G E L   I E
Sbjct: 179 EKRIGREELLNYIDE 193


>gi|150026105|ref|YP_001296931.1| GTPase EngB [Flavobacterium psychrophilum JIP02/86]
 gi|166225953|sp|A6H1A5|ENGB_FLAPJ RecName: Full=Probable GTP-binding protein EngB
 gi|149772646|emb|CAL44129.1| Probable GTP-binding protein EngB [Flavobacterium psychrophilum
           JIP02/86]
          Length = 205

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 104/189 (55%), Gaps = 10/189 (5%)

Query: 21  IGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK 80
           + L P+   PE AF GRSNVGKSSLIN+L N K+LA+TS  PG+TQ +N F       + 
Sbjct: 15  VSLCPQEHLPEYAFIGRSNVGKSSLINMLTNHKSLAKTSGRPGKTQLINHF------KIN 68

Query: 81  NNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQD 140
           NN     LVD+PGYGYA+  KK  + +   I  Y  +R  L C ++LID RH  ++ID +
Sbjct: 69  NN---WFLVDLPGYGYAKVSKKTKEVFQQFITDYFEKREQLVCAFVLIDIRHEAQKIDLE 125

Query: 141 VFSFLDKKAVSYQIVLTKIDKLSP-TTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI 199
             ++L +  + + IV TK DK+S    AQ        L++N     P    TS+ +  G 
Sbjct: 126 FITYLGEIELPFCIVFTKADKISKGKVAQHVAAYRTALLKNNWEEMPHHFVTSATEHTGK 185

Query: 200 EVLRKAILE 208
           E L   I E
Sbjct: 186 ESLLSYIDE 194


>gi|301057780|ref|ZP_07198849.1| ribosome biogenesis GTP-binding protein YsxC [delta proteobacterium
           NaphS2]
 gi|300448091|gb|EFK11787.1| ribosome biogenesis GTP-binding protein YsxC [delta proteobacterium
           NaphS2]
          Length = 198

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/185 (41%), Positives = 108/185 (58%), Gaps = 11/185 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P +  PE+AF+G+SNVGKSSLIN L  R+ LARTS+ PGRTQ +NFF    F        
Sbjct: 16  PPSDRPEVAFAGKSNVGKSSLINTLTGRRKLARTSSTPGRTQAINFF---RFGK------ 66

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            + LVD+PGYG+AR P K   SWG ++  YL  R TL+ V +++D R      D D+ ++
Sbjct: 67  TLYLVDLPGYGFARVPMKVKKSWGLMVEDYLRSRQTLKAVVVILDIRRDPSAGDADLINW 126

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L+   +   +VLTK DK+S   A +   + K  ++    + P +   SS  R+G+E L K
Sbjct: 127 LNYYHIVPIVVLTKADKVSRQQAGKRTARIKKSLKGVSFSAPVLF--SSHTRQGVEDLWK 184

Query: 205 AILET 209
            I ET
Sbjct: 185 RINET 189


>gi|210621785|ref|ZP_03292814.1| hypothetical protein CLOHIR_00759 [Clostridium hiranonis DSM 13275]
 gi|210154549|gb|EEA85555.1| hypothetical protein CLOHIR_00759 [Clostridium hiranonis DSM 13275]
          Length = 203

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 106/185 (57%), Gaps = 13/185 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-VPKDFSNLKNNL 83
           P  G PEIA +GRSNVGKSSL N L+NR+N ARTS+ PG+T+ +NF+ + K+F       
Sbjct: 19  PTDGIPEIALAGRSNVGKSSLTNALLNRRNFARTSSTPGKTRTINFYLINKEF------- 71

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
                VD+PGYGYA+  K   D WG ++ RYL +R  L  ++LL+D RH     D+ ++ 
Sbjct: 72  ---FFVDLPGYGYAKVAKSEKDKWGQVMERYLQDRDELCAIFLLVDIRHEPTADDKMMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           ++        +V TK DK+S     + L   +  ++       ++IP SS K+ GIE L 
Sbjct: 129 WIKYYGYDCVVVATKADKISRGQYLKHLSVIRKKLQ--LEKDEKIIPVSSSKKTGIEELW 186

Query: 204 KAILE 208
             I+E
Sbjct: 187 SEIVE 191


>gi|253579812|ref|ZP_04857080.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848811|gb|EES76773.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 201

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/175 (40%), Positives = 104/175 (59%), Gaps = 11/175 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PE+AF+G+SNVGKSSLIN L+NRK+LARTS  PG+TQ +NF+         N  
Sbjct: 18  LPDTNRPEVAFAGKSNVGKSSLINGLMNRKSLARTSAQPGKTQTINFY---------NIN 68

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
            AM LVD+PGYGYA+  +   + WG +I RYL     L+ V+LLID RH     D+ ++ 
Sbjct: 69  EAMYLVDLPGYGYAKVSQSEKEKWGKMIERYLHTSKNLKAVFLLIDIRHDPSANDKMMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           ++        I+ TK+DKL  +  Q+ ++  K  ++   +    +IP S+  ++G
Sbjct: 129 WILNNGYEPIIIATKLDKLKRSQVQKNIKAIKEGLK--LSKDGIIIPFSAETKQG 181


>gi|304440711|ref|ZP_07400595.1| ribosome biogenesis GTP-binding protein YsxC [Peptoniphilus
           duerdenii ATCC BAA-1640]
 gi|304370898|gb|EFM24520.1| ribosome biogenesis GTP-binding protein YsxC [Peptoniphilus
           duerdenii ATCC BAA-1640]
          Length = 200

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 109/188 (57%), Gaps = 11/188 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P     EIAF+GRSNVGKSS IN ++ RKNLARTS++PG+T+ +NF+         N   
Sbjct: 19  PDENLMEIAFAGRSNVGKSSFINSMLGRKNLARTSSSPGKTRTINFY---------NIDE 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            + LVD+PGYGYA+  K+   SW  +I  YL  R  L+ V+LL+D RH   + D ++F F
Sbjct: 70  KLRLVDLPGYGYAKVSKEEKSSWAKIINEYLESRENLKEVFLLVDIRHDPTKQDIEMFRF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           + +      +V TK DK+S + A   ++    +++   T +  +IP SSV +  ++ +  
Sbjct: 130 IKEAGFVGIVVATKSDKISKSKAITQIKNIAKVLKTENTDY--IIPYSSVDKNMVDEMWM 187

Query: 205 AILETINY 212
            I + + Y
Sbjct: 188 VIKDLLEY 195


>gi|125717924|ref|YP_001035057.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK36]
 gi|166226980|sp|A3CMV2|ENGB_STRSV RecName: Full=Probable GTP-binding protein EngB
 gi|125497841|gb|ABN44507.1| GTP-binding protein, putative [Streptococcus sanguinis SK36]
 gi|327460432|gb|EGF06769.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK1057]
 gi|327470115|gb|EGF15579.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK330]
          Length = 195

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 100/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KLRFVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K         + + I  SSV + G++  
Sbjct: 132 LKYYDIPVILVATKADKIPRGKWNKHESAIKKKLDF----DKNDDFILFSSVTKDGLDAA 187

Query: 203 RKAILETI 210
             AIL  I
Sbjct: 188 WDAILSKI 195


>gi|324991226|gb|EGC23160.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK353]
 gi|328946143|gb|EGG40288.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK1087]
          Length = 195

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 100/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KLRFVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K         + + I  SSV + G++  
Sbjct: 132 LKYYNIPVILVATKADKIPRGKWNKHESAIKKKLDF----DKNDDFILFSSVTKDGLDAA 187

Query: 203 RKAILETI 210
             AIL  I
Sbjct: 188 WDAILSKI 195


>gi|194017131|ref|ZP_03055743.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus pumilus ATCC
           7061]
 gi|194010999|gb|EDW20569.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus pumilus ATCC
           7061]
          Length = 195

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 106/187 (56%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA +GRSNVGKSS IN L+NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PSGGLPEIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQTLNFYIINDM-------- 70

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYG+A+  K   ++WG +I  Y++ R  L+ V  ++D RH     D +++ F
Sbjct: 71  -LHFVDVPGYGFAKVSKTEREAWGRMIETYITMREELKAVVQIVDLRHKPSVDDVNMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    V   ++ TK DK+     ++  +  K  +   P+   E++  SS  +KG +    
Sbjct: 130 LKYYGVPVIVIATKADKIPKGKWEKHAKVVKQTLDIAPS--DELVLFSSETKKGKDEAWN 187

Query: 205 AILETIN 211
           AIL  IN
Sbjct: 188 AILAKIN 194


>gi|126663224|ref|ZP_01734222.1| GTPase EngB [Flavobacteria bacterium BAL38]
 gi|126624882|gb|EAZ95572.1| GTPase EngB [Flavobacteria bacterium BAL38]
          Length = 206

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 107/199 (53%), Gaps = 14/199 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    E+   PK   PE AF GRSNVGKSSLIN+L N KNLA+TS+ PG+TQ +N F  
Sbjct: 8   FVISNSEVDKCPKERLPEYAFIGRSNVGKSSLINMLTNHKNLAKTSSKPGKTQLINHF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                + NN     LVD+PGYGYAR  KK    +   I+ Y  +R  L C ++LID R  
Sbjct: 66  ----KINNN---WFLVDLPGYGYARVSKKTKAVFQQFIMDYFEQREQLVCAFVLIDIRLE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEK-TKYLIRNYPTAHPEVIPTS 192
            ++ID +   +L +  + + I+ TK DKL        +E   K L+       P    TS
Sbjct: 119 AQKIDLEFMEYLGESEIPFAIIFTKSDKLGKNKVNNHVEAYKKQLLAGDWAEMPPYFVTS 178

Query: 193 SVKRKGIEVLRKAILETIN 211
           S++  G    R+ ILE IN
Sbjct: 179 SLEAIG----REGILEYIN 193


>gi|157693221|ref|YP_001487683.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus pumilus
           SAFR-032]
 gi|166920109|sp|A8FFV6|ENGB_BACP2 RecName: Full=Probable GTP-binding protein EngB
 gi|157681979|gb|ABV63123.1| possible GTPase [Bacillus pumilus SAFR-032]
          Length = 195

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 106/187 (56%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA +GRSNVGKSS IN L+NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PSGGLPEIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQTLNFYIINDM-------- 70

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYG+A+  K   ++WG +I  Y++ R  L+ V  ++D RH     D +++ F
Sbjct: 71  -LHFVDVPGYGFAKVSKTEREAWGRMIETYITMREELKAVVQIVDLRHKPSVDDVNMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    V   ++ TK DK+     ++  +  K  +   P+   E++  SS  +KG +    
Sbjct: 130 LKYYGVPVIVIATKADKIPKGKWEKHAKVVKQTLDIAPS--DELVLFSSETKKGKDEAWN 187

Query: 205 AILETIN 211
           AIL  IN
Sbjct: 188 AILAKIN 194


>gi|145219093|ref|YP_001129802.1| GTPase EngB [Prosthecochloris vibrioformis DSM 265]
 gi|189037185|sp|A4SCU1|ENGB_PROVI RecName: Full=Probable GTP-binding protein EngB
 gi|145205257|gb|ABP36300.1| GTP-binding protein, HSR1-related protein [Chlorobium
           phaeovibrioides DSM 265]
          Length = 191

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/185 (40%), Positives = 104/185 (56%), Gaps = 13/185 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+R V ++  LP+   PEI F+GRSNVGKSSL+N L  RK LA+TS+ PG+T+ +N+F+ 
Sbjct: 8   FVRSVSDLSDLPEESFPEIVFAGRSNVGKSSLLNSLTGRKGLAKTSSTPGKTRLINYFL- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L +NL     VD+PGYGYA       D+WG L+  Y+ +R+ +  V LL+D RH 
Sbjct: 67  -----LNDNL---YFVDIPGYGYAAVSHAEKDAWGRLLAGYVGDRAAIALVVLLLDSRHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
             + D+D+  FL      Y IVLTK DKL+          T+    N       ++  SS
Sbjct: 119 AMKSDRDMMDFLAYHDRPYGIVLTKDDKLTQKERTHAKRATESCAMNAGF----IVSYSS 174

Query: 194 VKRKG 198
           V  KG
Sbjct: 175 VSGKG 179


>gi|332366631|gb|EGJ44374.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK1059]
          Length = 195

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 100/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KLRFVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K         + + I  SSV + G++  
Sbjct: 132 LKYYDIPVILVATKADKIPRGKWNKHESAIKKKLDF----DKNDDFILFSSVTKDGLDTA 187

Query: 203 RKAILETI 210
             AIL  I
Sbjct: 188 WDAILSKI 195


>gi|325679699|ref|ZP_08159273.1| ribosome biogenesis GTP-binding protein YsxC [Ruminococcus albus 8]
 gi|324108514|gb|EGC02756.1| ribosome biogenesis GTP-binding protein YsxC [Ruminococcus albus 8]
          Length = 242

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 109/198 (55%), Gaps = 14/198 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    +   +PK+  PE AFSGRSNVGKSSLIN + NRKN+AR S+ PG+T  +NFF  
Sbjct: 11  FVTSYGKFSQIPKSDRPEFAFSGRSNVGKSSLINKIFNRKNMARVSSVPGKTVTINFFSV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSE-RSTLRCVYLLIDCRH 132
           +D          +  VD+PGYGYA   K     WG LI  YL +    +  V+ LID RH
Sbjct: 71  ED----------VYFVDLPGYGYANVSKAEKGKWGELIGGYLGDFERYVEIVFQLIDMRH 120

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
              + D  + ++L    + + IVLTK DKL PT  +  +      I  +   H   IP S
Sbjct: 121 APSKDDIQMINYLIDNEMPFVIVLTKADKLKPTARKARMAAFAEEIPCFEDIH--CIPFS 178

Query: 193 SVKRKGIEVLRKAILETI 210
           +V  +G++ L KA++E +
Sbjct: 179 AVTGEGVDEL-KAVIEEV 195


>gi|254490408|ref|ZP_05103595.1| putative GTPase [Methylophaga thiooxidans DMS010]
 gi|224464374|gb|EEF80636.1| putative GTPase [Methylophaga thiooxydans DMS010]
          Length = 219

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 107/182 (58%), Gaps = 10/182 (5%)

Query: 20  EIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNL 79
           ++  LP+    E+AF+GRSN GKSS IN +   ++LARTS  PGRTQ +NFF   D    
Sbjct: 30  QLSQLPEDTGFEVAFAGRSNAGKSSAINTITGIRSLARTSKTPGRTQMINFFHFDD---- 85

Query: 80  KNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQ 139
                  ALVD+PGYGYA+ P+K    W   + +YL  R +LR + +++D RH +K+ D 
Sbjct: 86  -----QRALVDLPGYGYAKVPEKMKQKWQQTLAKYLETRQSLRGLMMMMDVRHPLKEFDL 140

Query: 140 DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI 199
            + S+ ++  +S  I+LTK DKL  + A+++L K    ++N+      V   SS+ + G 
Sbjct: 141 QMLSWANQADLSVHILLTKADKLKNSAAKQSLLKVVAELKNHDL-KASVQLFSSLNKSGR 199

Query: 200 EV 201
           ++
Sbjct: 200 DI 201


>gi|332292523|ref|YP_004431132.1| ribosome biogenesis GTP-binding protein YsxC [Krokinobacter
           diaphorus 4H-3-7-5]
 gi|332170609|gb|AEE19864.1| ribosome biogenesis GTP-binding protein YsxC [Krokinobacter
           diaphorus 4H-3-7-5]
          Length = 203

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 95/165 (57%), Gaps = 9/165 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    E+   P    PE AF GRSNVGKSSLIN+L NRK+LA+TS  PG+TQ +N F+ 
Sbjct: 8   FVVSNSEVTKCPNTRIPEYAFIGRSNVGKSSLINMLTNRKSLAKTSGRPGKTQLINHFLI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            LVD+PGYGYAR  KK+   +   I  Y  +R  +   ++L+DCRH 
Sbjct: 68  NE---------NWHLVDLPGYGYARVSKKDKKYFQKFITDYFEQREQMISAFVLVDCRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLI 178
            ++ID +   +L +K + + I+ TK DKL P   +  +E  K ++
Sbjct: 119 PQKIDMEFMEYLGEKEIPFSIIFTKADKLRPQALERNIEVYKKIM 163


>gi|313884146|ref|ZP_07817912.1| ribosome biogenesis GTP-binding protein YsxC [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312620593|gb|EFR32016.1| ribosome biogenesis GTP-binding protein YsxC [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 198

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 104/182 (57%), Gaps = 11/182 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A +GRSNVGKSS IN L+ RKNLARTS+ PG+TQ LNF+             
Sbjct: 19  PQDQLPEVALAGRSNVGKSSFINSLIARKNLARTSSQPGKTQTLNFYAINQ--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A   VD+PGYGYAR  K    +W  +I +YLS+R  +  ++LL+D RH   ++D+++  F
Sbjct: 70  AFRFVDVPGYGYARVSKDFRLAWSKMIEKYLSQRENMELLFLLMDMRHEPTRLDREMKDF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
            +   + Y IVLTK DK+ P +  + L   K  +   P+    + P S+ K  G E +  
Sbjct: 130 AENLDLPYAIVLTKADKIKPASWNKHLSMYKKALE-LPSVDA-LFPYSATKGYGKEEIWD 187

Query: 205 AI 206
            I
Sbjct: 188 VI 189


>gi|66827277|ref|XP_646993.1| hypothetical protein DDB_G0268824 [Dictyostelium discoideum AX4]
 gi|60475065|gb|EAL73001.1| hypothetical protein DDB_G0268824 [Dictyostelium discoideum AX4]
          Length = 432

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 116/211 (54%), Gaps = 11/211 (5%)

Query: 1   MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSN 60
           + ++  F+K A +    +  +   PK   P++AF G+SNVGKS+L+N ++ R++LA  S 
Sbjct: 204 LFANVFFSKEASLDTMAIKSVDF-PKKHFPQVAFLGKSNVGKSTLLNSVL-RRDLAYVSK 261

Query: 61  APGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST 120
           + G T+ +NF+              + LVD+PGYG+A+  KK    WG  I  +L     
Sbjct: 262 SAGCTKTINFY---------QIWEKLYLVDLPGYGFAKVSKKKSTVWGNAISEFLLTSPN 312

Query: 121 LRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
           L  V+LLID R+ + + D +  S LD+  VS+QIVLTKIDK +P+  +      K  I+ 
Sbjct: 313 LFKVFLLIDSRNKIHKNDIEAMSLLDQHKVSFQIVLTKIDKTTPSMLRSLYGSLKEEIQK 372

Query: 181 YPTAHPEVIPTSSVKRKGIEVLRKAILETIN 211
                P +I TSSV  KGI+ +R  IL   N
Sbjct: 373 TTCCLPTIIQTSSVDSKGIDDIRTTILNVTN 403


>gi|212551105|ref|YP_002309422.1| ribosome biogenesis GTP-binding protein YsxC [Candidatus
           Azobacteroides pseudotrichonymphae genomovar. CFP2]
 gi|212549343|dbj|BAG84011.1| GTPase EngB [Candidatus Azobacteroides pseudotrichonymphae
           genomovar. CFP2]
          Length = 209

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 116/198 (58%), Gaps = 12/198 (6%)

Query: 13  IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           +F+ G  ++G  P+ G PE AF GRSNVGKSSLIN+L  +K LA TS+ PG+TQ +N+F 
Sbjct: 15  VFVVGNTDVGKCPRDGFPEYAFIGRSNVGKSSLINMLTGQKGLALTSSIPGKTQLINYF- 73

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSER-STLRCVYLLIDCR 131
                 L NN     LVD+PGYGYA+  K+   +   +I  YL +R   L C+++LIDCR
Sbjct: 74  ------LINN--EWYLVDLPGYGYAQGGKQKRRTLQRIIDNYLCQRKKELTCIFVLIDCR 125

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK-YLIRNYPTAHPEVIP 190
           H  ++ D +    L      + IV TKIDKLS  + +E ++  +  L++N+    P +  
Sbjct: 126 HNPQKNDTEFIQQLGGNGFPFVIVFTKIDKLSNKSLKENIDVYQSTLLKNWEEL-PSIFV 184

Query: 191 TSSVKRKGIEVLRKAILE 208
           TSS ++ G + +   I E
Sbjct: 185 TSSERKIGRDEILNYIEE 202


>gi|332878394|ref|ZP_08446117.1| ribosome biogenesis GTP-binding protein YsxC [Capnocytophaga sp.
           oral taxon 329 str. F0087]
 gi|332683659|gb|EGJ56533.1| ribosome biogenesis GTP-binding protein YsxC [Capnocytophaga sp.
           oral taxon 329 str. F0087]
          Length = 200

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 103/196 (52%), Gaps = 9/196 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    ++   PK   PE AF GRSNVGKSSLIN+L N KNLA+TS  PG+TQ +N F  
Sbjct: 7   FVMSNSQVAKCPKDRLPEYAFIGRSNVGKSSLINMLTNCKNLAKTSGRPGKTQLINHFKI 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYAR  K     +   I  Y  +R  L   ++L+D RH 
Sbjct: 67  DD---------RWFLVDLPGYGYARVSKTTKQVFQRFITDYFEQREQLVSAFVLVDIRHE 117

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID +   +L ++A+ + I+ TK DKL P   +  +   K  +  +    P    TS+
Sbjct: 118 PQKIDVEFMQWLGERAIPFAIIFTKADKLKPQAIERNVAAYKEALLEWWEEFPPYFVTSA 177

Query: 194 VKRKGIEVLRKAILET 209
             + G E L + I +T
Sbjct: 178 QNKTGKEELTQYIEQT 193


>gi|253575676|ref|ZP_04853012.1| ribosome biogenesis GTP-binding protein YsxC [Paenibacillus sp.
           oral taxon 786 str. D14]
 gi|251845014|gb|EES73026.1| ribosome biogenesis GTP-binding protein YsxC [Paenibacillus sp.
           oral taxon 786 str. D14]
          Length = 214

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/148 (44%), Positives = 93/148 (62%), Gaps = 9/148 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSSLIN ++NRKNLARTS+ PG+TQHLN++   D         
Sbjct: 19  PEDALPEIALAGRSNVGKSSLINRMINRKNLARTSSTPGKTQHLNYYRVND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K   + WG +I +YL ER TL+ V  +ID RH   + D+ ++ +
Sbjct: 70  RLYFVDVPGYGYAKVSKSQREVWGKMIEKYLQERETLKLVLQIIDLRHPPTKDDELMYDW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLE 172
           L    +   +V TK DK+  +  Q+ L+
Sbjct: 130 LKAYELPVCVVATKADKVPKSRWQKHLK 157


>gi|91206092|ref|YP_538447.1| GTPase EngB [Rickettsia bellii RML369-C]
 gi|157826475|ref|YP_001495539.1| ribosome biogenesis GTP-binding protein YsxC [Rickettsia bellii OSU
           85-389]
 gi|119369249|sp|Q1RH06|ENGB_RICBR RecName: Full=Probable GTP-binding protein EngB
 gi|166225974|sp|A8GUK6|ENGB_RICB8 RecName: Full=Probable GTP-binding protein EngB
 gi|91069636|gb|ABE05358.1| Hypothetical GTP-binding protein [Rickettsia bellii RML369-C]
 gi|157801779|gb|ABV78502.1| GTPase EngB [Rickettsia bellii OSU 85-389]
          Length = 212

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 109/198 (55%), Gaps = 14/198 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G  +I  LP    P+IAF G+SNVGKSSLIN + N K LA+ SN PGRT+ +NFF  
Sbjct: 24  FVAGAMDIKQLPNFALPQIAFVGKSNVGKSSLINTICNNKKLAKVSNTPGRTRQINFF-- 81

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                  N +  + +VD+PGYG+A+ P +  D W  LI  YL +   L+ V LLID R G
Sbjct: 82  -------NLVDKLIIVDLPGYGFAQVPNQVKDQWEILINHYLRKSDNLKLVNLLIDSRRG 134

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR-NYPTAHPEVIPTS 192
           +K+ D+ V   L      +QI+ TK DK++       LE   +L   NY      +I  S
Sbjct: 135 IKENDKKVAELLLANKRDFQIIFTKSDKVTD-RKNLNLEAQNFLATLNYSC---NLIYVS 190

Query: 193 SVKRKGIEVLRKAILETI 210
           S  ++G   L+ ++ + I
Sbjct: 191 SRSKEGARELKTSLAKCI 208


>gi|134300397|ref|YP_001113893.1| ribosome biogenesis GTP-binding protein YsxC [Desulfotomaculum
           reducens MI-1]
 gi|172044336|sp|A4J7L5|ENGB_DESRM RecName: Full=Probable GTP-binding protein EngB
 gi|134053097|gb|ABO51068.1| small GTP-binding protein [Desulfotomaculum reducens MI-1]
          Length = 205

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 81/193 (41%), Positives = 110/193 (56%), Gaps = 16/193 (8%)

Query: 22  GLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN 81
           G  P    PE+AF GRSNVGKSSLIN +VNRK LA+TS+ PGRTQ +NFF      N+ N
Sbjct: 16  GGYPPGNLPEVAFVGRSNVGKSSLINKVVNRKGLAKTSSTPGRTQLINFF------NINN 69

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDV 141
           +     +VD+PGYGYA+ P      WG +I  YL ER  L+ V LLID RH     D+ +
Sbjct: 70  D--QFLMVDLPGYGYAKVPTDVRIKWGKMIEGYLKERECLKGVVLLIDSRHTPTAQDKQM 127

Query: 142 FSFLDKKAVSYQIVLTKIDKLSPTT---AQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           + +L    V   +V TK+DKLS       Q  ++K+  L + +     ++I  S+   +G
Sbjct: 128 YEWLQYYHVPTVVVATKVDKLSNNQWAKQQAVIKKSLPLSKEH-----QLISFSAETGRG 182

Query: 199 IEVLRKAILETIN 211
            E L K + E I+
Sbjct: 183 KEKLLKVLDEFIH 195


>gi|295092437|emb|CBK78544.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Clostridium cf.
           saccharolyticum K10]
          Length = 205

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 111/188 (59%), Gaps = 15/188 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PE AF+G+SNVGKSSLIN L+NRK+ ARTS  PG+TQ +NF+   D        
Sbjct: 18  LPANTQPEFAFAGKSNVGKSSLINALMNRKSYARTSAQPGKTQTINFYHIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
            A+  VD+PGYGYARA ++    WG +I  YL +   L+CV+LLID RH   + D+ ++S
Sbjct: 70  -ALYYVDLPGYGYARANEEVKAKWGKMIENYLHKSPMLKCVFLLIDIRHEPSENDRLMYS 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEV 201
           ++  +     I+ TK+DKL  +   + ++    ++R      PE  +IP S+  ++G E 
Sbjct: 129 WIQNQGYRPVIIATKLDKLKRSQVAKHVK----MVRTGLGMEPEDLLIPFSAETKQGREK 184

Query: 202 LRKAILET 209
           +   I +T
Sbjct: 185 IWDFIEKT 192


>gi|323351644|ref|ZP_08087298.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis VMC66]
 gi|322122130|gb|EFX93856.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis VMC66]
          Length = 195

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 100/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KLRFVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K         + + I  SSV + G++  
Sbjct: 132 LRYYNIPVILVATKADKIPRGKWNKHESAIKKKLDF----DKNDDFILFSSVTKDGLDAA 187

Query: 203 RKAILETI 210
             AIL  I
Sbjct: 188 WDAILSKI 195


>gi|298714913|emb|CBJ27669.1| YihA4, YihA/EngB-like GTPase [Ectocarpus siliculosus]
          Length = 677

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 74/188 (39%), Positives = 104/188 (55%), Gaps = 8/188 (4%)

Query: 14  FLRGVPEIGLLPKAGP-PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           F++G   +  LPK    PE AF GRSNVGKSSLIN++ NRK LA TS  PG+TQ  N+F+
Sbjct: 419 FVKGAVSMATLPKEPVLPEAAFIGRSNVGKSSLINMVCNRKALAFTSKRPGKTQQFNYFL 478

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
             +     N   A  LVD+PG GYA+ P+K    W  L   Y++ RS+LR ++ LID RH
Sbjct: 479 MNN-----NTENAFYLVDLPGMGYAKVPEKQRKEWSTLFRSYITRRSSLRVLFHLIDGRH 533

Query: 133 GVKQIDQDVFSFLDK--KAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP 190
           G    D  +   + +      Y +VLTK DK   + +++ LE     +R    +   V+ 
Sbjct: 534 GPVGQDHAIMKLMAELPDTARYVVVLTKADKSDNSVSRQVLEGVVAALREAGVSRTPVVL 593

Query: 191 TSSVKRKG 198
           TS+  + G
Sbjct: 594 TSAASKLG 601


>gi|327474151|gb|EGF19561.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK408]
          Length = 195

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 100/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KLRFVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K         + + I  SSV + G++  
Sbjct: 132 LKYYNIPVILVATKADKIPRGKWNKHESAIKKKLDF----DKNDDFILFSSVTKDGLDAS 187

Query: 203 RKAILETI 210
             AIL  I
Sbjct: 188 WDAILSKI 195


>gi|124005837|ref|ZP_01690675.1| GTP-binding protein [Microscilla marina ATCC 23134]
 gi|123988520|gb|EAY28161.1| GTP-binding protein [Microscilla marina ATCC 23134]
          Length = 200

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/193 (38%), Positives = 104/193 (53%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++   +    P    PE AF GRSNVGKSSLIN L NRK+LA+TS  PG+TQ +N F+ 
Sbjct: 8   FIKSSTDYTQCPAVHQPEYAFIGRSNVGKSSLINKLTNRKSLAKTSQNPGKTQTINHFLI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA+A K     WG +I  Y+ +R  L  +++LID RH 
Sbjct: 68  ND---------RWHLVDLPGYGYAKASKTERKKWGKMINDYILKREVLLGIFVLIDARHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID +   +L ++ V + +V TK DKLS     + +   +  I       P    TSS
Sbjct: 119 PQKIDLEFLEWLGEERVPFTMVFTKSDKLSSNKLPQAIASYRKAILRTWEEMPTHFVTSS 178

Query: 194 VKRKGIEVLRKAI 206
           V   G + + K I
Sbjct: 179 VSGLGCDEILKFI 191


>gi|52081302|ref|YP_080093.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus
           licheniformis ATCC 14580]
 gi|52786681|ref|YP_092510.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus
           licheniformis ATCC 14580]
 gi|319647215|ref|ZP_08001437.1| GTPase EngB [Bacillus sp. BT1B_CT2]
 gi|81825232|sp|Q65GJ7|ENGB_BACLD RecName: Full=Probable GTP-binding protein EngB
 gi|52004513|gb|AAU24455.1| GTP-binding domain,Small GTP-binding protein domain [Bacillus
           licheniformis ATCC 14580]
 gi|52349183|gb|AAU41817.1| YsxC [Bacillus licheniformis ATCC 14580]
 gi|317390562|gb|EFV71367.1| GTPase EngB [Bacillus sp. BT1B_CT2]
          Length = 195

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 86/138 (62%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G PEIA +GRSNVGKSS IN ++NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PEGGLPEIALAGRSNVGKSSFINTMINRKNLARTSSKPGKTQTLNFYIIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYG+A+  K   ++WG +I  YL+ R  L+ V  ++D RH   Q D  ++ F
Sbjct: 70  VLHFVDVPGYGFAKVSKTEREAWGRMIETYLTSREELKAVVQIVDLRHAPSQDDVMMYDF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   ++ TK DK+
Sbjct: 130 LKHYEIPVIVIATKADKI 147


>gi|119369278|sp|Q5GSS9|ENGB_WOLTR RecName: Full=Probable GTP-binding protein EngB
          Length = 197

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 100/167 (59%), Gaps = 8/167 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G  +I  LP    PEIAF+GRSNVGKSSLIN+L+N K  AR S+ PG T+ +NF+  
Sbjct: 11  FMFGASDIKSLPNESAPEIAFAGRSNVGKSSLINLLINSKKAARVSSKPGCTRQINFY-- 68

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               ++ N+     LVD+PGYG + A K     + GL+  YL  R  LR V++LID +  
Sbjct: 69  ----SMYND--KFRLVDLPGYGCSHASKDETIQYLGLVEYYLIHRRNLRRVFVLIDSKVR 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
           +K+ID+D   +L    +++ +VLTKIDK+        +E T+  I N
Sbjct: 123 LKEIDKDFIYWLTYNNINFDVVLTKIDKVDRENLDAIIESTRKWINN 169


>gi|282883087|ref|ZP_06291687.1| ribosome biogenesis GTP-binding protein YsxC [Peptoniphilus
           lacrimalis 315-B]
 gi|281297064|gb|EFA89560.1| ribosome biogenesis GTP-binding protein YsxC [Peptoniphilus
           lacrimalis 315-B]
          Length = 198

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 101/178 (56%), Gaps = 11/178 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PE AF+GRSNVGKSS IN ++ RKNLARTS+ PG+T+ +NF+   D         
Sbjct: 19  PANNLPEFAFAGRSNVGKSSFINAMLGRKNLARTSSTPGKTRTINFYKVND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            + LVD+PGYGYA+  KK  DSW  +I  YL  R  L    LL+D RH   Q+D  ++ +
Sbjct: 70  DLRLVDLPGYGYAKVSKKEKDSWANIINEYLETRENLLETILLVDIRHDPTQLDIQMYDY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L     S  ++ TK DK+S ++ ++ ++     ++        +IP SSV +  ++ L
Sbjct: 130 LLASGFSGIVIATKKDKISKSSVKKNIDNIARKLK--APVKENIIPFSSVDKDEVDEL 185


>gi|326790234|ref|YP_004308055.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium
           lentocellum DSM 5427]
 gi|326540998|gb|ADZ82857.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium
           lentocellum DSM 5427]
          Length = 196

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 113/203 (55%), Gaps = 17/203 (8%)

Query: 8   TKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQH 67
           TK+  I   G+      P    PEIAF+G+SNVGKSSL+N ++NRK LARTS+ PG+TQ 
Sbjct: 4   TKAEMIITAGLS--SQFPVHDMPEIAFAGKSNVGKSSLLNAMLNRKALARTSSQPGKTQT 61

Query: 68  LNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLL 127
           +NF+  +D             VD+PGYGYA+  K + + WG LI  YL +R  L+ + LL
Sbjct: 62  INFYNVQD---------TYMFVDLPGYGYAKVSKTDRERWGKLIEGYLEKREQLKKIILL 112

Query: 128 IDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE 187
           ID RH V   D+ ++ ++        +V TK+DK+  +  Q+ L     +IR      PE
Sbjct: 113 IDIRHEVGNNDKMMYDWIKHYHNEVIVVATKMDKIKRSQVQKHLS----MIRKGLNLMPE 168

Query: 188 --VIPTSSVKRKGIEVLRKAILE 208
             ++  SS  ++G E L K I E
Sbjct: 169 DKLVGFSSETKQGKEELWKIIEE 191


>gi|257869244|ref|ZP_05648897.1| GTP-binding protein [Enterococcus gallinarum EG2]
 gi|257803408|gb|EEV32230.1| GTP-binding protein [Enterococcus gallinarum EG2]
          Length = 195

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 85/138 (61%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PEIA +GRSNVGKSS IN L+NRKNLARTS+ PG+TQ LNF++      ++N L 
Sbjct: 19  PDTHLPEIALAGRSNVGKSSFINTLINRKNLARTSSKPGKTQTLNFYL------IENTL- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K     WG +I  YL+ER  LR V  L+D RH   Q D  ++ F
Sbjct: 72  --HFVDVPGYGYAKVSKTERAKWGKMIETYLAERQQLRAVVSLVDLRHAPSQEDIQMYQF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   +V TK DK+
Sbjct: 130 LKYYEIPVIVVATKADKI 147


>gi|157803283|ref|YP_001491832.1| ribosome biogenesis GTP-binding protein YsxC [Rickettsia canadensis
           str. McKiel]
 gi|166225975|sp|A8EXG4|ENGB_RICCK RecName: Full=Probable GTP-binding protein EngB
 gi|157784546|gb|ABV73047.1| GTP-binding protein [Rickettsia canadensis str. McKiel]
          Length = 219

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 108/197 (54%), Gaps = 12/197 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  +P    PEIAF G+SNVGKSSLIN + N KNLA+ SN PGRT  +NFF  
Sbjct: 26  FVAGAMNINQIPNFLLPEIAFIGKSNVGKSSLINTICNNKNLAKVSNIPGRTGQINFFNL 85

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A  P    + W  LI  YL   + LR V LLID R G
Sbjct: 86  AD---------KLIIVDLPGYGFANVPISVKEQWEVLISYYLRNSNNLRLVNLLIDSRRG 136

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K+ D+ V   L K   S+QI+ TK DK++      T E   +L   + + +  V+  SS
Sbjct: 137 IKENDKKVAELLLKNKRSFQIIFTKFDKVTD-CKNLTDEAQNFLTTLHYSCN--VMYVSS 193

Query: 194 VKRKGIEVLRKAILETI 210
             ++G   L+ ++ + I
Sbjct: 194 RSKEGARELKASLAKCI 210


>gi|332361328|gb|EGJ39132.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK1056]
          Length = 195

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 101/189 (53%), Gaps = 17/189 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK  + WG +I  YL+ R  L+ V  L+D RH     D  ++ F
Sbjct: 72  KLRFVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLKAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL---SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEV 201
           L    +   +V TK DK+        +  ++K     RN      + I  SSV + G++ 
Sbjct: 132 LKYYDIPVILVATKADKIPRGKWNKHESAIKKKLDFDRN-----DDFILFSSVTKDGLDA 186

Query: 202 LRKAILETI 210
              AIL  I
Sbjct: 187 AWDAILSKI 195


>gi|291550778|emb|CBL27040.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Ruminococcus
           torques L2-14]
          Length = 206

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 109/188 (57%), Gaps = 15/188 (7%)

Query: 23  LLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNN 82
           +LP+   PEIAF+G+SNVGKSSLIN L+NRK+ AR S  PG+TQ +NF+   +       
Sbjct: 17  VLPENDKPEIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFYTINE------- 69

Query: 83  LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVF 142
              M LVD+PGYGYA+  ++    WG LI RYL     L+ V+LLID RH     D+ ++
Sbjct: 70  --EMYLVDLPGYGYAKVSEQEKIQWGKLIERYLHTSKQLKAVFLLIDIRHDPSANDKMMY 127

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
            ++  +     I+ TK+DK+  +  Q+ ++  K  ++  P    +VIP SS  ++G    
Sbjct: 128 QWILDQGYQPIIIATKLDKIKRSQVQKHIKMLKTGLQLVPGT--KVIPFSSQTKQG---- 181

Query: 203 RKAILETI 210
           R  I E I
Sbjct: 182 RDEIWELI 189


>gi|331086217|ref|ZP_08335299.1| GTP-binding protein engB [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330406376|gb|EGG85890.1| GTP-binding protein engB [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 205

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 104/175 (59%), Gaps = 11/175 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PEIAF+G+SNVGKSSLIN L+NRK+ AR S  PG+TQ +NF+         N  
Sbjct: 18  LPENDKPEIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFY---------NIN 68

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             M LVD+PGYGYA+  +K    WG LI +YL     LR V+LLID RH     D+ ++ 
Sbjct: 69  EEMYLVDLPGYGYAKVSEKEKIQWGKLIEKYLHTSKQLRAVFLLIDIRHEPSANDKMMYQ 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           ++  +  +  I+ TK+DK+  +  Q+ ++  K  ++  P     VIP SS  ++G
Sbjct: 129 WIVDQGYNPIIIATKLDKIKRSQVQKHVKMIKEGLQLVPGTT--VIPFSSETKQG 181


>gi|325662425|ref|ZP_08151031.1| GTP-binding protein engB [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471259|gb|EGC74483.1| GTP-binding protein engB [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 205

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 104/175 (59%), Gaps = 11/175 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PEIAF+G+SNVGKSSLIN L+NRK+ AR S  PG+TQ +NF+         N  
Sbjct: 18  LPENDKPEIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFY---------NIN 68

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             M LVD+PGYGYA+  +K    WG LI +YL     LR V+LLID RH     D+ ++ 
Sbjct: 69  EEMYLVDLPGYGYAKVSEKEKIQWGKLIEKYLHTSKQLRAVFLLIDIRHEPSANDKMMYQ 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           ++  +  +  I+ TK+DK+  +  Q+ ++  K  ++  P     VIP SS  ++G
Sbjct: 129 WIVDQGYNPIIIATKLDKIKRSQVQKHVKMIKEGLQLVPGTT--VIPFSSETKQG 181


>gi|332360698|gb|EGJ38507.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           sanguinis SK49]
          Length = 195

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 99/188 (52%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK  + WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KLRFVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K         + + I  SSV + G++  
Sbjct: 132 LKYYDIPVVLVATKADKIPRGKWNKHESAIKKKLDF----DKNDDFILFSSVTKDGLDAA 187

Query: 203 RKAILETI 210
             AI   I
Sbjct: 188 WDAIFSKI 195


>gi|295113199|emb|CBL31836.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Enterococcus sp.
           7L76]
          Length = 193

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 86/138 (62%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P++  PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNF++ +D         
Sbjct: 19  PESQLPEIALAGRSNVGKSSFINTLINRKNLARTSGKPGKTQTLNFYLIED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+  VD+PGYGYA+  K     WG +I  Y+++R  LR V  LID RH   Q D  ++ F
Sbjct: 70  ALHFVDVPGYGYAKVSKTERAKWGKMIETYITQREQLRAVVSLIDLRHPPTQDDIQMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   IV TK DK+
Sbjct: 130 LKYYDLPVIIVATKADKI 147


>gi|331649708|ref|ZP_08350788.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           M605]
 gi|331041341|gb|EGI13491.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           M605]
          Length = 215

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 16  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKNLARTSKTPGRTQLINLFEV 75

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 76  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 127 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSS 185

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 186 LKKQGVDKLRQKL 198


>gi|29376444|ref|NP_815598.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           V583]
 gi|227519262|ref|ZP_03949311.1| GTPase [Enterococcus faecalis TX0104]
 gi|227555531|ref|ZP_03985578.1| GTPase [Enterococcus faecalis HH22]
 gi|229545497|ref|ZP_04434222.1| GTPase [Enterococcus faecalis TX1322]
 gi|229549743|ref|ZP_04438468.1| GTPase [Enterococcus faecalis ATCC 29200]
 gi|255972439|ref|ZP_05423025.1| GTP-binding protein [Enterococcus faecalis T1]
 gi|255975539|ref|ZP_05426125.1| GTP-binding protein [Enterococcus faecalis T2]
 gi|256762853|ref|ZP_05503433.1| GTP-binding protein [Enterococcus faecalis T3]
 gi|256853437|ref|ZP_05558807.1| GTPase EngB [Enterococcus faecalis T8]
 gi|256959235|ref|ZP_05563406.1| GTP-binding protein [Enterococcus faecalis DS5]
 gi|256961588|ref|ZP_05565759.1| GTP-binding protein [Enterococcus faecalis Merz96]
 gi|256964804|ref|ZP_05568975.1| GTP-binding protein [Enterococcus faecalis HIP11704]
 gi|257079303|ref|ZP_05573664.1| GTP-binding protein [Enterococcus faecalis JH1]
 gi|257082258|ref|ZP_05576619.1| GTP-binding protein [Enterococcus faecalis E1Sol]
 gi|257084875|ref|ZP_05579236.1| GTP-binding protein [Enterococcus faecalis Fly1]
 gi|257087128|ref|ZP_05581489.1| GTP-binding protein [Enterococcus faecalis D6]
 gi|257416358|ref|ZP_05593352.1| GTP-binding protein [Enterococcus faecalis AR01/DG]
 gi|257419606|ref|ZP_05596600.1| GTP-binding protein [Enterococcus faecalis T11]
 gi|257422288|ref|ZP_05599278.1| GTPase engB [Enterococcus faecalis X98]
 gi|293382410|ref|ZP_06628347.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           R712]
 gi|293388259|ref|ZP_06632775.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           S613]
 gi|294779795|ref|ZP_06745182.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           PC1.1]
 gi|300861039|ref|ZP_07107126.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TUSoD Ef11]
 gi|307268263|ref|ZP_07549647.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX4248]
 gi|307272886|ref|ZP_07554133.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0855]
 gi|307275639|ref|ZP_07556780.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX2134]
 gi|307280531|ref|ZP_07561580.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0860]
 gi|307287932|ref|ZP_07567965.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0109]
 gi|307295962|ref|ZP_07575794.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0411]
 gi|312900931|ref|ZP_07760225.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0470]
 gi|312902701|ref|ZP_07761905.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0635]
 gi|312908363|ref|ZP_07767327.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           DAPTO 512]
 gi|312910564|ref|ZP_07769406.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           DAPTO 516]
 gi|312950950|ref|ZP_07769860.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0102]
 gi|81838891|sp|Q833M8|ENGB_ENTFA RecName: Full=Probable GTP-binding protein EngB
 gi|29343908|gb|AAO81668.1| GTP-binding protein [Enterococcus faecalis V583]
 gi|227073274|gb|EEI11237.1| GTPase [Enterococcus faecalis TX0104]
 gi|227175336|gb|EEI56308.1| GTPase [Enterococcus faecalis HH22]
 gi|229305012|gb|EEN71008.1| GTPase [Enterococcus faecalis ATCC 29200]
 gi|229309413|gb|EEN75400.1| GTPase [Enterococcus faecalis TX1322]
 gi|255963457|gb|EET95933.1| GTP-binding protein [Enterococcus faecalis T1]
 gi|255968411|gb|EET99033.1| GTP-binding protein [Enterococcus faecalis T2]
 gi|256684104|gb|EEU23799.1| GTP-binding protein [Enterococcus faecalis T3]
 gi|256711896|gb|EEU26934.1| GTPase EngB [Enterococcus faecalis T8]
 gi|256949731|gb|EEU66363.1| GTP-binding protein [Enterococcus faecalis DS5]
 gi|256952084|gb|EEU68716.1| GTP-binding protein [Enterococcus faecalis Merz96]
 gi|256955300|gb|EEU71932.1| GTP-binding protein [Enterococcus faecalis HIP11704]
 gi|256987333|gb|EEU74635.1| GTP-binding protein [Enterococcus faecalis JH1]
 gi|256990288|gb|EEU77590.1| GTP-binding protein [Enterococcus faecalis E1Sol]
 gi|256992905|gb|EEU80207.1| GTP-binding protein [Enterococcus faecalis Fly1]
 gi|256995158|gb|EEU82460.1| GTP-binding protein [Enterococcus faecalis D6]
 gi|257158186|gb|EEU88146.1| GTP-binding protein [Enterococcus faecalis ARO1/DG]
 gi|257161434|gb|EEU91394.1| GTP-binding protein [Enterococcus faecalis T11]
 gi|257164112|gb|EEU94072.1| GTPase engB [Enterococcus faecalis X98]
 gi|291080186|gb|EFE17550.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           R712]
 gi|291082341|gb|EFE19304.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           S613]
 gi|294453169|gb|EFG21584.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           PC1.1]
 gi|300850078|gb|EFK77828.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TUSoD Ef11]
 gi|306496293|gb|EFM65872.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0411]
 gi|306501077|gb|EFM70384.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0109]
 gi|306504079|gb|EFM73295.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0860]
 gi|306507744|gb|EFM76873.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX2134]
 gi|306510500|gb|EFM79523.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0855]
 gi|306515423|gb|EFM83954.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX4248]
 gi|310625777|gb|EFQ09060.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           DAPTO 512]
 gi|310631099|gb|EFQ14382.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0102]
 gi|310633755|gb|EFQ17038.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0635]
 gi|311289112|gb|EFQ67668.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           DAPTO 516]
 gi|311292030|gb|EFQ70586.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0470]
 gi|315025927|gb|EFT37859.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX2137]
 gi|315028965|gb|EFT40897.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX4000]
 gi|315033239|gb|EFT45171.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0017]
 gi|315036724|gb|EFT48656.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0027]
 gi|315143499|gb|EFT87515.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX2141]
 gi|315147582|gb|EFT91598.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX4244]
 gi|315149320|gb|EFT93336.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0012]
 gi|315152207|gb|EFT96223.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0031]
 gi|315157012|gb|EFU01029.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0043]
 gi|315159834|gb|EFU03851.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0312]
 gi|315161526|gb|EFU05543.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0645]
 gi|315163616|gb|EFU07633.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX1302]
 gi|315167355|gb|EFU11372.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX1341]
 gi|315169562|gb|EFU13579.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX1342]
 gi|315174261|gb|EFU18278.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX1346]
 gi|315574491|gb|EFU86682.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0309B]
 gi|315576776|gb|EFU88967.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0630]
 gi|315581847|gb|EFU94038.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX0309A]
 gi|323481058|gb|ADX80497.1| GTPase, EngB subfamily [Enterococcus faecalis 62]
 gi|327535433|gb|AEA94267.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           OG1RF]
 gi|329572879|gb|EGG54504.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecalis
           TX1467]
          Length = 193

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 86/138 (62%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P++  PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNF++ +D         
Sbjct: 19  PESQLPEIALAGRSNVGKSSFINTLINRKNLARTSGKPGKTQTLNFYLIED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+  VD+PGYGYA+  K     WG +I  Y+++R  LR V  LID RH   Q D  ++ F
Sbjct: 70  ALHFVDVPGYGYAKVSKTERAKWGKMIETYITQREQLRAVVSLIDLRHPPTQDDIQMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   IV TK DK+
Sbjct: 130 LKYYDLPVIIVATKADKI 147


>gi|256619397|ref|ZP_05476243.1| GTP-binding protein [Enterococcus faecalis ATCC 4200]
 gi|256598924|gb|EEU18100.1| GTP-binding protein [Enterococcus faecalis ATCC 4200]
          Length = 193

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 86/138 (62%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P++  PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNF++ +D         
Sbjct: 19  PESQLPEIALAGRSNVGKSSFINTLINRKNLARTSGKPGKTQTLNFYLIED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+  VD+PGYGYA+  K     WG +I  Y+++R  LR V  LID RH   Q D  ++ F
Sbjct: 70  ALHFVDVPGYGYAKVSKTERAKWGKMIETYITQREQLRAVVSLIDLRHPPTQDDIQMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   IV TK DK+
Sbjct: 130 LKYYDLPVIIVATKADKI 147


>gi|157825273|ref|YP_001492993.1| ribosome biogenesis GTP-binding protein YsxC [Rickettsia akari str.
           Hartford]
 gi|166225973|sp|A8GM60|ENGB_RICAH RecName: Full=Probable GTP-binding protein EngB
 gi|157799231|gb|ABV74485.1| GTPase EngB [Rickettsia akari str. Hartford]
          Length = 212

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 101/197 (51%), Gaps = 12/197 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  +P    PEIAF G+SNVGKSSLIN + N KNLA+ SN PGRT+ +NFF  
Sbjct: 26  FVAGAMNINQIPNFSLPEIAFVGKSNVGKSSLINTICNNKNLAKVSNTPGRTRQINFFNL 85

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A  P    + W  LI  YL     LR V LLID R G
Sbjct: 86  AD---------KLIIVDLPGYGFAHVPISVKEQWEVLISYYLRNSHNLRLVNLLIDSRRG 136

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K+ DQ V   L      +QI+ TK DK+          +      NY      V+  SS
Sbjct: 137 IKENDQKVAELLLANKREFQIIFTKSDKVIDCKNLNNEVQNFLATLNYSC---NVMYVSS 193

Query: 194 VKRKGIEVLRKAILETI 210
             ++G   L+ ++ + I
Sbjct: 194 RSKEGARALKASLAKCI 210


>gi|259046800|ref|ZP_05737201.1| ribosome biogenesis GTP-binding protein YsxC [Granulicatella
           adiacens ATCC 49175]
 gi|259036568|gb|EEW37823.1| ribosome biogenesis GTP-binding protein YsxC [Granulicatella
           adiacens ATCC 49175]
          Length = 199

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 86/138 (62%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PEIA SGRSNVGKSS IN L+ RK+LARTS+ PG+TQ LNF+   +         
Sbjct: 19  PAGDLPEIALSGRSNVGKSSFINKLIQRKSLARTSSKPGKTQTLNFYHINEL-------- 70

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  KK  + WG +I  Y++ R +LR V +L+D RH   Q D  +  F
Sbjct: 71  -FYFVDVPGYGYAKVSKKEREKWGKMIEEYITTRQSLRLVLILVDFRHEPSQEDVQMREF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L+   + Y+IV+TK DK+
Sbjct: 130 LEYYNIPYRIVMTKCDKI 147


>gi|311069312|ref|YP_003974235.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus atrophaeus
           1942]
 gi|310869829|gb|ADP33304.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus atrophaeus
           1942]
          Length = 195

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 106/189 (56%), Gaps = 15/189 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G PEIA +GRSNVGKSS IN L+NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PEGGLPEIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQTLNFYIIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYG+A+  K   ++WG +I  Y++ R  L+ V  ++D RH     D  ++ F
Sbjct: 70  DLHFVDVPGYGFAKVSKTEREAWGRMIETYITTREELKAVVQIVDLRHAPSADDVSMYDF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP--EVIPTSSVKRKGIEVL 202
           L    +   I+ TK DK+     +   +K   ++R      P  E+I  SS  +KG +  
Sbjct: 130 LKHYGIPVIIIATKADKI----PKGKWDKHAKVVRQTLNIEPEDELILFSSETKKGKDEA 185

Query: 203 RKAILETIN 211
             AI + IN
Sbjct: 186 WGAIKKMIN 194


>gi|258591281|emb|CBE67578.1| putative GTP-binding protein engB [NC10 bacterium 'Dutch sediment']
          Length = 230

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 107/195 (54%), Gaps = 15/195 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-V 72
           F+  V  +  LP+    EIA  GRSNVGKSSLIN L+ R+ LAR S  PGRTQ LNFF +
Sbjct: 17  FVTSVSSLAQLPREPRAEIAVVGRSNVGKSSLINCLLRRRGLARVSGVPGRTQLLNFFLI 76

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
            +DF           LVD+PGYGYA+ P     +WG LI  YL+    LR V +LID R 
Sbjct: 77  NRDFY----------LVDLPGYGYAKVPDSIRLAWGPLIEGYLASDRDLRVVIVLIDARQ 126

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETL-EKTKYLIRNYPTAHPEVIPT 191
           GV + D  +   LD  ++++  VLTKIDKL  T  Q  + +    L    P A   +IP 
Sbjct: 127 GVTEKDLQMKGLLDNFSINWIPVLTKIDKLRRTARQAHIRDAVDALGLRDPRA---IIPF 183

Query: 192 SSVKRKGIEVLRKAI 206
           S+   +G E L   I
Sbjct: 184 SAKSEEGRESLLAVI 198


>gi|190570517|ref|YP_001974875.1| GTP-binding protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019273|ref|ZP_03335080.1| GTP-binding protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|238058990|sp|B3CL86|ENGB_WOLPP RecName: Full=Probable GTP-binding protein EngB
 gi|190356789|emb|CAQ54151.1| GTP-binding protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995382|gb|EEB56023.1| GTP-binding protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 197

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 103/167 (61%), Gaps = 8/167 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G  +   LP    PEIAF+GRSNVGKSSLIN+L+N K  AR S+ PG T+ +NF+  
Sbjct: 11  FIFGASDKKSLPDESAPEIAFAGRSNVGKSSLINLLINSKKAARVSSKPGCTRQINFY-- 68

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               ++ N+     +VD+PGYGY+ A K+    +  LI  YL  R  L+ V++LID + G
Sbjct: 69  ----SMYND--KFRIVDLPGYGYSCASKEEAVQYLNLIEYYLIHRRNLKRVFVLIDSKVG 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
           +K+ID+D   +L    +++ IVLTKIDK++  +    LE T+  + N
Sbjct: 123 LKEIDKDFVYWLICNNINFNIVLTKIDKVNQESLNAILENTQKWVNN 169


>gi|300813662|ref|ZP_07093984.1| ribosome biogenesis GTP-binding protein YsxC [Peptoniphilus sp.
           oral taxon 836 str. F0141]
 gi|300512204|gb|EFK39382.1| ribosome biogenesis GTP-binding protein YsxC [Peptoniphilus sp.
           oral taxon 836 str. F0141]
          Length = 198

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 107/187 (57%), Gaps = 14/187 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-VPKDFSNLKNNL 83
           P    PE AF+GRSNVGKSS IN ++ RKNLARTS+ PG+T+ +NF+ V +D        
Sbjct: 19  PANNLPEFAFAGRSNVGKSSFINAMLGRKNLARTSSTPGKTRTINFYKVNED-------- 70

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + LVD+PGYGYA+  KK  DSW  +I  YL  R  L    LL+D RH   Q+D  ++ 
Sbjct: 71  --LRLVDLPGYGYAKVSKKEKDSWANIINEYLETRENLLETILLVDIRHDPTQLDLQMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +L     S  ++ TK DK+S ++ ++ ++     ++        +IP SSV +  ++ L 
Sbjct: 129 YLLASGFSGIVIATKKDKISKSSVKKNIDNIARKLK--APVKENIIPFSSVDKDEVDELW 186

Query: 204 KAILETI 210
             ILE I
Sbjct: 187 -YILEDI 192


>gi|300856720|ref|YP_003781704.1| putative GTP-binding protein [Clostridium ljungdahlii DSM 13528]
 gi|300436835|gb|ADK16602.1| predicted GTP-binding protein [Clostridium ljungdahlii DSM 13528]
          Length = 196

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 107/188 (56%), Gaps = 13/188 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-VPKDFSNLKNNL 83
           P     E+AF GRSNVGKSSLIN L NRK L + S  PG+T+ +NFF +  DF       
Sbjct: 19  PVDNRVEVAFVGRSNVGKSSLINTLTNRKKLVKVSATPGKTRQINFFLINNDF------- 71

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYA+  KK  +SWG +I +YL+ R  L+ + L++DCRH     D  ++ 
Sbjct: 72  ---YLVDLPGYGYAKVSKKEKESWGNIIEKYLNARQQLKKIVLILDCRHKPTADDITMYK 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           ++        IV TKIDK+S     + L+  +  ++   +   E++  S++ ++G E + 
Sbjct: 129 WIKHYNYDIAIVATKIDKVSKNQLSKNLKVIRDTLK--MSGEDEILTFSALNKQGKEKIL 186

Query: 204 KAILETIN 211
           + +  TIN
Sbjct: 187 EVLESTIN 194


>gi|330908183|gb|EGH36702.1| GTP-binding protein EngB [Escherichia coli AA86]
          Length = 210

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKNLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|71903337|ref|YP_280140.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes MGAS6180]
 gi|119369273|sp|Q48U21|ENGB_STRPM RecName: Full=Probable GTP-binding protein EngB
 gi|71802432|gb|AAX71785.1| GTP-binding protein [Streptococcus pyogenes MGAS6180]
          Length = 199

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 101/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PEIA +GRSNVGKSS IN ++ RKNLARTS+ PG+TQ LNFF   D         
Sbjct: 25  PKDDLPEIALAGRSNVGKSSFINTILGRKNLARTSSKPGKTQLLNFFNIDD--------- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   + D  ++ F
Sbjct: 76  KLRFVDVPGYGYAKVSKSERAKWGKMIEEYLTSRDNLRAVVSLVDLRHAPSKEDIQMYDF 135

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E++ K      N  T     I  SSV+R GI+  
Sbjct: 136 LKYYDIPVIVVATKADKIPRGKWNKHESVVKKALNFDNSDT----FIVFSSVERIGIDDS 191

Query: 203 RKAILETI 210
             AILE +
Sbjct: 192 WDAILEQV 199


>gi|239947151|ref|ZP_04698904.1| ribosome biogenesis GTP-binding protein YsxC [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239921427|gb|EER21451.1| ribosome biogenesis GTP-binding protein YsxC [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 212

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 104/197 (52%), Gaps = 12/197 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ GV  I  +P    PEIAF G+SNVGKS LIN++ N KNLA+ SN PGRT+ +NFF  
Sbjct: 24  FVAGVMNINQIPNFSLPEIAFVGKSNVGKSRLINMICNNKNLAKVSNTPGRTRQINFFNL 83

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A  P    + W  LI  YL     LR V LLID R G
Sbjct: 84  AD---------KLIIVDLPGYGFANVPISVKEQWEVLISYYLRNSHNLRLVNLLIDSRRG 134

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K+ D+ V   L      +QI+ TK DK++         +      NY      V+  SS
Sbjct: 135 IKENDKKVAELLLANKREFQIIFTKSDKVTDHKNLNDEAQNFLATLNYSC---NVMYVSS 191

Query: 194 VKRKGIEVLRKAILETI 210
             ++G+  L+ ++ + I
Sbjct: 192 RSKEGVRELKASLAKCI 208


>gi|257090205|ref|ZP_05584566.1| GTP-binding protein [Enterococcus faecalis CH188]
 gi|256999017|gb|EEU85537.1| GTP-binding protein [Enterococcus faecalis CH188]
          Length = 193

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 86/138 (62%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P++  PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNF++ +D         
Sbjct: 19  PESQLPEIALAGRSNVGKSSFINTLINRKNLARTSGKPGKTQTLNFYLIED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+  VD+PGYGYA+  K     WG +I  Y+++R  LR V  LID RH   Q D  ++ F
Sbjct: 70  ALHFVDVPGYGYAKVSKTERAKWGKMIETYITQREQLRVVVSLIDLRHPPTQDDIQMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   IV TK DK+
Sbjct: 130 LKYYDLPVIIVATKADKI 147


>gi|291518670|emb|CBK73891.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Butyrivibrio
           fibrisolvens 16/4]
          Length = 206

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 111/189 (58%), Gaps = 15/189 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LPK   PE+AF+G+SNVGKSSLIN ++NRK LAR S  PG+TQ +NF+   D        
Sbjct: 18  LPKNDLPEVAFAGKSNVGKSSLINAVMNRKALARVSAQPGKTQTINFYNIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + +VD+PGYG+A+A +K  + WG +I  YL+    +R V+LL+D RH     D+ +F 
Sbjct: 70  -EIYVVDLPGYGFAKASEKERERWGKMIETYLNTSDMIRAVFLLVDIRHTPSANDKQMFE 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEV 201
           ++D       ++ TK DK+     +  L+K   ++R    A  E  ++P SS  ++G++ 
Sbjct: 129 WMDYVGYDPIVIATKADKIK----RSQLDKQIKMVREGLGAGKETIIVPFSSQTKQGLDT 184

Query: 202 LRKAILETI 210
           ++  + + I
Sbjct: 185 IQDFLDQVI 193


>gi|34580908|ref|ZP_00142388.1| hypothetical GTP-binding protein [Rickettsia sibirica 246]
 gi|28262293|gb|EAA25797.1| hypothetical GTP-binding protein [Rickettsia sibirica 246]
          Length = 212

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 87/150 (58%), Gaps = 9/150 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  +P    PEIAF G+SNVGKSSLIN + N KNLA+ SN PGRT+ +NFF  
Sbjct: 24  FVAGAMNINQIPNFSLPEIAFVGKSNVGKSSLINTICNNKNLAKVSNTPGRTRQINFFNL 83

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A  P    + WG LI  YL     LR V LLID R G
Sbjct: 84  AD---------KLIIVDLPGYGFANVPISVKEQWGVLISYYLRNSYNLRLVNLLIDSRRG 134

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
           +K+ D+ V   L      +QI+ TK DK++
Sbjct: 135 IKENDKKVADLLLANKREFQIIFTKSDKVT 164


>gi|325264759|ref|ZP_08131488.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium sp. D5]
 gi|324030051|gb|EGB91337.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium sp. D5]
          Length = 200

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 110/188 (58%), Gaps = 15/188 (7%)

Query: 23  LLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNN 82
           +LP    PEIAF+G+SNVGKSSLIN L+NRK+ AR S  PG+TQ +NF+         N 
Sbjct: 17  VLPDNDKPEIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFY---------NI 67

Query: 83  LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVF 142
              M LVD+PGYGYA+  +K    WG LI RYL+  + L+ ++LLID RH     D+ ++
Sbjct: 68  NEEMYLVDLPGYGYAKVSEKEKVQWGKLIERYLNGSARLKAIFLLIDIRHEPSANDKMMY 127

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           S++  +     I+ TK+DK+  +  Q+ ++  +  +   P    ++IP SS  ++G    
Sbjct: 128 SWIVGQGFQPIIIATKMDKIKRSQIQKHVKMVREGLDLVPGT--KIIPFSSATKQG---- 181

Query: 203 RKAILETI 210
           R  I E I
Sbjct: 182 RDEIWELI 189


>gi|328866113|gb|EGG14499.1| Putative GTP-binding protein [Dictyostelium fasciculatum]
          Length = 525

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/183 (40%), Positives = 101/183 (55%), Gaps = 10/183 (5%)

Query: 20  EIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNL 79
           E  LLP++  PE+AF GRSNVGKSSLIN +  R  LA+TS+ PG TQ +N+F        
Sbjct: 289 EDSLLPESDTPEVAFIGRSNVGKSSLINAITLR-GLAKTSDKPGLTQSINWFELG----- 342

Query: 80  KNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQ 139
                 + LVD+PGYG+A A ++  D+W  L V YL+ R +L+ V++LID RHG K  D+
Sbjct: 343 ----STLRLVDLPGYGFAFAKQEKSDTWNQLSVNYLTSRKSLKRVFVLIDSRHGFKDSDR 398

Query: 140 DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI 199
            +   LDK     QIVLTK D        +        I++Y      ++  SS   KGI
Sbjct: 399 QLLDILDKNHTHTQIVLTKTDLSEQLDLAKRFTLVANEIKHYRHVQDPILMVSSKTYKGI 458

Query: 200 EVL 202
             L
Sbjct: 459 AEL 461


>gi|158521131|ref|YP_001529001.1| GTP-binding protein HSR1-related [Desulfococcus oleovorans Hxd3]
 gi|238686898|sp|A8ZXG6|ENGB_DESOH RecName: Full=Probable GTP-binding protein EngB
 gi|158509957|gb|ABW66924.1| GTP-binding protein HSR1-related [Desulfococcus oleovorans Hxd3]
          Length = 197

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 74/186 (39%), Positives = 108/186 (58%), Gaps = 16/186 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PEIAF+GRSNVGKSS+IN+LVNRKNL +TS+ PG+T+ +NFF   D +       
Sbjct: 19  PDTDLPEIAFAGRSNVGKSSMINLLVNRKNLVKTSSTPGKTRLINFF---DING------ 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  +K   +WG ++ RYLS R TLR + LL+D R   ++ +  +  +
Sbjct: 70  QLMFVDLPGYGYAKVSRKEQKTWGPMVERYLSSRKTLRGLMLLMDLRREPREDEFLMMQW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
                + +++VLTK DK   T A     +   + R       E+I  S++++ G    R 
Sbjct: 130 CAHYDIPWKMVLTKADKFKKTAAD---RRRHEIARAVGIGADEMILFSTLQKMG----RD 182

Query: 205 AILETI 210
             LETI
Sbjct: 183 PALETI 188


>gi|51246489|ref|YP_066373.1| hypothetical protein DP2637 [Desulfotalea psychrophila LSv54]
 gi|81641346|sp|Q6AJW0|ENGB_DESPS RecName: Full=Probable GTP-binding protein EngB
 gi|50877526|emb|CAG37366.1| conserved hypothetical GTP-binding protein [Desulfotalea
           psychrophila LSv54]
          Length = 193

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 91/150 (60%), Gaps = 9/150 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL  V  +  LP+ G PE AF+GRSNVGKSSL+N L+ R    + S  PG+TQ LNFF  
Sbjct: 8   FLLSVHGLDQLPEDGLPEFAFAGRSNVGKSSLMNTLLRRSGFVKVSGRPGKTQGLNFFQA 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            LVD+PGYG+AR  K+  ++W  LI  Y+SER  L+CV ++ID RH 
Sbjct: 68  AE---------DCMLVDLPGYGFARVSKEMQNNWQKLITSYISEREALKCVVVIIDIRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
            K +D+ +  +L ++ V    + TKIDKLS
Sbjct: 119 PKALDRQLLDWLREQKVPVLPIYTKIDKLS 148


>gi|34540179|ref|NP_904658.1| ribosome biogenesis GTP-binding protein YsxC [Porphyromonas
           gingivalis W83]
 gi|188995479|ref|YP_001929731.1| ribosome biogenesis GTP-binding protein YsxC [Porphyromonas
           gingivalis ATCC 33277]
 gi|81572162|sp|Q7MX68|ENGB_PORGI RecName: Full=Probable GTP-binding protein EngB
 gi|238689267|sp|B2RL89|ENGB_PORG3 RecName: Full=Probable GTP-binding protein EngB
 gi|34396491|gb|AAQ65557.1| GTP-binding protein [Porphyromonas gingivalis W83]
 gi|188595159|dbj|BAG34134.1| putative GTP-binding protein [Porphyromonas gingivalis ATCC 33277]
          Length = 201

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 78/187 (41%), Positives = 104/187 (55%), Gaps = 10/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PE AF GRSNVGKSSLIN+L  +K LA TS  PG+TQ +N F+  D         
Sbjct: 19  PDTRLPEYAFIGRSNVGKSSLINMLTGQKGLAMTSQKPGKTQLINHFIIDD--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           +  LVD+PGYGYAR    N +S   +I  Y+  R  L  +++LIDCRH  ++ID +   +
Sbjct: 70  SWYLVDLPGYGYARLGASNRESLRRIIETYILCREQLSSLFVLIDCRHEPQKIDLEFLQW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L +  + + IV TK DKLS +  +E  E  K  +       P V  TSS K+ G E L  
Sbjct: 130 LGENGIPFSIVFTKADKLSFSRLKENTEAYKQKLLETWEELPPVFITSSEKKTGKEELLD 189

Query: 205 AILETIN 211
            I ++IN
Sbjct: 190 YI-DSIN 195


>gi|58617188|ref|YP_196387.1| GTPase EngB [Ehrlichia ruminantium str. Gardel]
 gi|75432753|sp|Q5FGZ3|ENGB_EHRRG RecName: Full=Probable GTP-binding protein EngB
 gi|58416800|emb|CAI27913.1| Probable GTP-binding protein engB [Ehrlichia ruminantium str.
           Gardel]
          Length = 200

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 110/197 (55%), Gaps = 10/197 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  LP    PE+A +GRSNVGKSSLIN + N +  AR S+ PG T+ +NF++ 
Sbjct: 12  FIIGATSIKSLPDFSIPEVALAGRSNVGKSSLINAITNNRKNARISSKPGCTRQINFYLI 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                   N   M LVD+PGYGY++A +  V+S+  L+  YL  R  L  V LLID + G
Sbjct: 72  --------NKGLMVLVDLPGYGYSKADRATVNSYICLMEYYLLNRKNLSKVVLLIDAKVG 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            K+ID D   +L+   + YQ+VLTKID++        +   +    N+   +P +I  SS
Sbjct: 124 FKEIDLDFIRWLEVHQILYQLVLTKIDRVQSNVLDVIVSDVQNFNLNF-IIYP-IINVSS 181

Query: 194 VKRKGIEVLRKAILETI 210
             ++GIE L   I + I
Sbjct: 182 KCKQGIEELIYEIAQCI 198


>gi|157151518|ref|YP_001450428.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           gordonii str. Challis substr. CH1]
 gi|189037195|sp|A8AXB8|ENGB_STRGC RecName: Full=Probable GTP-binding protein EngB
 gi|157076312|gb|ABV10995.1| GTP-binding protein [Streptococcus gordonii str. Challis substr.
           CH1]
          Length = 197

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 79/189 (41%), Positives = 101/189 (53%), Gaps = 15/189 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KLRFVDVPGYGYAKVSKTERAKWGRMIEEYLTSRENLRAVVSLVDLRHEPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K    N+  A    I  SSV + G++  
Sbjct: 132 LKYYEIPVILVATKADKIPRGKWNKHESAIKKKL---NFDQADT-FILFSSVDKTGLDAS 187

Query: 203 RKAILETIN 211
             AILE +N
Sbjct: 188 WDAILEKVN 196


>gi|295107480|emb|CBL05023.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Gordonibacter
           pamelaeae 7-10-1-b]
          Length = 193

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 105/198 (53%), Gaps = 14/198 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F R       L  +  PE+AFSGRSNVGKSSL+N L NRK LA+ S  PG+T  +NFF  
Sbjct: 8   FERSFGTSAQLTPSTAPEVAFSGRSNVGKSSLLNKLFNRKGLAKVSQTPGKTATINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                   +   +  VD+PGYGYA+  K     W  LI  Y ++  +   V  L+D RH 
Sbjct: 66  --------DGDGVTFVDLPGYGYAKVSKSEKARWSELIEGYFNQDRSFALVVALVDIRHE 117

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA-HPEVIPTS 192
             ++D+++  FL +  + + + LTK DKLS    Q+ +++   L R         ++ TS
Sbjct: 118 ASELDENMIRFLREADLPFVVALTKADKLSR---QQQMKQKAALKRQLALGDDASMVVTS 174

Query: 193 SVKRKGIEVLRKAILETI 210
           S K  G+E LRK I + +
Sbjct: 175 SAKGDGMEELRKIIRDAV 192


>gi|16079871|ref|NP_390697.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221310759|ref|ZP_03592606.1| GTPase EngB [Bacillus subtilis subsp. subtilis str. 168]
 gi|221315084|ref|ZP_03596889.1| GTPase EngB [Bacillus subtilis subsp. subtilis str. NCIB 3610]
 gi|221320003|ref|ZP_03601297.1| GTPase EngB [Bacillus subtilis subsp. subtilis str. JH642]
 gi|221324285|ref|ZP_03605579.1| GTPase EngB [Bacillus subtilis subsp. subtilis str. SMY]
 gi|321312351|ref|YP_004204638.1| GTP-binding protein YsxC [Bacillus subtilis BSn5]
 gi|586754|sp|P38424|ENGB_BACSU RecName: Full=Probable GTP-binding protein EngB
 gi|49259156|pdb|1SUL|A Chain A, Crystal Structure Of The Apo-Ysxc
 gi|49259157|pdb|1SUL|B Chain B, Crystal Structure Of The Apo-Ysxc
 gi|49259162|pdb|1SVI|A Chain A, Crystal Structure Of The Gtp-Binding Protein Ysxc
           Complexed With Gdp
 gi|49259165|pdb|1SVW|A Chain A, Crystal Structure Of Ysxc Complexed With Gmppnp
 gi|49259166|pdb|1SVW|B Chain B, Crystal Structure Of Ysxc Complexed With Gmppnp
 gi|496558|emb|CAA53985.1| unnamed protein product [Bacillus subtilis subsp. subtilis str.
           168]
 gi|1770079|emb|CAA99541.1| hypothetical protein [Bacillus subtilis]
 gi|2635284|emb|CAB14779.1| GTPase involved in ribosome 50S subunit assembly [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|291485234|dbj|BAI86309.1| GTPase EngB [Bacillus subtilis subsp. natto BEST195]
 gi|320018625|gb|ADV93611.1| GTP-binding protein YsxC [Bacillus subtilis BSn5]
          Length = 195

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 106/189 (56%), Gaps = 15/189 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G PEIA +GRSNVGKSS IN L+NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PEGGLPEIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQTLNFYIIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYG+A+  K   ++WG +I  Y++ R  L+ V  ++D RH     D  ++ F
Sbjct: 70  ELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP--EVIPTSSVKRKGIEVL 202
           L    +   ++ TK DK+     +   +K   ++R      P  E+I  SS  +KG +  
Sbjct: 130 LKYYGIPVIVIATKADKI----PKGKWDKHAKVVRQTLNIDPEDELILFSSETKKGKDEA 185

Query: 203 RKAILETIN 211
             AI + IN
Sbjct: 186 WGAIKKMIN 194


>gi|319939270|ref|ZP_08013633.1| GTPase [Streptococcus anginosus 1_2_62CV]
 gi|319811666|gb|EFW07942.1| GTPase [Streptococcus anginosus 1_2_62CV]
          Length = 195

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 100/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDEIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KLRFVDVPGYGYAKVSKTERAKWGKMIEEYLTSRENLRAVVSLVDFRHEPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E++ K K         + + I  SSV + G++  
Sbjct: 132 LKYYEIPVIVVATKADKIPRGKWNKHESVIKKKLDF----DKNDDFIVFSSVDKDGLDAA 187

Query: 203 RKAILETI 210
             AILE I
Sbjct: 188 WDAILEKI 195


>gi|291087566|ref|ZP_06346804.2| ribosome biogenesis GTP-binding protein YsxC [Clostridium sp.
           M62/1]
 gi|291074656|gb|EFE12020.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium sp.
           M62/1]
          Length = 218

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 110/188 (58%), Gaps = 15/188 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PE AF+G+SNVGKSSLIN L+NRK+ ARTS  PG+TQ +NF+   D        
Sbjct: 31  LPANTQPEFAFAGKSNVGKSSLINALMNRKSYARTSAQPGKTQTINFYHIND-------- 82

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
            A+  VD+PGYGYARA ++    WG +I  YL +   L+CV+LLID RH   + D+ ++S
Sbjct: 83  -ALYYVDLPGYGYARANEEVKAKWGKMIENYLHKSPMLKCVFLLIDIRHEPSENDRLMYS 141

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEV 201
           ++  +     I+ TK+DKL     +  + K   ++R      PE  +IP S+  ++G E 
Sbjct: 142 WIQNQGYRPVIIATKLDKLK----RSQVPKHVKMVRTGLGMGPEDLLIPFSAETKQGREE 197

Query: 202 LRKAILET 209
           +   I +T
Sbjct: 198 IWDFIEKT 205


>gi|218133239|ref|ZP_03462043.1| hypothetical protein BACPEC_01104 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992112|gb|EEC58116.1| hypothetical protein BACPEC_01104 [Bacteroides pectinophilus ATCC
           43243]
          Length = 195

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 110/185 (59%), Gaps = 15/185 (8%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           +P+   PE+AF+G+SNVGKSSLIN L+NRK+LARTS+ PG+TQ +NF+   D        
Sbjct: 18  MPQTTLPEVAFAGKSNVGKSSLINALMNRKSLARTSSQPGKTQTINFYNIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             M LVD+PGYGYA A ++    WG +I RYL +   L+ V+LLID RH     D+ ++ 
Sbjct: 70  -VMHLVDLPGYGYANASEEVKAKWGRMIERYLQKSQQLKQVFLLIDIRHAPSANDKLMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEV 201
           ++        I+ TK+DKL  +   ++++    ++R       E  +IP S+  + G+E 
Sbjct: 129 WIVHNGYRPVIIATKLDKLKRSQVAKSVK----IVREGLNLEKEDILIPFSAQTKHGLEQ 184

Query: 202 LRKAI 206
           + + I
Sbjct: 185 IWETI 189


>gi|259503089|ref|ZP_05745991.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus antri
           DSM 16041]
 gi|259168955|gb|EEW53450.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus antri
           DSM 16041]
          Length = 196

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 76/186 (40%), Positives = 111/186 (59%), Gaps = 15/186 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PEIA  GRSNVGKSSL N+L+NR+N A TS+ PG+TQ LNF+V +D         
Sbjct: 19  PKTNYPEIALVGRSNVGKSSLTNVLINRRNFAHTSSQPGKTQTLNFYVVED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  KK  + +G +I +YL++R  LR   LL+D RH     D  ++ +
Sbjct: 70  QLYFVDVPGYGYAKVSKKERERFGQMIEQYLTQRDQLRGTILLVDGRHAPTADDVSMYQW 129

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TKIDK+  +    QE+L K    +   P+A+ ++I  S+VK+ G + +
Sbjct: 130 LQYYHIPTLVVATKIDKVKGNAWNRQESLIKKTLGL---PSAN-QLILFSAVKKTGKDAV 185

Query: 203 RKAILE 208
            + I E
Sbjct: 186 WQWIDE 191


>gi|57239177|ref|YP_180313.1| ribosome biogenesis GTP-binding protein YsxC [Ehrlichia ruminantium
           str. Welgevonden]
 gi|58579135|ref|YP_197347.1| GTPase EngB [Ehrlichia ruminantium str. Welgevonden]
 gi|81557312|sp|Q5HB81|ENGB_EHRRW RecName: Full=Probable GTP-binding protein EngB
 gi|57161256|emb|CAH58177.1| putative GTP binding protein EngB [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417761|emb|CAI26965.1| Probable GTP-binding protein engB [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 200

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 110/197 (55%), Gaps = 10/197 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  LP    PE+A +GRSNVGKSSLIN + N +  AR S+ PG T+ +NF++ 
Sbjct: 12  FIIGATSIKSLPDFSIPEVALAGRSNVGKSSLINAITNNRKNARISSKPGCTRQINFYLI 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                   N   M LVD+PGYGY++A +  V+S+  L+  YL  R  L  V LLID + G
Sbjct: 72  --------NKGLMVLVDLPGYGYSKADRATVNSYICLMEYYLLNRKNLSKVVLLIDAKVG 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            K+ID D   +L+   + YQ+VLTKID++        +   +    N+   +P +I  SS
Sbjct: 124 FKEIDLDFIRWLEVHQILYQLVLTKIDRVQSNVLDVIVSDIQNFNLNF-IIYP-IINVSS 181

Query: 194 VKRKGIEVLRKAILETI 210
             ++GIE L   I + I
Sbjct: 182 KCKQGIEELIYEIAQCI 198


>gi|50914055|ref|YP_060027.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes MGAS10394]
 gi|94994180|ref|YP_602278.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes MGAS10750]
 gi|139473949|ref|YP_001128665.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes str. Manfredo]
 gi|73919335|sp|Q5XCL9|ENGB_STRP6 RecName: Full=Probable GTP-binding protein EngB
 gi|119369272|sp|Q1J740|ENGB_STRPF RecName: Full=Probable GTP-binding protein EngB
 gi|166225987|sp|A2RF16|ENGB_STRPG RecName: Full=Probable GTP-binding protein EngB
 gi|50903129|gb|AAT86844.1| YihA [Streptococcus pyogenes MGAS10394]
 gi|94547688|gb|ABF37734.1| GTP-binding protein YihA [Streptococcus pyogenes MGAS10750]
 gi|134272196|emb|CAM30442.1| putative GTP-binding protein [Streptococcus pyogenes str. Manfredo]
          Length = 199

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 78/186 (41%), Positives = 103/186 (55%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++ RKNLARTS+ PG+TQ LNFF      N+ N L 
Sbjct: 25  PQDDLPEIALAGRSNVGKSSFINTILGRKNLARTSSKPGKTQLLNFF------NIDNKL- 77

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   + D  ++ F
Sbjct: 78  --RFVDVPGYGYAKVSKSERAKWGKMIEEYLTSRDNLRAVVSLVDLRHAPSKEDIQMYDF 135

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   +V TK DK+ P       E       N+  +   ++  SSV+R GI+    
Sbjct: 136 LKYYDIPVIVVATKADKI-PRGKWNKHESVVKKALNFDKSDTFIV-FSSVERIGIDDSWD 193

Query: 205 AILETI 210
           AILE +
Sbjct: 194 AILEQV 199


>gi|312143238|ref|YP_003994684.1| ribosome biogenesis GTP-binding protein YsxC [Halanaerobium sp.
           'sapolanicus']
 gi|311903889|gb|ADQ14330.1| ribosome biogenesis GTP-binding protein YsxC [Halanaerobium sp.
           'sapolanicus']
          Length = 200

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 88/150 (58%), Gaps = 9/150 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F + V +    P+   PE+AFSGRSNVGKSSLIN +  RK LARTSN PGRTQ LN+F  
Sbjct: 8   FYKSVYKYEECPRLQQPEVAFSGRSNVGKSSLINRITKRKKLARTSNTPGRTQSLNYFNI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYG+A  PKK  D W  LI  YL+ R  L  +  +ID RH 
Sbjct: 68  DD---------KFYLVDLPGYGFANVPKKVKDDWAELIDSYLNYRENLIGIVQIIDSRHK 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
             + D+ +  +L    +S+ I  TK+DK+S
Sbjct: 119 PTKDDKMMVEWLKASGLSFLIAATKVDKIS 148


>gi|194334829|ref|YP_002016689.1| ribosome biogenesis GTP-binding protein YsxC [Prosthecochloris
           aestuarii DSM 271]
 gi|238693315|sp|B4S596|ENGB_PROA2 RecName: Full=Probable GTP-binding protein EngB
 gi|194312647|gb|ACF47042.1| small GTP-binding protein [Prosthecochloris aestuarii DSM 271]
          Length = 192

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 104/189 (55%), Gaps = 13/189 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F +   E+  LP +  PEI F GRSNVGKS+L+N L  RK LA+TS+ PG+TQ +N+F  
Sbjct: 8   FYKSCSELKGLPVSSLPEIVFVGRSNVGKSTLLNTLTGRKALAKTSSTPGKTQLINYFTI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          +  VD+PGYGYA+  K     WG L+  Y+SER  +  V LLID RH 
Sbjct: 68  ND---------RLYFVDLPGYGYAKVAKGQRYEWGRLLGGYISEREEISLVVLLIDSRHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
             + DQ +  FL+     Y IVLTK DKL     Q+   + +  ++++      ++  S+
Sbjct: 119 DMESDQQMIEFLEYYQRPYGIVLTKYDKLK----QKEKSRVRKALKSFSLKTKFIVNYSA 174

Query: 194 VKRKGIEVL 202
           +  +G E L
Sbjct: 175 LSGEGKESL 183


>gi|325570036|ref|ZP_08145961.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus
           casseliflavus ATCC 12755]
 gi|325156864|gb|EGC69035.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus
           casseliflavus ATCC 12755]
          Length = 200

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 103/183 (56%), Gaps = 15/183 (8%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
           PEIA +GRSNVGKSS IN L+NRKNLARTS+ PG+TQ LNF++      ++N L     V
Sbjct: 30  PEIALAGRSNVGKSSFINTLINRKNLARTSSKPGKTQTLNFYL------IENTL---HFV 80

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYGYA+  K     WG +I  YL +R  LR V  L+D RH   Q D  ++ FL    
Sbjct: 81  DVPGYGYAKVSKTERAKWGKMIETYLEQREQLRAVVSLVDLRHAPSQEDVQMYEFLKYYE 140

Query: 150 VSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEVLRKAIL 207
           +   +V TK DK+     +    K + +I+   +  P    I  SS+ ++G E   KAI 
Sbjct: 141 IPVIVVATKADKI----PRGKWNKHESMIKKALSFDPADTFILFSSITKQGKEEAWKAIE 196

Query: 208 ETI 210
             I
Sbjct: 197 AAI 199


>gi|255536601|ref|YP_003096972.1| GTP-binding protein EngB [Flavobacteriaceae bacterium 3519-10]
 gi|255342797|gb|ACU08910.1| GTP-binding protein EngB [Flavobacteriaceae bacterium 3519-10]
          Length = 206

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 102/185 (55%), Gaps = 9/185 (4%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE AF GRSNVGKSSLIN ++N K+LA+TS  PG+TQ +N FV  +         
Sbjct: 19  PEPTMPEYAFIGRSNVGKSSLINAMLNFKDLAKTSQTPGKTQLINHFVINE--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              L D+PGYGYAR  K     +  LI  Y+  R  L  +++L+D RH  ++ID +   +
Sbjct: 70  QWFLTDLPGYGYARVSKTKRKEFEKLITNYILNRKNLVNLFVLVDARHTPQKIDIEFIEW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
             + +V + IV TK DKL P T    +E  K  +       PE+  TS+ KR G + + K
Sbjct: 130 CGENSVPFSIVFTKADKLKPNTVISNVEHYKTELLKTWEDLPEIFVTSAEKRDGTDEVLK 189

Query: 205 AILET 209
            I +T
Sbjct: 190 LISKT 194


>gi|78221686|ref|YP_383433.1| ribosome biogenesis GTP-binding protein YsxC [Geobacter
           metallireducens GS-15]
 gi|119369199|sp|Q39YG6|ENGB_GEOMG RecName: Full=Probable GTP-binding protein EngB
 gi|78192941|gb|ABB30708.1| GTP-binding protein [Geobacter metallireducens GS-15]
          Length = 204

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 99/169 (58%), Gaps = 12/169 (7%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
           PE+AF+GRSNVGKSSLIN+LVNRK L RTS+ PGRTQ +NFF             ++ LV
Sbjct: 24  PEVAFAGRSNVGKSSLINVLVNRKGLVRTSSTPGRTQLINFFRVNG---------SLMLV 74

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYG+A+ P      WG ++  YLS R  L CV L++D R    + DQ +  +L    
Sbjct: 75  DLPGYGFAKVPLAVKKEWGPMVETYLSTRPNLSCVVLIVDIRREPTEEDQLMLQWLRAYN 134

Query: 150 VSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           V+  +V+TK DK+S     E  ++   + R    A  E+   S++ ++G
Sbjct: 135 VAVLVVVTKCDKVS---KNERAKQAAIITRTLGLARDEMAFFSALSKEG 180


>gi|160893845|ref|ZP_02074628.1| hypothetical protein CLOL250_01399 [Clostridium sp. L2-50]
 gi|156864497|gb|EDO57928.1| hypothetical protein CLOL250_01399 [Clostridium sp. L2-50]
          Length = 201

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 113/187 (60%), Gaps = 11/187 (5%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PEIAF+G+SNVGKSSLIN L+NRK+LARTS+ PG+TQ +N++      N+ ++L
Sbjct: 18  LPETEMPEIAFAGKSNVGKSSLINGLLNRKSLARTSSQPGKTQTINYY------NINHDL 71

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
                VD+PGYGYA+   +    WG ++ RYL     LR V+LLID RH   + D  ++ 
Sbjct: 72  ---YFVDLPGYGYAQVSVEIRAKWGKMVERYLHTSKQLRLVFLLIDIRHEPSENDCIMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           ++ K      I+ TK+DK+  +  Q+ L+  +  I+  P     +IP S+  ++G E + 
Sbjct: 129 WIVKNGYEPVIIATKLDKIKRSQIQKNLKIIRQKIQ--PVEGTIIIPFSAQTKQGKEEIL 186

Query: 204 KAILETI 210
           + I + I
Sbjct: 187 QLIEDRI 193


>gi|227509448|ref|ZP_03939497.1| GTPase [Lactobacillus brevis subsp. gravesensis ATCC 27305]
 gi|227512155|ref|ZP_03942204.1| GTPase [Lactobacillus buchneri ATCC 11577]
 gi|227524115|ref|ZP_03954164.1| GTPase [Lactobacillus hilgardii ATCC 8290]
 gi|227084549|gb|EEI19861.1| GTPase [Lactobacillus buchneri ATCC 11577]
 gi|227088746|gb|EEI24058.1| GTPase [Lactobacillus hilgardii ATCC 8290]
 gi|227191160|gb|EEI71227.1| GTPase [Lactobacillus brevis subsp. gravesensis ATCC 27305]
          Length = 195

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 101/176 (57%), Gaps = 15/176 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PEIAF GRSNVGKSSL N+L+NRK  ARTS+ PG+TQ LNF+  +D         
Sbjct: 19  PNTRFPEIAFVGRSNVGKSSLTNVLINRKGYARTSSQPGKTQTLNFYNIED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K N + WG +I +YL+ER  LR V  L+D RH     D  +  +
Sbjct: 70  KLFFVDVPGYGYAKTSKANREKWGKMIEKYLTEREQLRGVITLVDGRHAPTNDDVSMHEW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT--AHPEVIPTSSVKRKG 198
           L    +    V TK+DK+    A+    K + LIR      A+ ++I  S++ ++G
Sbjct: 130 LKYYGIEILTVATKMDKI----AKGKWNKQESLIRKTLNLDANEKLISFSALTKQG 181


>gi|257865955|ref|ZP_05645608.1| GTP-binding protein [Enterococcus casseliflavus EC30]
 gi|257872288|ref|ZP_05651941.1| GTP-binding protein [Enterococcus casseliflavus EC10]
 gi|257875582|ref|ZP_05655235.1| GTP-binding protein [Enterococcus casseliflavus EC20]
 gi|257799889|gb|EEV28941.1| GTP-binding protein [Enterococcus casseliflavus EC30]
 gi|257806452|gb|EEV35274.1| GTP-binding protein [Enterococcus casseliflavus EC10]
 gi|257809748|gb|EEV38568.1| GTP-binding protein [Enterococcus casseliflavus EC20]
          Length = 194

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 103/183 (56%), Gaps = 15/183 (8%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
           PEIA +GRSNVGKSS IN L+NRKNLARTS+ PG+TQ LNF++      ++N L     V
Sbjct: 24  PEIALAGRSNVGKSSFINTLINRKNLARTSSKPGKTQTLNFYL------IENTL---HFV 74

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYGYA+  K     WG +I  YL +R  LR V  L+D RH   Q D  ++ FL    
Sbjct: 75  DVPGYGYAKVSKTERAKWGKMIETYLEQREQLRAVVSLVDLRHAPSQEDIQMYEFLKYYE 134

Query: 150 VSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEVLRKAIL 207
           +   +V TK DK+     +    K + +I+   +  P    I  SS+ ++G E   KAI 
Sbjct: 135 IPVIVVATKADKIP----RGKWNKHESMIKKALSFDPADTFILFSSITKQGKEEAWKAIE 190

Query: 208 ETI 210
             I
Sbjct: 191 AAI 193


>gi|15603979|ref|NP_220494.1| ribosome biogenesis GTP-binding protein YsxC [Rickettsia prowazekii
           str. Madrid E]
 gi|6226324|sp|Q9ZE46|ENGB_RICPR RecName: Full=Probable GTP-binding protein EngB
 gi|3860670|emb|CAA14571.1| unknown [Rickettsia prowazekii]
 gi|292571693|gb|ADE29608.1| Hypothetical GTP-binding protein [Rickettsia prowazekii Rp22]
          Length = 214

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 105/204 (51%), Gaps = 22/204 (10%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  +P    PEI F G+SNVGKSS+IN + N K+LA+ SN PGRT+ +NFF  
Sbjct: 26  FVAGAIHINQIPDFSLPEIVFVGKSNVGKSSIINTICNNKSLAKVSNTPGRTRQINFF-- 83

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                  N +  + +VD+PGYG+A  P    + W GLI  YL     L  V LLID R G
Sbjct: 84  -------NIVDKLIIVDLPGYGFANVPISVKEQWEGLITYYLRNSHNLMLVNLLIDSRRG 136

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPT-----TAQETLEKTKYLIRNYPTAHPEV 188
           +K+ D+ V   L      +QI+ TK DK++        AQ  L    YL          V
Sbjct: 137 IKENDKKVAELLLANKREFQIIFTKSDKVTDRENLNYEAQNFLATLNYLC--------NV 188

Query: 189 IPTSSVKRKGIEVLRKAILETINY 212
           I  SS  ++G+  L+ +  + I +
Sbjct: 189 IYVSSRNKEGMRELKASFAQCIKH 212


>gi|330799251|ref|XP_003287660.1| hypothetical protein DICPUDRAFT_151784 [Dictyostelium purpureum]
 gi|325082338|gb|EGC35823.1| hypothetical protein DICPUDRAFT_151784 [Dictyostelium purpureum]
          Length = 1674

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 72/177 (40%), Positives = 102/177 (57%), Gaps = 10/177 (5%)

Query: 30   PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
            PE+AF GRSNVGKSSLIN L  R  +A+TS+ PG TQ +N++              + LV
Sbjct: 1460 PEVAFIGRSNVGKSSLINALTQR-GMAKTSDKPGFTQSINWYEIG---------STLYLV 1509

Query: 90   DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
            D+PGYG+A A    ++SW  +   YL+ R TL+CVY+L+D RHG+K  D+ +   LDKK 
Sbjct: 1510 DLPGYGFAFAKDVKLESWENITHEYLTTRKTLKCVYILVDARHGLKDSDRTLLLELDKKK 1569

Query: 150  VSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAI 206
            +   IVLTK D +      + ++ T   ++NY  +   +I  SS    G+  L K I
Sbjct: 1570 IKTHIVLTKADLVLQINLAKRIQITTDELKNYHHSILPIITVSSRSLAGVADLSKQI 1626


>gi|323527571|ref|YP_004229724.1| ribosome biogenesis GTP-binding protein YsxC [Burkholderia sp.
           CCGE1001]
 gi|323384573|gb|ADX56664.1| ribosome biogenesis GTP-binding protein YsxC [Burkholderia sp.
           CCGE1001]
          Length = 217

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 101/191 (52%), Gaps = 9/191 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP    PEIAF+GRSN GKS+ INIL N+K LA  S  PGRTQH+N+   
Sbjct: 10  FFTTVNHLRDLPATAQPEIAFAGRSNAGKSTAINILCNQKRLAFASKTPGRTQHINY--- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
             FS  K + PA  LVD+PGYGYA  P      W  L+  YL  RS LR + L++D R  
Sbjct: 67  --FSVGKADEPAAHLVDLPGYGYAEVPGAAKAHWEALLSTYLQSRSQLRGMILMMDARRP 124

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT-- 191
           +  +D+ +  +          +LTK DKL+   +   L  T+  +  Y  A  +   T  
Sbjct: 125 LTDLDRRMIEWFAPTGKPIHALLTKCDKLTRQESVNALRTTQKGLAEYRAAGYQGELTAQ 184

Query: 192 --SSVKRKGIE 200
             S++KR GIE
Sbjct: 185 LFSALKRVGIE 195


>gi|294155762|ref|YP_003560146.1| cell division GTP-binding protein EngB [Mycoplasma crocodyli MP145]
 gi|291600315|gb|ADE19811.1| cell division GTP-binding protein EngB [Mycoplasma crocodyli MP145]
          Length = 196

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 102/178 (57%), Gaps = 11/178 (6%)

Query: 29  PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMAL 88
             EI F GRSNVGKSSL+N +VN K+LAR S  PGRTQ LN+F        +N+L    +
Sbjct: 19  ASEICFWGRSNVGKSSLLNAIVNNKSLARVSKTPGRTQLLNYF--------ENDLSKNII 70

Query: 89  VDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKK 148
           VD+PGYGYA+  K   D    +I  YL   S+L+ V LLID RHG+  ID+++ ++L   
Sbjct: 71  VDLPGYGYAKISKSQKDKMLKMIDEYLKNSSSLKAVLLLIDSRHGITNIDREIINYLVSI 130

Query: 149 AVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAI 206
            +   ++ TKIDKL+     + ++ +K     +       +  SS  R+GI+ L K I
Sbjct: 131 NLPIVLIYTKIDKLNQKEKSQLIKMSK---NEFSINKFNYLFVSSQTRQGIDELNKNI 185


>gi|167854567|ref|ZP_02477348.1| putative GTP-binding protein EngB [Haemophilus parasuis 29755]
 gi|167854322|gb|EDS25555.1| putative GTP-binding protein EngB [Haemophilus parasuis 29755]
          Length = 209

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P+I  LP+    EIAF+GRSN GKS+ +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 13  FLTSAPDIHHLPEDSGVEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  LR V +L+D RH 
Sbjct: 73  E---------PNCKLVDLPGYGYAAVPEQVKLQWQRSLGEYLQKRECLRGVVILMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKLS +   +T++  +  I  +     +V   S+
Sbjct: 124 LKDLDQQMIEWAVSAKLPVLLLLTKADKLSQSARSKTVKMVREAILPF-QGDVQVEAYSA 182

Query: 194 VKRKGIEVL 202
           + R GI+ L
Sbjct: 183 LNRIGIDKL 191


>gi|89901959|ref|YP_524430.1| ribosome biogenesis GTP-binding protein YsxC [Rhodoferax
           ferrireducens T118]
 gi|119369243|sp|Q21TK4|ENGB_RHOFD RecName: Full=Probable GTP-binding protein EngB
 gi|89346696|gb|ABD70899.1| GTP-binding protein, HSR1-related [Rhodoferax ferrireducens T118]
          Length = 207

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 104/191 (54%), Gaps = 15/191 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++  LP    PEIAF GRSN GKS+ IN L  +K LA  S  PGRTQH+N    
Sbjct: 11  FLTTAPQLHFLPALDVPEIAFVGRSNAGKSTCINTLTQQKQLAFASKKPGRTQHINL--- 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
             FS  K  +      D+PGYGYA  PK++   W  ++  YL  R  L+ + L+ D RHG
Sbjct: 68  --FSLGKQGVTDAVFADLPGYGYAAVPKQDKIRWQQVMANYLVTRENLKAIVLMCDPRHG 125

Query: 134 VKQIDQDVFSFLD---KKAVSYQIVLTKIDKLSPTTAQETLEKTKYL-IRNYPTAHPEVI 189
           + ++D+ +   +    ++ + + +VLTK DKL+ T      E+TK L I        EV 
Sbjct: 126 LTELDEILLDIVRPRVEEGLKFLVVLTKADKLTRT------EQTKALSIMKLQAGGGEVR 179

Query: 190 PTSSVKRKGIE 200
             S+ KR+GI+
Sbjct: 180 LFSATKRQGID 190


>gi|168183544|ref|ZP_02618208.1| GTP-binding protein [Clostridium botulinum Bf]
 gi|237796683|ref|YP_002864235.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium botulinum
           Ba4 str. 657]
 gi|182673313|gb|EDT85274.1| GTP-binding protein [Clostridium botulinum Bf]
 gi|229260786|gb|ACQ51819.1| GTP-binding protein [Clostridium botulinum Ba4 str. 657]
          Length = 194

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 111/188 (59%), Gaps = 15/188 (7%)

Query: 22  GLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN 81
           G  P+ G PEIAF GRSNVGKS+LIN L NR+ L + S+ PG+T+ +NFF+  D      
Sbjct: 18  GQYPEDGRPEIAFVGRSNVGKSTLINTLTNRRKLVKVSSTPGKTRLINFFLIND------ 71

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDV 141
               M  VD+PGYGYA+  KK  ++WG ++ +YL ER+ L+ + LL+D RH     D ++
Sbjct: 72  ---NMYFVDLPGYGYAKVSKKEKENWGYIMEQYLVERNQLKKIVLLVDSRHKPTSDDINM 128

Query: 142 FSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGI 199
           ++++        +V TK+DKL     +  + K K +IR+      +  ++  SS+ ++G 
Sbjct: 129 YNWIKHYNYEVLVVGTKLDKLK----RNDINKNKKIIRDTLKMDKDDKILLISSLSKEGK 184

Query: 200 EVLRKAIL 207
           E + + IL
Sbjct: 185 EEVLEQIL 192


>gi|219872202|ref|YP_002476577.1| ribosome biogenesis GTP-binding protein YsxC [Haemophilus parasuis
           SH0165]
 gi|254783198|sp|B8F8H7|ENGB_HAEPS RecName: Full=Probable GTP-binding protein EngB
 gi|219692406|gb|ACL33629.1| GTPase EngB [Haemophilus parasuis SH0165]
          Length = 209

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P+I  LP+    EIAF+GRSN GKS+ +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 13  FLTSAPDIRHLPEDSGVEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  LR V +L+D RH 
Sbjct: 73  E---------PNCKLVDLPGYGYAAVPEQVKLQWQRSLGEYLQKRECLRGVVILMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKLS +   +T++  +  I  +     +V   S+
Sbjct: 124 LKDLDQQMIEWAVSAELPVLLLLTKADKLSQSARSKTVKMVREAILPF-QGDVQVEAYSA 182

Query: 194 VKRKGIEVL 202
           + R GI+ L
Sbjct: 183 LNRIGIDKL 191


>gi|315221694|ref|ZP_07863610.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           anginosus F0211]
 gi|315189181|gb|EFU22880.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           anginosus F0211]
          Length = 195

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 100/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF   D         
Sbjct: 21  PQDEIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 72  KLRFVDVPGYGYAKVSKTERAKWGKMIEEYLTSRENLRAVVSLVDVRHEPSTDDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E++ K K         + + I  SSV + G++  
Sbjct: 132 LKYYEIPVIVVATKADKVPRGKWNKYESVIKKKLDF----DKNDDFIIFSSVNKDGLDAA 187

Query: 203 RKAILETI 210
             AILE I
Sbjct: 188 WDAILEKI 195


>gi|225568846|ref|ZP_03777871.1| hypothetical protein CLOHYLEM_04925 [Clostridium hylemonae DSM
           15053]
 gi|225162345|gb|EEG74964.1| hypothetical protein CLOHYLEM_04925 [Clostridium hylemonae DSM
           15053]
          Length = 200

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 72/176 (40%), Positives = 105/176 (59%), Gaps = 11/176 (6%)

Query: 23  LLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNN 82
           +LP    PEIAF+G+SNVGKSSLIN L+NRK+ AR S  PG+TQ +NF+      N+ N 
Sbjct: 17  ILPDNDHPEIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFY------NINNE 70

Query: 83  LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVF 142
              M LVD+PGYGYA+  +K    WG LI RYL     L+ V+LLID RH     D+ ++
Sbjct: 71  ---MYLVDLPGYGYAKVSEKEKMKWGQLIERYLHGSGQLKAVFLLIDIRHEPSANDRMMY 127

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
            ++  +     I+ TK+DK+  +   + ++  +  +   P    +VIP SS+ ++G
Sbjct: 128 DWIVDQGYEPIIIATKLDKIKRSQVDKHIKMLRTGLDLIPGT--KVIPFSSMTKQG 181


>gi|32035822|ref|ZP_00135658.1| COG0218: Predicted GTPase [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|126207582|ref|YP_001052807.1| ribosome biogenesis GTP-binding protein YsxC [Actinobacillus
           pleuropneumoniae L20]
 gi|303250228|ref|ZP_07336429.1| GTPase EngB [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307251616|ref|ZP_07533522.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|307260548|ref|ZP_07542241.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|126096374|gb|ABN73202.1| putative GTP-binding protein EngB [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|302650939|gb|EFL81094.1| GTPase EngB [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306860927|gb|EFM92934.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306869777|gb|EFN01561.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
          Length = 206

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P+I  LP+    EIAF+GRSN GKS+ +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 11  FLTSAPDIRHLPEDNGVEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  LR V +L+D RH 
Sbjct: 71  E---------PNCKLVDLPGYGYAAVPEQMKIQWQKALGEYLQKRECLRGVVILMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKLS +   +T++  +  I  +     +V   S+
Sbjct: 122 LKDLDQQMIEWAVSAQLPVLLLLTKADKLSQSARSKTVKMVREAILPF-QGDIQVEAYSA 180

Query: 194 VKRKGIEVL 202
           + + GI+ L
Sbjct: 181 LNKVGIDKL 189


>gi|258516483|ref|YP_003192705.1| small GTP-binding protein [Desulfotomaculum acetoxidans DSM 771]
 gi|257780188|gb|ACV64082.1| small GTP-binding protein [Desulfotomaculum acetoxidans DSM 771]
          Length = 201

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 87/151 (57%), Gaps = 10/151 (6%)

Query: 14  FLRGVPEIGLLPKAGP-PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           F+   P I L P+    PEI F+GRSNVGKSSLIN LVNRKNLARTS  PGRTQ LN+F+
Sbjct: 8   FVISSPGIKLCPEGQEYPEIGFAGRSNVGKSSLINKLVNRKNLARTSKTPGRTQLLNYFL 67

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
                       A  +VD PGYGYA+ P+     WG +I  YL  R  L  V LL+D RH
Sbjct: 68  INR---------AFYIVDFPGYGYAKVPQSVRAGWGKMIEGYLKNRKELSGVVLLLDIRH 118

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
                D  +F +L    +   +V TK DKLS
Sbjct: 119 KPTAQDVQMFDWLQHYEIPTLLVATKADKLS 149


>gi|34499840|ref|NP_904055.1| ribosome biogenesis GTP-binding protein YsxC [Chromobacterium
           violaceum ATCC 12472]
 gi|81654051|sp|Q7NPV7|ENGB_CHRVO RecName: Full=Probable GTP-binding protein EngB
 gi|34105690|gb|AAQ62044.1| GTP-binding protein [Chromobacterium violaceum ATCC 12472]
          Length = 206

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 99/176 (56%), Gaps = 11/176 (6%)

Query: 31  EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVD 90
           E+AF GRSN GKSS IN L NR  LA  S  PGRTQH+NFF   D            LVD
Sbjct: 25  EVAFVGRSNAGKSSAINTLANRTRLAYVSKTPGRTQHINFFELGD---------ECFLVD 75

Query: 91  MPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAV 150
           +PGYGYA  P+     W  L+ RYL  R +L  + L++D RH +K++D+ +  F      
Sbjct: 76  LPGYGYAEVPEAVRAHWVELLGRYLQTRQSLIGLLLIMDARHPLKELDRRMLEFFRVAGR 135

Query: 151 SYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAI 206
              I+L+K DKLS     + L + K  + +YP+   ++   SS+K+ G++V+ + +
Sbjct: 136 PVHILLSKADKLSRQEQNKVLAEVKRELADYPSVSVQMF--SSLKKTGVDVVEQVV 189


>gi|315641096|ref|ZP_07896175.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus italicus
           DSM 15952]
 gi|315483104|gb|EFU73621.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus italicus
           DSM 15952]
          Length = 222

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 106/190 (55%), Gaps = 15/190 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P++  PEIA +GRSNVGKSS IN L+ RKNLARTS+ PG+TQ LNF+  +D         
Sbjct: 44  PESELPEIALAGRSNVGKSSFINTLIERKNLARTSSKPGKTQTLNFYNIED--------- 94

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG +I  YL++RS L+ V  L+D RH     D  ++ F
Sbjct: 95  VLHFVDVPGYGYAKVSKTERAKWGKMIETYLTQRSQLKAVVSLVDFRHEPSVEDVQMYQF 154

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEVL 202
           L    +   +V TKIDK+     +    K + +I+   T   E   I  SSV + G ++ 
Sbjct: 155 LKYYDIPVIVVATKIDKI----PRGKWNKHESMIKKAMTFEKEDTFILFSSVTKDGKQLA 210

Query: 203 RKAILETINY 212
             AI + I Y
Sbjct: 211 WNAIEKAIGY 220


>gi|281180927|dbj|BAI57257.1| GTP-binding protein [Escherichia coli SE15]
          Length = 210

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGACKAQLNMVREAVLAF-NGDVQVETFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|332084079|gb|EGI89284.1| putative GTP-binding protein [Shigella boydii 5216-82]
          Length = 210

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  AD---------GKCLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|189501178|ref|YP_001960648.1| ribosome biogenesis GTP-binding protein YsxC [Chlorobium
           phaeobacteroides BS1]
 gi|238692282|sp|B3EP28|ENGB_CHLPB RecName: Full=Probable GTP-binding protein EngB
 gi|189496619|gb|ACE05167.1| GTP-binding protein HSR1-related [Chlorobium phaeobacteroides BS1]
          Length = 192

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 103/189 (54%), Gaps = 13/189 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F + V  I  LPK   PEI F GRSNVGKS+L+N L  RK LA+TS+ PG+TQ +N+FV 
Sbjct: 8   FYKSVSAIDHLPKEQLPEIVFVGRSNVGKSTLLNSLTARKGLAKTSSTPGKTQLINYFVI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +         +   VD+PGYGYA+  K     WG L+  Y+S R ++  V LLID RH 
Sbjct: 68  NE---------SCYFVDLPGYGYAKVDKGKKYEWGKLLSHYVSTRDSITLVVLLIDSRHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
             + D  +  FL+     Y +VLTK DKL     Q+     +  +++Y      ++  S+
Sbjct: 119 DMESDHLMAEFLEHCGRPYGVVLTKYDKLK----QQAKAAARLAVKSYSLKSKFIVNYSA 174

Query: 194 VKRKGIEVL 202
           +  +G E L
Sbjct: 175 ISGQGKEEL 183


>gi|223041729|ref|ZP_03611923.1| putative GTP-binding protein EngB [Actinobacillus minor 202]
 gi|240950262|ref|ZP_04754541.1| GTPase EngB [Actinobacillus minor NM305]
 gi|223017467|gb|EEF15884.1| putative GTP-binding protein EngB [Actinobacillus minor 202]
 gi|240295239|gb|EER46040.1| GTPase EngB [Actinobacillus minor NM305]
          Length = 208

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P+I  LP+    EIAF+GRSN GKS+ +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 14  FLTSAPDIRHLPEDSGIEIAFAGRSNAGKSTSLNALTNQKNLARTSKTPGRTQLINLFEV 73

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  LR V +L+D RH 
Sbjct: 74  E---------PQCKLVDLPGYGYAAVPEQMKLQWQKALGEYLQKRECLRGVVILMDIRHP 124

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKLS +   +T++  +  I  +     +V   S+
Sbjct: 125 LKDLDQQMIEWAVSAELPVLLLLTKADKLSQSARSKTVKMVREAILPF-QGDVQVEAYSA 183

Query: 194 VKRKGIEVL 202
           + + GI+ L
Sbjct: 184 LNKIGIDKL 192


>gi|165975551|ref|YP_001651144.1| ribosome biogenesis GTP-binding protein YsxC [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303251917|ref|ZP_07338088.1| GTPase EngB [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307244896|ref|ZP_07526994.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|307247073|ref|ZP_07529126.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|307249295|ref|ZP_07531290.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|307258306|ref|ZP_07540048.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307262677|ref|ZP_07544306.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|165875652|gb|ABY68700.1| GTP-binding protein [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|302649347|gb|EFL79532.1| GTPase EngB [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|306854218|gb|EFM86425.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|306856442|gb|EFM88592.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|306858694|gb|EFM90755.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|306867645|gb|EFM99491.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306872005|gb|EFN03720.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 206

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P+I  LP+    EIAF+GRSN GKS+ +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 11  FLTSAPDIRHLPEDNGVEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  LR V +L+D RH 
Sbjct: 71  E---------PNCKLVDLPGYGYAAVPEQMKLQWQKALGEYLQKRECLRGVVILMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKLS +   +T++  +  I  +     +V   S+
Sbjct: 122 LKDLDQQMIEWAVSAQLPVLLLLTKADKLSQSARSKTVKMVREAILPF-QGDIQVEAYSA 180

Query: 194 VKRKGIEVL 202
           + + GI+ L
Sbjct: 181 LNKVGIDKL 189


>gi|293470176|ref|ZP_06664587.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           B088]
 gi|291321386|gb|EFE60825.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           B088]
          Length = 216

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 17  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 76

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 77  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 127

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 128 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSS 186

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 187 LKKQGVDKLRQKL 199


>gi|58584614|ref|YP_198187.1| GTPase EngB [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58418930|gb|AAW70945.1| Predicted GTPase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 186

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 98/164 (59%), Gaps = 8/164 (4%)

Query: 17  GVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDF 76
           G  +I  LP    PEIAF+GRSNVGKSSLIN+L+N K  AR S+ PG T+ +NF+     
Sbjct: 3   GASDIKSLPNESAPEIAFAGRSNVGKSSLINLLINSKKAARVSSKPGCTRQINFY----- 57

Query: 77  SNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQ 136
            ++ N+     LVD+PGYG + A K     + GL+  YL  R  LR V++LID +  +K+
Sbjct: 58  -SMYND--KFRLVDLPGYGCSHASKDETIQYLGLVEYYLIHRRNLRRVFVLIDSKVRLKE 114

Query: 137 IDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
           ID+D   +L    +++ +VLTKIDK+        +E T+  I N
Sbjct: 115 IDKDFIYWLTYNNINFDVVLTKIDKVDRENLDAIIESTRKWINN 158


>gi|322515140|ref|ZP_08068143.1| ribosome biogenesis GTP-binding protein YsxC [Actinobacillus ureae
           ATCC 25976]
 gi|322118854|gb|EFX91044.1| ribosome biogenesis GTP-binding protein YsxC [Actinobacillus ureae
           ATCC 25976]
          Length = 206

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P+I  LP+    EIAF+GRSN GKS+ +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 11  FLTSAPDIRHLPEDNGVEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  LR V +L+D RH 
Sbjct: 71  E---------PNCKLVDLPGYGYAAVPEQMKLQWQKALGEYLQKRECLRGVVILMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKLS +   +T++  +  I  +     +V   S+
Sbjct: 122 LKDLDQQMIEWAVSTQLPVLLLLTKADKLSQSARSKTVKMVREAILPF-QGDIQVEAYSA 180

Query: 194 VKRKGIEVL 202
           + + GI+ L
Sbjct: 181 LNKIGIDKL 189


>gi|325104688|ref|YP_004274342.1| ribosome biogenesis GTP-binding protein YsxC [Pedobacter saltans
           DSM 12145]
 gi|324973536|gb|ADY52520.1| ribosome biogenesis GTP-binding protein YsxC [Pedobacter saltans
           DSM 12145]
          Length = 216

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 106/182 (58%), Gaps = 11/182 (6%)

Query: 20  EIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLN-FFVPKDFSN 78
           +I  LP    PE AF GRSNVGKSSLIN+L + K LA+TS  PG+TQ +N F + K++  
Sbjct: 14  KISKLPPCVLPEYAFIGRSNVGKSSLINMLTDVKGLAKTSQKPGKTQLINHFLINKEW-- 71

Query: 79  LKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQID 138
                    LVD+PGYGYAR+ K N   W   I  YL +R +L+CV++LID R   ++ID
Sbjct: 72  --------YLVDLPGYGYARSSKSNRLEWAKFIKNYLEKRESLQCVFVLIDSRLEPQKID 123

Query: 139 QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
            +   +L ++ + + ++ TK DK     +Q+ +   K  +  +    P+++ TSS  + G
Sbjct: 124 IEFCCYLGERGIPFILIFTKADKNGVNKSQQNMSAFKKEMLKHFEEVPQMLLTSSETKFG 183

Query: 199 IE 200
            E
Sbjct: 184 KE 185


>gi|312885959|ref|ZP_07745587.1| ribosome biogenesis GTP-binding protein YsxC [Mucilaginibacter
           paludis DSM 18603]
 gi|311301496|gb|EFQ78537.1| ribosome biogenesis GTP-binding protein YsxC [Mucilaginibacter
           paludis DSM 18603]
          Length = 215

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 105/187 (56%), Gaps = 9/187 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    ++  LP A  PE AF GRSNVGKSSLIN+LV++K LA+TS  PG+TQ +N F+ 
Sbjct: 8   FVCSNTQVSKLPPAVKPEYAFIGRSNVGKSSLINMLVDKKGLAKTSQTPGKTQLINHFLI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYAR  K   + W   I  YL +R +L+ V++LID R  
Sbjct: 68  ND---------NWYLVDLPGYGYARISKSKKEDWNKFIRTYLDKRESLQTVFVLIDSRLE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID +  ++L +K +S+ ++ TK DK S     + +   K  +       P +  TS+
Sbjct: 119 PQKIDLEFCNWLGEKGLSFALIFTKADKQSRVKTDQNVSAFKKALLTTFEDIPTIFITSA 178

Query: 194 VKRKGIE 200
             + G E
Sbjct: 179 ELQTGRE 185


>gi|117626138|ref|YP_859461.1| GTPase EngB [Escherichia coli APEC O1]
 gi|227885401|ref|ZP_04003206.1| GTP-binding protein [Escherichia coli 83972]
 gi|300976574|ref|ZP_07173524.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           45-1]
 gi|300985860|ref|ZP_07177624.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           200-1]
 gi|301046668|ref|ZP_07193797.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           185-1]
 gi|259645893|sp|A1AI47|ENGB_ECOK1 RecName: Full=Probable GTP-binding protein EngB
 gi|115515262|gb|ABJ03337.1| putative GTP-binding protein [Escherichia coli APEC O1]
 gi|227837659|gb|EEJ48125.1| GTP-binding protein [Escherichia coli 83972]
 gi|300301380|gb|EFJ57765.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           185-1]
 gi|300306499|gb|EFJ61019.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           200-1]
 gi|300410032|gb|EFJ93570.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           45-1]
 gi|307556007|gb|ADN48782.1| probable GTP-binding protein [Escherichia coli ABU 83972]
 gi|315289565|gb|EFU48958.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           110-3]
 gi|315292789|gb|EFU52141.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           153-1]
 gi|315300260|gb|EFU59496.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           16-3]
 gi|324006859|gb|EGB76078.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           57-2]
 gi|324012583|gb|EGB81802.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           60-1]
          Length = 215

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 16  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 75

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 76  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 127 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSS 185

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 186 LKKQGVDKLRQKL 198


>gi|307731224|ref|YP_003908448.1| ribosome biogenesis GTP-binding protein YsxC [Burkholderia sp.
           CCGE1003]
 gi|307585759|gb|ADN59157.1| ribosome biogenesis GTP-binding protein YsxC [Burkholderia sp.
           CCGE1003]
          Length = 217

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 103/197 (52%), Gaps = 9/197 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP    PEIAF+GRSN GKS+ INIL N+K LA  S  PGRTQH+N+   
Sbjct: 10  FFTTVNHLRDLPATAQPEIAFAGRSNAGKSTAINILCNQKRLAFASKTPGRTQHINY--- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
             FS  K + PA  LVD+PGYGYA  P      W  L+  YL  RS LR + L++D R  
Sbjct: 67  --FSVGKADEPAGHLVDLPGYGYAEVPGAAKAHWEALLSTYLQSRSQLRGMILMMDARRP 124

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT-- 191
           +  +D+ +  +          +LTK DKL+   +   L  T+  +  Y  A  +   T  
Sbjct: 125 LTDLDRRMIEWFAPTGKPIHALLTKCDKLTRQESVNALRTTQKGLAEYRAAGYQGELTAQ 184

Query: 192 --SSVKRKGIEVLRKAI 206
             S++KR GIE   + I
Sbjct: 185 LFSALKRVGIEEAHELI 201


>gi|23099530|ref|NP_692996.1| GTPase EngB [Oceanobacillus iheyensis HTE831]
 gi|81846051|sp|Q8EPM2|ENGB_OCEIH RecName: Full=Probable GTP-binding protein EngB
 gi|22777760|dbj|BAC14031.1| GTP-binding protein (EngB family) [Oceanobacillus iheyensis HTE831]
          Length = 195

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 92/154 (59%), Gaps = 9/154 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS+ PG+TQ LNF+   +         
Sbjct: 19  PEDQLPEIALAGRSNVGKSSFINRLINRKNLARTSSKPGKTQTLNFYRINE--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           +   VD+PGYGYA+  KK  + WG ++  Y   R TLR V L+ D RH   Q D  ++ F
Sbjct: 70  SFYFVDVPGYGYAKVSKKEREKWGRMMEEYFQTRDTLRAVVLVTDLRHDPTQDDIQMYDF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLI 178
           +    +   I+ TK+DK++    Q+ + + K ++
Sbjct: 130 IKYFDLPVIIIGTKLDKITKNKRQKHINRAKQVL 163


>gi|295109359|emb|CBL23312.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Ruminococcus
           obeum A2-162]
          Length = 201

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 105/189 (55%), Gaps = 19/189 (10%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           +P  G PE+AF+G+SNVGKSSLIN L+NRK LARTS  PG+TQ +NF+   D        
Sbjct: 18  IPDTGLPEVAFAGKSNVGKSSLINGLMNRKALARTSAQPGKTQTINFYKIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + LVD+PGYGYAR      + WG +I  YL     L+ V+LLID RH     D+ ++ 
Sbjct: 70  -ELDLVDLPGYGYARVTPAEKEKWGKMIENYLHTSHNLKAVFLLIDIRHDPSANDRQMYE 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK--YLIRNYPTAHPEVIPTSSVKRKGIEV 201
           ++        I+ TK+DKL  +  Q+ L+  +    +R   T    VIP S+  ++G   
Sbjct: 129 WILHNGYEPIIIATKLDKLKRSQVQKNLKAIREGLQLRKGTT----VIPYSAETKQG--- 181

Query: 202 LRKAILETI 210
            R  I E I
Sbjct: 182 -RDEIWELI 189


>gi|325499167|gb|EGC97026.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia
           fergusonii ECD227]
          Length = 207

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 8   FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 68  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 119 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSS 177

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 178 LKKQGVDKLRQKL 190


>gi|324111948|gb|EGC05928.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia
           fergusonii B253]
          Length = 210

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|301309826|ref|ZP_07215765.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp. 20_3]
 gi|300831400|gb|EFK62031.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp. 20_3]
          Length = 200

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 108/187 (57%), Gaps = 15/187 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE AF GRSNVGKSSLIN+L N+K LA TS  PG+T  +N F+  D         
Sbjct: 19  PEGNKPEYAFIGRSNVGKSSLINMLTNKKGLAMTSQTPGKTLLINHFLIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYG+A+  K+N +    +I  Y+ +R  L  +++L+DCRH  ++ID +   +
Sbjct: 70  EWYLVDLPGYGFAQRGKENREQLKRIIENYILDREQLTNLFVLLDCRHEAQKIDLEFMEW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLE-KTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           L +  V + I+ TKIDK+S    +E L+  T  L+  +    P +  +SS K++G    R
Sbjct: 130 LGESGVPFSIIFTKIDKISKGRLKENLKVYTDKLLETWEELPP-IFLSSSEKKEG----R 184

Query: 204 KAILETI 210
             IL+ I
Sbjct: 185 DEILDYI 191


>gi|290969195|ref|ZP_06560720.1| ribosome biogenesis GTP-binding protein YsxC [Megasphaera genomosp.
           type_1 str. 28L]
 gi|290780701|gb|EFD93304.1| ribosome biogenesis GTP-binding protein YsxC [Megasphaera genomosp.
           type_1 str. 28L]
          Length = 206

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 107/190 (56%), Gaps = 10/190 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF----VPKDFSNLK 80
           P  G  E+AF GRSNVGKSSLIN L N + LAR S +PG+TQ +N++      +D  +++
Sbjct: 22  PTDGLAEVAFLGRSNVGKSSLINSLCNHRGLARVSGSPGKTQTINYYGVTLRQEDGEDVR 81

Query: 81  NNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQD 140
                +  VD+PGYG+A+  KK  D W   I  Y+ E + LR + LLID RH    +D  
Sbjct: 82  RY--PLYFVDLPGYGFAKTGKKQRDMWSAFIHEYIRESTQLRLLCLLIDSRHPGLDLDLQ 139

Query: 141 VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
            + +L    VS QIV TK DKL     Q+ L   + L   +P     ++  SS+KR+G  
Sbjct: 140 AYEWLLSAGVSVQIVATKSDKLRARERQQNL---RTLAELFPDGGRPLL-YSSLKRQGQT 195

Query: 201 VLRKAILETI 210
           +L + I+ TI
Sbjct: 196 LLLQQIIHTI 205


>gi|303278466|ref|XP_003058526.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226459686|gb|EEH56981.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 523

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/162 (45%), Positives = 100/162 (61%), Gaps = 15/162 (9%)

Query: 20  EIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNL 79
           E  L P    PE+AF+GRSNVGKSSLIN  +     AR+S+ PG+TQ LNF+   D S  
Sbjct: 225 EDSLPPPDDVPEVAFAGRSNVGKSSLINA-ITLSAAARSSDVPGKTQSLNFY---DVSRR 280

Query: 80  KNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQ 139
                 + +VDMPGYG+A A    VD+W  LI +YL+ R+ L+ VY++ID RHG+K  D+
Sbjct: 281 ------LRIVDMPGYGFAFAAPDRVDAWNRLIDKYLTGRANLKRVYVVIDARHGLKAPDR 334

Query: 140 DVFSFLDK-KAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
           ++ +FL K   VSYQ+VL K D + P      L +  +LIR 
Sbjct: 335 EMLAFLSKYGGVSYQVVLNKTDLVKPG----DLARRAFLIRE 372


>gi|119369192|sp|Q0TAJ6|ENGB_ECOL5 RecName: Full=Probable GTP-binding protein EngB
          Length = 210

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIEWAVDSNIAVLVLLTKTDKLASGARKAQLNMVREAVLAF-NGDVQVETFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|170769691|ref|ZP_02904144.1| putative GTP-binding protein EngB [Escherichia albertii TW07627]
 gi|170121499|gb|EDS90430.1| putative GTP-binding protein EngB [Escherichia albertii TW07627]
          Length = 210

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|19745954|ref|NP_607090.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes MGAS8232]
 gi|24418369|sp|Q8P1C8|ENGB_STRP8 RecName: Full=Probable GTP-binding protein EngB
 gi|19748113|gb|AAL97589.1| conserved hypothetical GTP-binding protein [Streptococcus pyogenes
           MGAS8232]
          Length = 199

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 103/186 (55%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++ RKNLARTS+ PG+TQ LNFF      N+ + L 
Sbjct: 25  PQDDLPEIALAGRSNVGKSSFINTILGRKNLARTSSKPGKTQLLNFF------NIDDKL- 77

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   + D  ++ F
Sbjct: 78  --RFVDVPGYGYAKVSKSERAEWGKMIEEYLTSRDNLRAVVSLVDLRHAPSKEDIQMYDF 135

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   +V TK DK+ P       E       N+  +   ++  SSV+R GI+    
Sbjct: 136 LKYYDIPVIVVATKADKI-PRGKWNKHESVVKKALNFDKSDTFIV-FSSVERIGIDDSWD 193

Query: 205 AILETI 210
           AILE +
Sbjct: 194 AILEQV 199


>gi|89098931|ref|ZP_01171811.1| GTP-binding protein [Bacillus sp. NRRL B-14911]
 gi|89086335|gb|EAR65456.1| GTP-binding protein [Bacillus sp. NRRL B-14911]
          Length = 195

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 92/158 (58%), Gaps = 9/158 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE A +GRSNVGKSS IN ++NRKNLARTS+ PG+TQ LNF++  +         
Sbjct: 19  PEESLPEFALAGRSNVGKSSFINKMLNRKNLARTSSKPGKTQTLNFYLINEM-------- 70

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYA+  KK  ++WG +I  Y + R  L+   L++D RH   + D  ++ F
Sbjct: 71  -MHFVDVPGYGYAKVSKKEREAWGRMIETYFTSREQLKAAVLIVDLRHPPTKDDIMMYDF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP 182
           L    +   I+ TK DK+  T  Q+  + TK  +   P
Sbjct: 130 LKHHGIRCIIIATKADKIPKTKRQKHFKITKETLELEP 167


>gi|322807541|emb|CBZ05116.1| GTP-binding protein EngB [Clostridium botulinum H04402 065]
          Length = 199

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 109/185 (58%), Gaps = 15/185 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G PE+AF GRSNVGKS+LIN L NR+ L + S+ PG+T+ +NFFV  D         
Sbjct: 26  PEDGRPEVAFVGRSNVGKSTLINTLTNRRKLVKVSSTPGKTRLINFFVIND--------- 76

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYA+  KK  ++WG ++ +YL ER  L+ + LL+D RH     D +++++
Sbjct: 77  NMYFVDLPGYGYAKVSKKEKENWGYIMEQYLVERDQLKKIVLLVDSRHKPTSDDINMYNW 136

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEVL 202
           +        +V TK+DKL     +  + K K +IR+      +  ++  SS+ ++G E +
Sbjct: 137 IKHYNYEVLVVGTKLDKLK----RNDINKNKKIIRDTLKMDKDDKILLISSLSKEGKEEV 192

Query: 203 RKAIL 207
            + IL
Sbjct: 193 LEQIL 197


>gi|224826040|ref|ZP_03699143.1| GTP-binding protein HSR1-related [Lutiella nitroferrum 2002]
 gi|224601677|gb|EEG07857.1| GTP-binding protein HSR1-related [Lutiella nitroferrum 2002]
          Length = 207

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/181 (39%), Positives = 99/181 (54%), Gaps = 14/181 (7%)

Query: 29  PP---EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPA 85
           PP   E+AF GRSN GKSS IN L NR  LA  S  PGRTQH+NFF   D    +     
Sbjct: 20  PPTRAEVAFVGRSNAGKSSAINTLANRTRLAFVSKTPGRTQHINFF---DLGEER----- 71

Query: 86  MALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFL 145
             LVD+PGYGYA  P+     W  L+ RYL  R  L  + +++D RH +K++D  +  F 
Sbjct: 72  -YLVDLPGYGYAEVPEAVRTHWVALLGRYLQTRQNLVGLIMIMDSRHPLKELDWKMLEFF 130

Query: 146 DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKA 205
            +      I+L+K DKLS    Q+TL   K  + +YP    ++   SS+K+ G E + + 
Sbjct: 131 RETGRPVHILLSKSDKLSRMEQQKTLASVKKALADYPAVSIQLF--SSLKKTGGETVEEV 188

Query: 206 I 206
           +
Sbjct: 189 V 189


>gi|145698334|ref|NP_418301.3| GTP-binding protein required for normal cell division [Escherichia
           coli str. K-12 substr. MG1655]
 gi|157156230|ref|YP_001465345.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           E24377A]
 gi|157163335|ref|YP_001460653.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli HS]
 gi|161486045|ref|NP_756667.2| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           CFT073]
 gi|161950010|ref|YP_405310.2| ribosome biogenesis GTP-binding protein YsxC [Shigella dysenteriae
           Sd197]
 gi|161986408|ref|YP_312789.2| ribosome biogenesis GTP-binding protein YsxC [Shigella sonnei
           Ss046]
 gi|162138322|ref|YP_543397.2| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           UTI89]
 gi|170022121|ref|YP_001727075.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli ATCC
           8739]
 gi|170683684|ref|YP_001746193.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           SMS-3-5]
 gi|187732245|ref|YP_001882562.1| ribosome biogenesis GTP-binding protein YsxC [Shigella boydii CDC
           3083-94]
 gi|188492392|ref|ZP_02999662.1| GTPase family protein [Escherichia coli 53638]
 gi|191169445|ref|ZP_03031182.1| putative GTP-binding protein EngB [Escherichia coli B7A]
 gi|191173902|ref|ZP_03035422.1| putative GTP-binding protein EngB [Escherichia coli F11]
 gi|193063965|ref|ZP_03045051.1| putative GTP-binding protein EngB [Escherichia coli E22]
 gi|193068077|ref|ZP_03049042.1| putative GTP-binding protein EngB [Escherichia coli E110019]
 gi|215489198|ref|YP_002331629.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O127:H6 str. E2348/69]
 gi|237702894|ref|ZP_04533375.1| GTPase EngB [Escherichia sp. 3_2_53FAA]
 gi|238902932|ref|YP_002928728.1| GTP-binding protein [Escherichia coli BW2952]
 gi|253775500|ref|YP_003038331.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|256021502|ref|ZP_05435367.1| ribosome biogenesis GTP-binding protein YsxC [Shigella sp. D9]
 gi|256026102|ref|ZP_05439967.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia sp.
           4_1_40B]
 gi|260846367|ref|YP_003224145.1| GTP-binding protein [Escherichia coli O103:H2 str. 12009]
 gi|260857737|ref|YP_003231628.1| GTP-binding protein [Escherichia coli O26:H11 str. 11368]
 gi|260870581|ref|YP_003236983.1| GTP-binding protein [Escherichia coli O111:H- str. 11128]
 gi|293407484|ref|ZP_06651403.1| GTP-binding protein engB [Escherichia coli FVEC1412]
 gi|293413299|ref|ZP_06655960.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           B354]
 gi|293417325|ref|ZP_06659949.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           B185]
 gi|297517721|ref|ZP_06936107.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           OP50]
 gi|298383227|ref|ZP_06992820.1| GTP-binding protein engB [Escherichia coli FVEC1302]
 gi|301027904|ref|ZP_07191196.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           196-1]
 gi|306813870|ref|ZP_07448046.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           NC101]
 gi|307140559|ref|ZP_07499915.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           H736]
 gi|307314015|ref|ZP_07593629.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli W]
 gi|309783772|ref|ZP_07678418.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|312969392|ref|ZP_07783594.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|331660414|ref|ZP_08361348.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           TA206]
 gi|332282740|ref|ZP_08395153.1| GTPase EngB [Shigella sp. D9]
 gi|67462332|sp|P0A6P7|ENGB_ECOLI RecName: Full=Probable GTP-binding protein EngB
 gi|67462333|sp|P0A6P8|ENGB_ECOL6 RecName: Full=Probable GTP-binding protein EngB
 gi|119369193|sp|Q1R448|ENGB_ECOUT RecName: Full=Probable GTP-binding protein EngB
 gi|119369257|sp|Q32A36|ENGB_SHIDS RecName: Full=Probable GTP-binding protein EngB
 gi|119369259|sp|Q3YVA8|ENGB_SHISS RecName: Full=Probable GTP-binding protein EngB
 gi|166920110|sp|A7ZU66|ENGB_ECO24 RecName: Full=Probable GTP-binding protein EngB
 gi|166920111|sp|A8A6W6|ENGB_ECOHS RecName: Full=Probable GTP-binding protein EngB
 gi|189037177|sp|B1IW48|ENGB_ECOLC RecName: Full=Probable GTP-binding protein EngB
 gi|226741188|sp|B1LMP7|ENGB_ECOSM RecName: Full=Probable GTP-binding protein EngB
 gi|238691700|sp|B2TVL1|ENGB_SHIB3 RecName: Full=Probable GTP-binding protein EngB
 gi|254783196|sp|B7UNI7|ENGB_ECO27 RecName: Full=Probable GTP-binding protein EngB
 gi|259645892|sp|C5A033|ENGB_ECOBW RecName: Full=Probable GTP-binding protein EngB
 gi|33358154|pdb|1PUI|A Chain A, Structure Of Engb Gtpase
 gi|33358155|pdb|1PUI|B Chain B, Structure Of Engb Gtpase
 gi|145693205|gb|AAC76862.3| GTP-binding protein required for normal cell division [Escherichia
           coli str. K-12 substr. MG1655]
 gi|157069015|gb|ABV08270.1| putative GTP-binding protein EngB [Escherichia coli HS]
 gi|157078260|gb|ABV17968.1| putative GTP-binding protein EngB [Escherichia coli E24377A]
 gi|169757049|gb|ACA79748.1| GTP-binding protein HSR1-related [Escherichia coli ATCC 8739]
 gi|170521402|gb|ACB19580.1| putative GTP-binding protein EngB [Escherichia coli SMS-3-5]
 gi|187429237|gb|ACD08511.1| putative GTP-binding protein EngB [Shigella boydii CDC 3083-94]
 gi|188487591|gb|EDU62694.1| GTPase family protein [Escherichia coli 53638]
 gi|190900513|gb|EDV60325.1| putative GTP-binding protein EngB [Escherichia coli B7A]
 gi|190905860|gb|EDV65479.1| putative GTP-binding protein EngB [Escherichia coli F11]
 gi|192929430|gb|EDV83038.1| putative GTP-binding protein EngB [Escherichia coli E22]
 gi|192958697|gb|EDV89135.1| putative GTP-binding protein EngB [Escherichia coli E110019]
 gi|215267270|emb|CAS11719.1| GTP-binding protein [Escherichia coli O127:H6 str. E2348/69]
 gi|222035577|emb|CAP78322.1| GTP-binding protein engB [Escherichia coli LF82]
 gi|226902831|gb|EEH89090.1| GTPase EngB [Escherichia sp. 3_2_53FAA]
 gi|238861392|gb|ACR63390.1| GTP-binding protein [Escherichia coli BW2952]
 gi|253326544|gb|ACT31146.1| GTP-binding protein HSR1-related [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|257756386|dbj|BAI27888.1| GTP-binding protein [Escherichia coli O26:H11 str. 11368]
 gi|257761514|dbj|BAI33011.1| GTP-binding protein [Escherichia coli O103:H2 str. 12009]
 gi|257766937|dbj|BAI38432.1| GTP-binding protein [Escherichia coli O111:H- str. 11128]
 gi|260451300|gb|ACX41722.1| GTP-binding protein HSR1-related protein [Escherichia coli DH1]
 gi|284923966|emb|CBG37065.1| probable GTP-binding protein [Escherichia coli 042]
 gi|291425401|gb|EFE98440.1| GTP-binding protein engB [Escherichia coli FVEC1412]
 gi|291430845|gb|EFF03841.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           B185]
 gi|291468047|gb|EFF10545.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           B354]
 gi|294490765|gb|ADE89521.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           IHE3034]
 gi|298276261|gb|EFI17781.1| GTP-binding protein engB [Escherichia coli FVEC1302]
 gi|299878997|gb|EFI87208.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           196-1]
 gi|305852868|gb|EFM53315.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           NC101]
 gi|306906332|gb|EFN36848.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli W]
 gi|307628941|gb|ADN73245.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           UM146]
 gi|308928355|gb|EFP73816.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|312285939|gb|EFR13857.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312948434|gb|ADR29261.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|315063150|gb|ADT77477.1| GTP-binding protein [Escherichia coli W]
 gi|315138433|dbj|BAJ45592.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli DH1]
 gi|320174863|gb|EFW49984.1| GTP-binding protein EngB [Shigella dysenteriae CDC 74-1112]
 gi|320182136|gb|EFW57039.1| GTP-binding protein EngB [Shigella boydii ATCC 9905]
 gi|320196912|gb|EFW71534.1| GTP-binding protein EngB [Escherichia coli WV_060327]
 gi|320198936|gb|EFW73534.1| GTP-binding protein EngB [Escherichia coli EC4100B]
 gi|323155159|gb|EFZ41346.1| hypothetical protein ECEPECA14_2976 [Escherichia coli EPECa14]
 gi|323189711|gb|EFZ74990.1| hypothetical protein ECRN5871_2081 [Escherichia coli RN587/1]
 gi|323380786|gb|ADX53054.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           KO11]
 gi|323934351|gb|EGB30764.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           E1520]
 gi|323939085|gb|EGB35301.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           E482]
 gi|323943760|gb|EGB39857.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           H120]
 gi|323949359|gb|EGB45248.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           H252]
 gi|323954360|gb|EGB50145.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           H263]
 gi|323959368|gb|EGB55029.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           H489]
 gi|323964212|gb|EGB59695.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           M863]
 gi|323969731|gb|EGB65014.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           TA007]
 gi|323974267|gb|EGB69396.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           TW10509]
 gi|324115641|gb|EGC09579.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           E1167]
 gi|327250492|gb|EGE62200.1| hypothetical protein ECSTEC7V_4574 [Escherichia coli STEC_7v]
 gi|331052363|gb|EGI24400.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           TA206]
 gi|332085127|gb|EGI90305.1| hypothetical protein SD15574_4569 [Shigella dysenteriae 155-74]
 gi|332105092|gb|EGJ08438.1| GTPase EngB [Shigella sp. D9]
 gi|332345854|gb|AEE59188.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332998505|gb|EGK18103.1| hypothetical protein SFK272_4369 [Shigella flexneri K-272]
 gi|333014000|gb|EGK33361.1| hypothetical protein SFK227_4300 [Shigella flexneri K-227]
          Length = 210

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|170758960|ref|YP_001788547.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium botulinum
           A3 str. Loch Maree]
 gi|169405949|gb|ACA54360.1| GTP-binding protein [Clostridium botulinum A3 str. Loch Maree]
          Length = 194

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 110/188 (58%), Gaps = 15/188 (7%)

Query: 22  GLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN 81
           G  P+ G PE+AF GRSNVGKS+LIN L NR+ L + S+ PG+T+ +NFFV  D      
Sbjct: 18  GQYPEDGRPEVAFVGRSNVGKSTLINTLTNRRKLVKVSSTPGKTRLINFFVIND------ 71

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDV 141
               M  VD+PGYGYA+  K+  ++WG ++ +YL ER  L+ + LL+D RH     D ++
Sbjct: 72  ---NMYFVDLPGYGYAKVSKREKENWGYIMEQYLVERDQLKKIVLLVDSRHKPTSDDINM 128

Query: 142 FSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGI 199
           ++++        +V TK+DKL     +  + K K +IR+      +  ++  SS+ ++G 
Sbjct: 129 YNWIKHYNYEVLVVGTKLDKLK----RNDINKNKKIIRDTLKMDKDDKILLISSLSKEGK 184

Query: 200 EVLRKAIL 207
           E + + IL
Sbjct: 185 EEVLEQIL 192


>gi|148381176|ref|YP_001255717.1| GTP-binding protein [Clostridium botulinum A str. ATCC 3502]
 gi|153931772|ref|YP_001385551.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium botulinum
           A str. ATCC 19397]
 gi|153935229|ref|YP_001388957.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium botulinum
           A str. Hall]
 gi|153938105|ref|YP_001392578.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium botulinum
           F str. Langeland]
 gi|168179123|ref|ZP_02613787.1| GTP-binding protein [Clostridium botulinum NCTC 2916]
 gi|170757263|ref|YP_001782866.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium botulinum
           B1 str. Okra]
 gi|226950655|ref|YP_002805746.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium botulinum
           A2 str. Kyoto]
 gi|148290660|emb|CAL84789.1| probable GTP-binding protein Engb [Clostridium botulinum A str.
           ATCC 3502]
 gi|152927816|gb|ABS33316.1| GTP-binding protein [Clostridium botulinum A str. ATCC 19397]
 gi|152931143|gb|ABS36642.1| GTP-binding protein [Clostridium botulinum A str. Hall]
 gi|152934001|gb|ABS39499.1| GTP-binding protein [Clostridium botulinum F str. Langeland]
 gi|169122475|gb|ACA46311.1| GTP-binding protein [Clostridium botulinum B1 str. Okra]
 gi|182669944|gb|EDT81920.1| GTP-binding protein [Clostridium botulinum NCTC 2916]
 gi|226842026|gb|ACO84692.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium botulinum
           A2 str. Kyoto]
 gi|295320563|gb|ADG00941.1| GTP-binding protein [Clostridium botulinum F str. 230613]
          Length = 194

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 109/185 (58%), Gaps = 15/185 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G PE+AF GRSNVGKS+LIN L NR+ L + S+ PG+T+ +NFFV  D         
Sbjct: 21  PEDGRPEVAFVGRSNVGKSTLINTLTNRRKLVKVSSTPGKTRLINFFVIND--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYA+  KK  ++WG ++ +YL ER  L+ + LL+D RH     D +++++
Sbjct: 72  NMYFVDLPGYGYAKVSKKEKENWGYIMEQYLVERDQLKKIVLLVDSRHKPTSDDINMYNW 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEVL 202
           +        +V TK+DKL     +  + K K +IR+      +  ++  SS+ ++G E +
Sbjct: 132 IKHYNYEVLVVGTKLDKLK----RNDINKNKKIIRDTLKMDKDDKILLISSLSKEGKEEV 187

Query: 203 RKAIL 207
            + IL
Sbjct: 188 LEQIL 192


>gi|67458477|ref|YP_246101.1| GTPase EngB [Rickettsia felis URRWXCal2]
 gi|75537053|sp|Q4UNC2|ENGB_RICFE RecName: Full=Probable GTP-binding protein EngB
 gi|67004010|gb|AAY60936.1| Hypothetical GTP-binding protein [Rickettsia felis URRWXCal2]
          Length = 212

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 103/197 (52%), Gaps = 12/197 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  +P    PEIAF G+SNVGKSSLIN + N KNLA+ SN PGRT+ +NFF  
Sbjct: 24  FVAGAMNINQIPNFSLPEIAFVGKSNVGKSSLINTICNNKNLAKVSNTPGRTRQINFFNL 83

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A  P    + W  LI  YL    +LR V LLID R G
Sbjct: 84  AD---------KLIIVDLPGYGFANVPISVKEQWEVLISYYLRNSYSLRLVNLLIDSRRG 134

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K+ D+ V   L      +QI+ TK DK++         +      NY      V+  SS
Sbjct: 135 IKENDKKVAELLLANKREFQIIFTKSDKVTDRKNLNDEAQNFLATLNYSC---NVMYVSS 191

Query: 194 VKRKGIEVLRKAILETI 210
             ++G   L+ ++ + I
Sbjct: 192 RSKEGARELKASLAKCI 208


>gi|15834041|ref|NP_312814.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O157:H7 str. Sakai]
 gi|161367480|ref|NP_290489.2| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O157:H7 EDL933]
 gi|168755530|ref|ZP_02780537.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str.
           EC4401]
 gi|168768147|ref|ZP_02793154.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str.
           EC4486]
 gi|168780765|ref|ZP_02805772.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str.
           EC4076]
 gi|168786702|ref|ZP_02811709.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str.
           EC869]
 gi|168799576|ref|ZP_02824583.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str.
           EC508]
 gi|195937501|ref|ZP_03082883.1| GTPase EngB [Escherichia coli O157:H7 str. EC4024]
 gi|208807401|ref|ZP_03249738.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O157:H7 str. EC4206]
 gi|208814207|ref|ZP_03255536.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O157:H7 str. EC4045]
 gi|208819675|ref|ZP_03259995.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O157:H7 str. EC4042]
 gi|209398819|ref|YP_002273380.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O157:H7 str. EC4115]
 gi|217326295|ref|ZP_03442379.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O157:H7 str. TW14588]
 gi|254795855|ref|YP_003080692.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O157:H7 str. TW14359]
 gi|261223491|ref|ZP_05937772.1| GTP-binding protein [Escherichia coli O157:H7 str. FRIK2000]
 gi|261257254|ref|ZP_05949787.1| GTP-binding protein [Escherichia coli O157:H7 str. FRIK966]
 gi|291285275|ref|YP_003502093.1| putative GTP-binding protein engB [Escherichia coli O55:H7 str.
           CB9615]
 gi|21362528|sp|Q8X8H0|ENGB_ECO57 RecName: Full=Probable GTP-binding protein EngB
 gi|238058983|sp|B5YZ00|ENGB_ECO5E RecName: Full=Probable GTP-binding protein EngB
 gi|13364263|dbj|BAB38210.1| essential GTPase for cell cycle [Escherichia coli O157:H7 str.
           Sakai]
 gi|189001573|gb|EDU70559.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str.
           EC4076]
 gi|189357180|gb|EDU75599.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362605|gb|EDU81024.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str.
           EC4486]
 gi|189373339|gb|EDU91755.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str.
           EC869]
 gi|189378061|gb|EDU96477.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str.
           EC508]
 gi|208727202|gb|EDZ76803.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O157:H7 str. EC4206]
 gi|208735484|gb|EDZ84171.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O157:H7 str. EC4045]
 gi|208739798|gb|EDZ87480.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O157:H7 str. EC4042]
 gi|209160219|gb|ACI37652.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O157:H7 str. EC4115]
 gi|209752828|gb|ACI74721.1| hypothetical protein ECs4787 [Escherichia coli]
 gi|209752830|gb|ACI74722.1| hypothetical protein ECs4787 [Escherichia coli]
 gi|209752832|gb|ACI74723.1| hypothetical protein ECs4787 [Escherichia coli]
 gi|209752834|gb|ACI74724.1| hypothetical protein ECs4787 [Escherichia coli]
 gi|209752836|gb|ACI74725.1| hypothetical protein ECs4787 [Escherichia coli]
 gi|217322516|gb|EEC30940.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           O157:H7 str. TW14588]
 gi|254595255|gb|ACT74616.1| GTP-binding protein [Escherichia coli O157:H7 str. TW14359]
 gi|290765148|gb|ADD59109.1| Probable GTP-binding protein engB [Escherichia coli O55:H7 str.
           CB9615]
 gi|320191045|gb|EFW65695.1| GTP-binding protein EngB [Escherichia coli O157:H7 str. EC1212]
 gi|320639202|gb|EFX08829.1| GTP-binding protein YsxC [Escherichia coli O157:H7 str. G5101]
 gi|320644590|gb|EFX13644.1| GTP-binding protein YsxC [Escherichia coli O157:H- str. 493-89]
 gi|320649914|gb|EFX18422.1| GTP-binding protein YsxC [Escherichia coli O157:H- str. H 2687]
 gi|320655221|gb|EFX23167.1| GTP-binding protein YsxC [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320666007|gb|EFX33026.1| GTP-binding protein YsxC [Escherichia coli O157:H7 str. LSU-61]
 gi|326338133|gb|EGD61963.1| GTP-binding protein EngB [Escherichia coli O157:H7 str. 1044]
 gi|326342573|gb|EGD66346.1| GTP-binding protein EngB [Escherichia coli O157:H7 str. 1125]
          Length = 210

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|157828012|ref|YP_001494254.1| ribosome biogenesis GTP-binding protein YsxC [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|166225976|sp|A8GQS1|ENGB_RICRS RecName: Full=Probable GTP-binding protein EngB
 gi|157800493|gb|ABV75746.1| GTPase EngB [Rickettsia rickettsii str. 'Sheila Smith']
          Length = 212

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 103/199 (51%), Gaps = 12/199 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  +P    PEIAF G+SNVGKSSLIN + N KNLA+ SN  GRT+ +NFF  
Sbjct: 24  FVAGAMNINQIPNFSLPEIAFVGKSNVGKSSLINTICNNKNLAKVSNTAGRTRQINFFNL 83

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A  P    + WG LI  YL     LR V LLID R G
Sbjct: 84  AD---------KLIIVDLPGYGFANVPISVKEQWGVLISYYLRNSYNLRLVNLLIDSRRG 134

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K+ D+ V   L      +QI+ TK DK++         +      NY      V+  S+
Sbjct: 135 IKENDKKVADLLLANKREFQIIFTKSDKVTDHKNLHDEAQNFLATLNYSC---NVMYVSN 191

Query: 194 VKRKGIEVLRKAILETINY 212
             ++G   L+ ++ + I +
Sbjct: 192 RSKEGARELKASLAKCIKF 210


>gi|291548431|emb|CBL21539.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Ruminococcus sp.
           SR1/5]
          Length = 203

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 92/152 (60%), Gaps = 9/152 (5%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           +P  G PE+AF+G+SNVGKSSLIN L+NRK LARTS  PG+TQ +NF+         N  
Sbjct: 18  IPDTGRPEVAFAGKSNVGKSSLINGLMNRKALARTSAQPGKTQTINFY---------NIN 68

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
            AM LVD+PGYGYA+      + WG +I  YL     LR V+LL+D RH     D+ ++ 
Sbjct: 69  EAMYLVDLPGYGYAKVSAAEKEKWGKMIEGYLHNSKELRAVFLLVDIRHKPSANDKQMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK 175
           ++        I+ TK+DKL  +   ++L++ +
Sbjct: 129 WICHNGYEPVIIATKLDKLKRSQVAKSLKEIR 160


>gi|89895940|ref|YP_519427.1| hypothetical protein DSY3194 [Desulfitobacterium hafniense Y51]
 gi|219670373|ref|YP_002460808.1| ribosome biogenesis GTP-binding protein YsxC [Desulfitobacterium
           hafniense DCB-2]
 gi|119369191|sp|Q24SK9|ENGB_DESHY RecName: Full=Probable GTP-binding protein EngB
 gi|254783194|sp|B8FVH0|ENGB_DESHD RecName: Full=Probable GTP-binding protein EngB
 gi|89335388|dbj|BAE84983.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219540633|gb|ACL22372.1| small GTP-binding protein domain protein [Desulfitobacterium
           hafniense DCB-2]
          Length = 201

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 113/205 (55%), Gaps = 18/205 (8%)

Query: 7   FTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ 66
           F  SA + ++G PE+        PEIA +GRSNVGKSSLIN  +NR+NLART N PG+TQ
Sbjct: 9   FVTSA-VNIKGYPELT------GPEIALAGRSNVGKSSLINKFINRRNLARTGNTPGKTQ 61

Query: 67  HLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYL 126
            LNF+   D           + VD+PGYGYA+  K+   +WG ++  Y S R  LR V  
Sbjct: 62  MLNFYRIND---------QWSFVDLPGYGYAKVSKEIKANWGKMMEEYFSRRENLRAVIQ 112

Query: 127 LIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP 186
           ++D RH     DQ++ +FL  + +   +V TK DK+S     + L +    + + P  H 
Sbjct: 113 VVDIRHVPSVEDQEMHAFLRNRGIPVLVVATKADKISKGQWGKHLSQIAKAL-HIPDWHI 171

Query: 187 EVIPTSSVKRKGIEVLRKAILETIN 211
            +I  S+    G+  L +A+ E ++
Sbjct: 172 -IITYSAETGLGVPELHEAVEEILS 195


>gi|15674911|ref|NP_269085.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes M1 GAS]
 gi|71910505|ref|YP_282055.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes MGAS5005]
 gi|306827517|ref|ZP_07460800.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes ATCC 10782]
 gi|24418393|sp|Q9A088|ENGB_STRP1 RecName: Full=Probable GTP-binding protein EngB
 gi|13622052|gb|AAK33806.1| conserved hypothetical GTP-binding protein [Streptococcus pyogenes
           M1 GAS]
 gi|71853287|gb|AAZ51310.1| GTP-binding protein [Streptococcus pyogenes MGAS5005]
 gi|304430315|gb|EFM33341.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes ATCC 10782]
          Length = 199

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 103/186 (55%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++ RKNLARTS+ PG+TQ LNFF      N+ + L 
Sbjct: 25  PQDDLPEIALAGRSNVGKSSFINTILGRKNLARTSSKPGKTQLLNFF------NIDDKL- 77

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   + D  ++ F
Sbjct: 78  --RFVDVPGYGYAKVSKSERAKWGKMIEEYLTSRDNLRAVVSLVDLRHAPSKEDIQMYDF 135

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   +V TK DK+ P       E       N+  +   ++  SSV+R GI+    
Sbjct: 136 LKYYDIPVIVVATKADKI-PRGKWNKHESVVKKALNFDKSDTFIV-FSSVERIGIDDSWD 193

Query: 205 AILETI 210
           AILE +
Sbjct: 194 AILEQV 199


>gi|308174517|ref|YP_003921222.1| GTPase [Bacillus amyloliquefaciens DSM 7]
 gi|307607381|emb|CBI43752.1| GTPase involved in ribosome 50S subunit assembly [Bacillus
           amyloliquefaciens DSM 7]
 gi|328554436|gb|AEB24928.1| GTP-binding protein YsxC [Bacillus amyloliquefaciens TA208]
 gi|328912840|gb|AEB64436.1| GTPase involved in ribosome 50S subunit assembly [Bacillus
           amyloliquefaciens LL3]
          Length = 195

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 104/187 (55%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA +GRSNVGKSS IN L+NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PDGGLPEIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQTLNFYIIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYG+A+  K   ++WG +I  Y++ R  L+    ++D RH     D +++ F
Sbjct: 70  ELHFVDVPGYGFAKVSKSEREAWGRMIETYMTTREELKACVQIVDLRHAPSADDVNMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   ++ TK DK+      + L+  K  +   P    E+I  SS  +KG +    
Sbjct: 130 LKYYGIPVIVIATKADKIPKGKWDKHLKVVKQTLDMDP--EDELILFSSETKKGKDEAWG 187

Query: 205 AILETIN 211
           AI + I+
Sbjct: 188 AIKKMIS 194


>gi|229586341|ref|YP_002844842.1| ribosome biogenesis GTP-binding protein YsxC [Rickettsia africae
           ESF-5]
 gi|259645905|sp|C3PMD9|ENGB_RICAE RecName: Full=Probable GTP-binding protein EngB
 gi|228021391|gb|ACP53099.1| Hypothetical GTP-binding protein [Rickettsia africae ESF-5]
          Length = 212

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 87/150 (58%), Gaps = 9/150 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  +P    PEIAF G+SNVGKSSLIN + + KNLA+ SN PGRT+ +NFF  
Sbjct: 24  FVAGAMNINQIPNFSLPEIAFVGKSNVGKSSLINTICSNKNLAKVSNTPGRTRQINFFNL 83

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A  P    + WG LI  YL     LR V LLID R G
Sbjct: 84  AD---------KLIIVDLPGYGFANVPISVKEQWGVLISYYLRNSYNLRLVNLLIDSRRG 134

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
           +K+ D+ V   L      +QI+ TK DK++
Sbjct: 135 IKENDKKVADLLLANKREFQIIFTKSDKVT 164


>gi|21910141|ref|NP_664409.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes MGAS315]
 gi|28896160|ref|NP_802510.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes SSI-1]
 gi|25452936|sp|Q8K7V8|ENGB_STRP3 RecName: Full=Probable GTP-binding protein EngB
 gi|21904334|gb|AAM79212.1| putative GTP-binding protein [Streptococcus pyogenes MGAS315]
 gi|28811410|dbj|BAC64343.1| conserved hypothetical GTP-binding protein [Streptococcus pyogenes
           SSI-1]
          Length = 199

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 103/186 (55%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++ RKNLARTS+ PG+TQ LNFF      N+ + L 
Sbjct: 25  PQDDLPEIALAGRSNVGKSSFINTILGRKNLARTSSKPGKTQLLNFF------NIDDKL- 77

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   + D  ++ F
Sbjct: 78  --RFVDVPGYGYAKVSKSERAKWGKMIEEYLTSRDNLRAVVSLVDLRHAPSKEDIQMYDF 135

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   +V TK DK+ P       E       N+  +   ++  SSV+R GI+    
Sbjct: 136 LKYYDIPVIVVATKADKI-PHGKWNKHESVVKKALNFDKSDTFIV-FSSVERIGIDDSWD 193

Query: 205 AILETI 210
           AILE +
Sbjct: 194 AILEQV 199


>gi|154686955|ref|YP_001422116.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus
           amyloliquefaciens FZB42]
 gi|166225941|sp|A7Z7A9|ENGB_BACA2 RecName: Full=Probable GTP-binding protein EngB
 gi|154352806|gb|ABS74885.1| YsxC [Bacillus amyloliquefaciens FZB42]
          Length = 195

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 104/187 (55%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA +GRSNVGKSS IN L+NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PDGGLPEIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQTLNFYIIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYG+A+  K   ++WG +I  Y++ R  L+    ++D RH     D +++ F
Sbjct: 70  ELHFVDVPGYGFAKVSKSEREAWGRMIETYMTTREELKACVQIVDLRHAPSAEDVNMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   ++ TK DK+      + L+  K  +   P    E+I  SS  +KG +    
Sbjct: 130 LKYYGIPVIVIATKADKIPKGKWDKHLKVVKQTLDMDP--EDELILFSSETKKGKDEAWG 187

Query: 205 AILETIN 211
           AI + I+
Sbjct: 188 AIKKMIS 194


>gi|332686390|ref|YP_004456164.1| GTP-binding protein EngB [Melissococcus plutonius ATCC 35311]
 gi|332370399|dbj|BAK21355.1| GTP-binding protein EngB [Melissococcus plutonius ATCC 35311]
          Length = 193

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/182 (40%), Positives = 104/182 (57%), Gaps = 11/182 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNF++ +D         
Sbjct: 19  PERELPEIALAGRSNVGKSSFINTLINRKNLARTSGKPGKTQTLNFYLIED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           ++  VD+PGYGYA+  K     WG +I  Y++ R+ L  V  L+D RH     D+ ++ F
Sbjct: 70  SLYFVDVPGYGYAKVSKTERAKWGKMIETYITSRNQLEAVVSLVDFRHPPTVEDKQMYDF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   +V TK+DK+ P++     E       N+  +  + I  SSV +KG E   +
Sbjct: 130 LKYYEIPVILVATKVDKI-PSSKWNKHENIIKKTLNF-DSQDKFILFSSVTKKGKEEAWQ 187

Query: 205 AI 206
           AI
Sbjct: 188 AI 189


>gi|189183737|ref|YP_001937522.1| Era/Obg family GTP-binding protein [Orientia tsutsugamushi str.
           Ikeda]
 gi|189180508|dbj|BAG40288.1| Era/Obg family GTP-binding protein [Orientia tsutsugamushi str.
           Ikeda]
          Length = 207

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 104/195 (53%), Gaps = 13/195 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL G       P    PE  F G+SNVGKSSLIN+L N+ +LAR S  PGRT+ +NFF+ 
Sbjct: 21  FLLGASHKSQFPATNLPEFVFVGKSNVGKSSLINLLCNKHSLARVSKTPGRTREINFFLI 80

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +          + LVD+PGYGY++       +W  LI+ YL  R  LR +Y+LID R G
Sbjct: 81  AN---------KLILVDLPGYGYSKTAVVTCKNWEKLILSYLENRKNLRLIYVLIDARRG 131

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K  D  V + +     + +IV TK DK+S       +  +K L+      + ++I TS 
Sbjct: 132 IKDNDLAVINLVHHFNYTMKIVFTKEDKISDLEKNSLIATSKNLL----DYNDKIIFTSI 187

Query: 194 VKRKGIEVLRKAILE 208
             + G + ++  IL+
Sbjct: 188 RNKNGAQEIQYNILK 202


>gi|153813471|ref|ZP_01966139.1| hypothetical protein RUMOBE_03891 [Ruminococcus obeum ATCC 29174]
 gi|149830415|gb|EDM85507.1| hypothetical protein RUMOBE_03891 [Ruminococcus obeum ATCC 29174]
          Length = 201

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 104/187 (55%), Gaps = 15/187 (8%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           +P  G PE+AF+G+SNVGKSSLIN L+NRK LARTS  PG+TQ +NF+   D        
Sbjct: 18  IPDTGLPEVAFAGKSNVGKSSLINGLMNRKALARTSAQPGKTQTINFYKIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + LVD+PGYGYAR      + WG +I  YL     L+ V+LLID RH     D+ ++ 
Sbjct: 70  -ELDLVDLPGYGYARVTPAEKEKWGKMIENYLHTSHNLKAVFLLIDIRHDPSANDRQMYE 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           ++        I+ TK+DKL  +  Q+ L+  +  ++        VIP S+  ++G    R
Sbjct: 129 WILHNGYEPIIIATKLDKLKRSQVQKNLKAIREGLQ--LKKGTTVIPYSAETKQG----R 182

Query: 204 KAILETI 210
             I E I
Sbjct: 183 DEIWELI 189


>gi|311281672|ref|YP_003943903.1| ribosome biogenesis GTP-binding protein YsxC [Enterobacter cloacae
           SCF1]
 gi|308750867|gb|ADO50619.1| ribosome biogenesis GTP-binding protein YsxC [Enterobacter cloacae
           SCF1]
          Length = 208

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 108/196 (55%), Gaps = 16/196 (8%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVTSAPDIRHLPADSGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 71  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRLCLKGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA---HPEVIP 190
           +K +DQ +  +     +   ++LTK DKL+    +  L     ++R   TA     +V  
Sbjct: 122 LKDLDQQMIEWAVDSGIQVLVLLTKADKLASGARKAQLN----MVREAATAFNGDVQVEA 177

Query: 191 TSSVKRKGIEVLRKAI 206
            SS+K++G++ LR+ +
Sbjct: 178 FSSLKKQGVDKLREKL 193


>gi|281419987|ref|ZP_06250986.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella copri DSM
           18205]
 gi|281405787|gb|EFB36467.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella copri DSM
           18205]
          Length = 201

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 107/198 (54%), Gaps = 13/198 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F    P + + PK    E AF GRSNVGKSSLIN+L N K LA+TS  PG+T  +N F+ 
Sbjct: 8   FTISAPRVSMCPKDTKAEYAFIGRSNVGKSSLINMLCNHKGLAKTSATPGKTLLINHFII 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                  NN     LVD+PGYG+A+  K        +I  Y+ +R  L  V++LID RH 
Sbjct: 68  -------NN--EWYLVDLPGYGFAKRSKTVQKQLEQMISSYILQRQQLANVFVLIDVRHD 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID++   +L +  V + IV TK DKL P  A+   EK  + + +   A P    TSS
Sbjct: 119 QQKIDREFVDWLGESGVPFCIVFTKADKLGPVKARMNAEKWMHALEDRWEALPPYFITSS 178

Query: 194 VKRKGIEVLRKAILETIN 211
            K+ G    R  +L+ I+
Sbjct: 179 EKKLG----RDEVLDYID 192


>gi|332764612|gb|EGJ94844.1| cell division protein putative checkpoint GTPase [Shigella flexneri
           2930-71]
          Length = 207

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 8   FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 68  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 119 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKALLNMVREAVLAF-NGDVQVETFSS 177

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 178 LKKQGVDKLRQKL 190


>gi|165932710|ref|YP_001649499.1| GTP-binding protein YsxC [Rickettsia rickettsii str. Iowa]
 gi|165907797|gb|ABY72093.1| GTP-binding protein [Rickettsia rickettsii str. Iowa]
          Length = 225

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 103/199 (51%), Gaps = 12/199 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  +P    PEIAF G+SNVGKSSLIN + N KNLA+ SN  GRT+ +NFF  
Sbjct: 37  FVAGAMNINQIPNFSLPEIAFVGKSNVGKSSLINTICNNKNLAKVSNTAGRTRQINFFNL 96

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A  P    + WG LI  YL     LR V LLID R G
Sbjct: 97  AD---------KLIIVDLPGYGFANVPISVKEQWGVLISYYLRNSYNLRLVNLLIDSRRG 147

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K+ D+ V   L      +QI+ TK DK++         +      NY      V+  S+
Sbjct: 148 IKENDKKVADLLLANKREFQIIFTKSDKVTDHKNLHDEAQNFLATLNYSC---NVMYVSN 204

Query: 194 VKRKGIEVLRKAILETINY 212
             ++G   L+ ++ + I +
Sbjct: 205 RSKEGARELKASLAKCIKF 223


>gi|197120176|ref|YP_002140603.1| ribosome biogenesis GTP-binding protein YsxC [Geobacter
           bemidjiensis Bem]
 gi|238690880|sp|B5EEM1|ENGB_GEOBB RecName: Full=Probable GTP-binding protein EngB
 gi|197089536|gb|ACH40807.1| GTPase EngB [Geobacter bemidjiensis Bem]
          Length = 214

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/151 (45%), Positives = 93/151 (61%), Gaps = 11/151 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-V 72
           F++   +    P+   PEIAF+GRSNVGKSSL+N+LVNRKNL RTS+ PGRTQ +NFF V
Sbjct: 8   FIKSATKPAHYPEGNLPEIAFAGRSNVGKSSLVNVLVNRKNLVRTSSTPGRTQLINFFQV 67

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
             DF           LVD+PGYGYA+ P      W  ++  YLS+R  LR V L++D R 
Sbjct: 68  NDDF----------MLVDLPGYGYAKVPLAVKKEWRPMMETYLSKRRNLRGVVLILDIRR 117

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
              + D  + ++L   +V   +V+TK DK+S
Sbjct: 118 TPTEEDLQMLAWLRAFSVPPIVVITKCDKVS 148


>gi|153206108|ref|ZP_01945371.1| GTP-binding protein [Coxiella burnetii 'MSU Goat Q177']
 gi|212217903|ref|YP_002304690.1| ribosome biogenesis GTP-binding protein YsxC [Coxiella burnetii
           CbuK_Q154]
 gi|238058981|sp|B6J4E1|ENGB_COXB1 RecName: Full=Probable GTP-binding protein EngB
 gi|120577238|gb|EAX33862.1| GTP-binding protein [Coxiella burnetii 'MSU Goat Q177']
 gi|212012165|gb|ACJ19545.1| GTP-binding protein [Coxiella burnetii CbuK_Q154]
          Length = 205

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 94/168 (55%), Gaps = 9/168 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           +L    E   LP     EIAF GRSN GKSS +NI+   K LARTS  PGRTQ +NFF  
Sbjct: 15  YLTSAAEFDQLPPDQGAEIAFIGRSNAGKSSALNIITGIKGLARTSKTPGRTQMINFFAL 74

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +   L         VD+PGYGYA+ P+     W  L+  YL +R  L+ + +++D RH 
Sbjct: 75  NEHERL---------VDLPGYGYAKVPRMVQKRWEELVDSYLKKRRCLKGLVVVMDIRHP 125

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY 181
           +K++D+DV  +     +   I+LTK DKLS   A++TL + +  I  Y
Sbjct: 126 LKEVDEDVIEWAVNYDIPIHILLTKSDKLSQNAAKKTLGEVQTAISAY 173


>gi|299471340|emb|CBN79295.1| YihA2, YihA/EngB-like GTPase [Ectocarpus siliculosus]
          Length = 247

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 102/178 (57%), Gaps = 5/178 (2%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP A  PE+AF GRSN GKS+L+  L+    L R S +PG T+ +N+F  ++        
Sbjct: 60  LPTADTPEVAFIGRSNQGKSTLVGKLLKNPKLVRASKSPGCTKTVNYFALREGGA---ES 116

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST--LRCVYLLIDCRHGVKQIDQDV 141
           P   LVD+PGYG+AR  K+ V  W   +  YL  RS+  LR  ++L+D RHG++  D+ +
Sbjct: 117 PQAFLVDLPGYGFARESKRAVRGWNQAVGSYLEGRSSSVLRRTFVLVDGRHGLQPDDEQM 176

Query: 142 FSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI 199
            SFL  + V   +VLTK+DK SP    ++LE    L  ++P   P V   S+ K +G+
Sbjct: 177 LSFLSSRDVENMVVLTKVDKASPAQLVQSLEGAFQLAVHHPATLPIVHCISAHKGQGM 234


>gi|152972673|ref|YP_001337819.1| ribosome biogenesis GTP-binding protein YsxC [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238892278|ref|YP_002917012.1| ribosome biogenesis GTP-binding protein YsxC [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262041647|ref|ZP_06014840.1| ribosome biogenesis GTP-binding protein YsxC [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|166225962|sp|A6TG68|ENGB_KLEP7 RecName: Full=Probable GTP-binding protein EngB
 gi|150957522|gb|ABR79552.1| GTP-binding protein [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238544594|dbj|BAH60945.1| GTP-binding protein [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259041000|gb|EEW42078.1| ribosome biogenesis GTP-binding protein YsxC [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
          Length = 210

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 11  FVTSAPDIRHLPADTGIEVAFAGRSNAGKSSALNTLTNQKNLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            LVD+PGYGYA+ P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 71  AE---------GKRLVDLPGYGYAQVPEEMKIKWQRALGEYLEKRLCLKGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +  +  +   ++LTK DKL+    +  +   +  +  +     +V P SS
Sbjct: 122 LKDLDQQMIEWAVESDIQVLVLLTKADKLASGARKAQVNMVREAVLAF-NGDVQVEPFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 181 LKKSGVDKLRQKL 193


>gi|161485827|ref|NP_709663.3| ribosome biogenesis GTP-binding protein YsxC [Shigella flexneri 2a
           str. 301]
 gi|161486407|ref|NP_839017.2| ribosome biogenesis GTP-binding protein YsxC [Shigella flexneri 2a
           str. 2457T]
 gi|119369258|sp|Q83PF4|ENGB_SHIFL RecName: Full=Probable GTP-binding protein EngB
 gi|281603253|gb|ADA76237.1| putative GTP-binding protein engB [Shigella flexneri 2002017]
 gi|313647097|gb|EFS11552.1| hypothetical protein SF2457T_4463 [Shigella flexneri 2a str. 2457T]
 gi|332751497|gb|EGJ81898.1| hypothetical protein SFK671_4264 [Shigella flexneri K-671]
 gi|332753187|gb|EGJ83570.1| hypothetical protein SF274771_4128 [Shigella flexneri 2747-71]
 gi|332997588|gb|EGK17203.1| hypothetical protein SFVA6_4456 [Shigella flexneri VA-6]
 gi|332998615|gb|EGK18212.1| hypothetical protein SFK218_4644 [Shigella flexneri K-218]
 gi|333013840|gb|EGK33202.1| hypothetical protein SFK304_4498 [Shigella flexneri K-304]
          Length = 210

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKALLNMVREAVLAF-NGDVQVETFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|56808898|ref|ZP_00366607.1| COG0218: Predicted GTPase [Streptococcus pyogenes M49 591]
 gi|94988379|ref|YP_596480.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes MGAS9429]
 gi|94990259|ref|YP_598359.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes MGAS10270]
 gi|94992261|ref|YP_600360.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes MGAS2096]
 gi|209559239|ref|YP_002285711.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pyogenes NZ131]
 gi|119369269|sp|Q1JC92|ENGB_STRPB RecName: Full=Probable GTP-binding protein EngB
 gi|119369270|sp|Q1JM76|ENGB_STRPC RecName: Full=Probable GTP-binding protein EngB
 gi|119369271|sp|Q1JHC1|ENGB_STRPD RecName: Full=Probable GTP-binding protein EngB
 gi|238058988|sp|B5XL04|ENGB_STRPZ RecName: Full=Probable GTP-binding protein EngB
 gi|94541887|gb|ABF31936.1| GTP-binding protein YihA [Streptococcus pyogenes MGAS9429]
 gi|94543767|gb|ABF33815.1| GTP-binding protein YihA [Streptococcus pyogenes MGAS10270]
 gi|94545769|gb|ABF35816.1| GTP-binding protein YihA [Streptococcus pyogenes MGAS2096]
 gi|209540440|gb|ACI61016.1| GTP-binding protein EngB [Streptococcus pyogenes NZ131]
          Length = 199

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 103/186 (55%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++ RKNLARTS+ PG+TQ LNFF      N+ + L 
Sbjct: 25  PQDDLPEIALAGRSNVGKSSFINTILGRKNLARTSSKPGKTQLLNFF------NIDDKL- 77

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   + D  ++ F
Sbjct: 78  --RFVDVPGYGYAKVSKSERAKWGKMIEEYLTTRDNLRAVVSLVDLRHAPSKEDIQMYDF 135

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   +V TK DK+ P       E       N+  +   ++  SSV+R GI+    
Sbjct: 136 LKYYDIPVIVVATKADKI-PRGKWNKHESVVKKALNFDKSDTFIV-FSSVERIGIDDSWD 193

Query: 205 AILETI 210
           AILE +
Sbjct: 194 AILEQV 199


>gi|161984817|ref|YP_410156.2| ribosome biogenesis GTP-binding protein YsxC [Shigella boydii
           Sb227]
 gi|119369256|sp|Q31UD0|ENGB_SHIBS RecName: Full=Probable GTP-binding protein EngB
 gi|320185488|gb|EFW60256.1| GTP-binding protein EngB [Shigella flexneri CDC 796-83]
 gi|332088563|gb|EGI93677.1| hypothetical protein SB359474_4457 [Shigella boydii 3594-74]
          Length = 210

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRHSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|332518992|ref|ZP_08395459.1| ribosome biogenesis GTP-binding protein YsxC [Lacinutrix algicola
           5H-3-7-4]
 gi|332044840|gb|EGI81033.1| ribosome biogenesis GTP-binding protein YsxC [Lacinutrix algicola
           5H-3-7-4]
          Length = 206

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 98/185 (52%), Gaps = 9/185 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    E+   PK   PE AF GRSNVGKSSLIN+L +RK+LA+TS  PG+TQ +N F+ 
Sbjct: 8   FVISNSEVSKCPKDMLPEYAFIGRSNVGKSSLINMLTSRKSLAKTSGRPGKTQLINHFII 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                         LVD+PGYGYAR  K     +   I +Y  +R  L C ++L+D RH 
Sbjct: 68  N---------KEWYLVDLPGYGYARVSKSTKKVFQKFITKYFEQREQLVCAFVLVDIRHK 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            + ID +   +L +  + + I+ TK DKL P      +E  + ++       P+   TSS
Sbjct: 119 PQPIDLEFMQYLGEGGIPFCIIFTKADKLKPNAITRHVEDYRKIMLETWEEMPQHFITSS 178

Query: 194 VKRKG 198
            K  G
Sbjct: 179 SKDIG 183


>gi|161617123|ref|YP_001591088.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|189037187|sp|A9MYC7|ENGB_SALPB RecName: Full=Probable GTP-binding protein EngB
 gi|161366487|gb|ABX70255.1| hypothetical protein SPAB_04962 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 210

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDRGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  VD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +  +  +   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIQWAVESNIQVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVEAFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|302877399|ref|YP_003845963.1| ribosome biogenesis GTP-binding protein YsxC [Gallionella
           capsiferriformans ES-2]
 gi|302580188|gb|ADL54199.1| ribosome biogenesis GTP-binding protein YsxC [Gallionella
           capsiferriformans ES-2]
          Length = 208

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 104/188 (55%), Gaps = 12/188 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  I  LP  G  E+AF GRSN GKSS IN L N   LA TS  PGRTQHLN+F  
Sbjct: 9   FYTTVNHIKDLPMHGGREVAFVGRSNAGKSSAINTLANHVRLAYTSKTPGRTQHLNYF-- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               +L N+     +VD+PGYGYA+ P +    W  L+  YL +R  L  + +++D R  
Sbjct: 67  ----SLGND---GYIVDLPGYGYAKVPPEAKRHWEALLSTYLQKREELSGLIVIMDIRRP 119

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK-YLIRNYPTAHPEVIPTS 192
           + ++D+ +  +         I+LTK DKLS   +  TL K K YL  NYP    ++   S
Sbjct: 120 LLELDETMLDWFATTGKPVHILLTKSDKLSRQQSTLTLMKVKAYLAENYPQCSVQLF--S 177

Query: 193 SVKRKGIE 200
           S+K++G+E
Sbjct: 178 SLKKQGLE 185


>gi|254039076|ref|ZP_04873126.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
 gi|226838512|gb|EEH70541.1| conserved hypothetical protein [Escherichia sp. 1_1_43]
          Length = 210

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     ++   SS
Sbjct: 122 LKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQIETFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|73542832|ref|YP_297352.1| GTPase EngB [Ralstonia eutropha JMP134]
 gi|119369239|sp|Q46WH5|ENGB_CUPPJ RecName: Full=Probable GTP-binding protein EngB
 gi|72120245|gb|AAZ62508.1| cell division checkpoint GTPase YihA [Ralstonia eutropha JMP134]
          Length = 228

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 105/198 (53%), Gaps = 8/198 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP    PE+AF+GRSN GKS+ INIL N+K LA +S  PGRTQH+N+F  
Sbjct: 9   FFTTVNHLRDLPATAVPEVAFAGRSNAGKSTAINILCNQKRLAFSSRTPGRTQHINYFT- 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
              + +K   P   LVD+PGYGYA         W GL+  Y+  RS L  + L++D R  
Sbjct: 68  --VAPVKAPDPIAFLVDLPGYGYAEVSGSAKYHWQGLLSDYVQTRSQLSGLILMMDARRP 125

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT-- 191
              +D  +  +         ++LTK DKL+ +   + L +T+ ++  Y       +P   
Sbjct: 126 FTDLDCQMVEWFLPTGKPVHVLLTKADKLTNSENAKALRETRKMLEGYAEQLATPVPLTA 185

Query: 192 ---SSVKRKGIEVLRKAI 206
              SS+KR+GIE  ++ I
Sbjct: 186 QLFSSLKRRGIEEAQRVI 203


>gi|328943788|ref|ZP_08241253.1| ribosome biogenesis GTP-binding protein YsxC [Atopobium vaginae DSM
           15829]
 gi|327491757|gb|EGF23531.1| ribosome biogenesis GTP-binding protein YsxC [Atopobium vaginae DSM
           15829]
          Length = 203

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 102/185 (55%), Gaps = 13/185 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP +  PEI F GRSNVGKSSLIN L+ RK LARTS+ PG+T ++NFF          N+
Sbjct: 28  LPASTTPEIIFCGRSNVGKSSLINKLLKRKALARTSSQPGKTANINFF----------NV 77

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             +  VD+PGYG+A+  K   + W  LI  Y  +  +   V  LID R   +Q+D+D+ +
Sbjct: 78  DGIRFVDLPGYGFAKVSKAERERWSSLISGYFEDNRSFNLVICLIDIRIDAQQLDKDMLT 137

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           ++  + + Y +  TK DKL+ + A   L     L +       + I TS+   +G+  LR
Sbjct: 138 YVIHEELPYVVAFTKADKLTHSKA---LAARTKLCKALEVPQDKTIITSAETGEGMADLR 194

Query: 204 KAILE 208
           + I E
Sbjct: 195 RCIEE 199


>gi|16762431|ref|NP_458048.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|16767266|ref|NP_462881.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|29143919|ref|NP_807261.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56415847|ref|YP_152922.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|62182463|ref|YP_218880.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|167551521|ref|ZP_02345276.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|167995106|ref|ZP_02576196.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168232924|ref|ZP_02657982.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168237615|ref|ZP_02662673.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168244253|ref|ZP_02669185.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168263108|ref|ZP_02685081.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168467330|ref|ZP_02701167.1| putative GTP-binding protein EngB [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|194447921|ref|YP_002048005.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194468507|ref|ZP_03074491.1| putative GTP-binding protein EngB [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194736984|ref|YP_002116922.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197251708|ref|YP_002148921.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197264265|ref|ZP_03164339.1| putative GTP-binding protein EngB [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|200387738|ref|ZP_03214350.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204930344|ref|ZP_03221321.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|213162853|ref|ZP_03348563.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Typhi str.
           E00-7866]
 gi|213425461|ref|ZP_03358211.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Typhi str.
           E02-1180]
 gi|213581475|ref|ZP_03363301.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-0664]
 gi|213609177|ref|ZP_03369003.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-2068]
 gi|213650654|ref|ZP_03380707.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Typhi str.
           J185]
 gi|213852344|ref|ZP_03381876.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Typhi str.
           M223]
 gi|238913941|ref|ZP_04657778.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Tennessee
           str. CDC07-0191]
 gi|289829362|ref|ZP_06546974.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|54037056|sp|P64069|ENGB_SALTI RecName: Full=Probable GTP-binding protein EngB
 gi|54040979|sp|P64068|ENGB_SALTY RecName: Full=Probable GTP-binding protein EngB
 gi|75479463|sp|Q57HL3|ENGB_SALCH RecName: Full=Probable GTP-binding protein EngB
 gi|81599694|sp|Q5PKC6|ENGB_SALPA RecName: Full=Probable GTP-binding protein EngB
 gi|238690012|sp|B5EZX3|ENGB_SALA4 RecName: Full=Probable GTP-binding protein EngB
 gi|238690599|sp|B4TBT8|ENGB_SALHS RecName: Full=Probable GTP-binding protein EngB
 gi|238690710|sp|B4TPL2|ENGB_SALSV RecName: Full=Probable GTP-binding protein EngB
 gi|25306632|pir||AG0950 ATP/GTP-binding protein [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16422563|gb|AAL22840.1| putative GTPase involved in coordination of cell cycle [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16504736|emb|CAD03099.1| ATP/GTP-binding protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139555|gb|AAO71121.1| ATP/GTP-binding protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56130104|gb|AAV79610.1| ATP/GTP-binding protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62130096|gb|AAX67799.1| putative GTPase, involved in coordination of cell cycle [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|194406225|gb|ACF66444.1| putative GTP-binding protein EngB [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194454871|gb|EDX43710.1| putative GTP-binding protein EngB [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194712486|gb|ACF91707.1| putative GTP-binding protein EngB [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195630199|gb|EDX48839.1| putative GTP-binding protein EngB [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197215411|gb|ACH52808.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197242520|gb|EDY25140.1| putative GTP-binding protein EngB [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197289331|gb|EDY28696.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|199604836|gb|EDZ03381.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204320748|gb|EDZ05950.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205323760|gb|EDZ11599.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205327140|gb|EDZ13904.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205332795|gb|EDZ19559.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205336858|gb|EDZ23622.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205348121|gb|EDZ34752.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|267996284|gb|ACY91169.1| GTPase EngB [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|312915114|dbj|BAJ39088.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|321225285|gb|EFX50343.1| GTP-binding protein EngB [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322613071|gb|EFY10021.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322619142|gb|EFY16025.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322626008|gb|EFY22820.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322626534|gb|EFY23340.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322632355|gb|EFY29103.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322635165|gb|EFY31886.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322642758|gb|EFY39347.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322647923|gb|EFY44395.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322650673|gb|EFY47074.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322652856|gb|EFY49193.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322657171|gb|EFY53451.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322662343|gb|EFY58558.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322666878|gb|EFY63054.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322672148|gb|EFY68263.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322675870|gb|EFY71942.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322681716|gb|EFY77742.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322684091|gb|EFY80100.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|322716957|gb|EFZ08528.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323132342|gb|ADX19772.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|323193363|gb|EFZ78578.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323197720|gb|EFZ82853.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323200708|gb|EFZ85779.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323207289|gb|EFZ92241.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323211490|gb|EFZ96331.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323218465|gb|EGA03173.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323221055|gb|EGA05487.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323226030|gb|EGA10249.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323231710|gb|EGA15822.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323236043|gb|EGA20121.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323239537|gb|EGA23586.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323243871|gb|EGA27882.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323249233|gb|EGA33150.1| GTP-binding protein YsxC [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250525|gb|EGA34408.1| GTP-binding protein YsxC [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258979|gb|EGA42631.1| GTP-binding protein YsxC [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323260224|gb|EGA43847.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323265343|gb|EGA48840.1| GTP-binding protein YsxC [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270565|gb|EGA54011.1| GTP-binding protein YsxC [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|332990829|gb|AEF09812.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 210

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDCGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  VD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +  +  +   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIQWAVESNIQVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVEAFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|291085891|ref|ZP_06354360.2| hypothetical protein CIT292_08820 [Citrobacter youngae ATCC 29220]
 gi|291069529|gb|EFE07638.1| ribosome biogenesis GTP-binding protein YsxC [Citrobacter youngae
           ATCC 29220]
          Length = 215

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 107/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 16  FVMSAPDIRHLPSDSGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 75

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 76  VD---------GKRLVDLPGYGYAEVPEEMKRKWQRALAEYLEKRQSLQGLVVLMDIRHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +  +  V   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 127 LKDLDQQMILWAVESNVQVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVEAFSS 185

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 186 LKKLGVDKLRQKL 198


>gi|158321195|ref|YP_001513702.1| small GTP-binding protein [Alkaliphilus oremlandii OhILAs]
 gi|166920107|sp|A8MIS4|ENGB_ALKOO RecName: Full=Probable GTP-binding protein EngB
 gi|158141394|gb|ABW19706.1| small GTP-binding protein [Alkaliphilus oremlandii OhILAs]
          Length = 208

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/186 (38%), Positives = 108/186 (58%), Gaps = 15/186 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G PEIA +GRSNVGKSS +N ++ R+ LAR S +PG+T+ +NF++        NN  
Sbjct: 19  PENGLPEIALAGRSNVGKSSTVNTILKRRKLARVSASPGKTRTINFYIV-------NN-- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              +VD+PGYGYA+  K   ++WG ++  YLS R  L  V LL+D RH     D+ ++ +
Sbjct: 70  EFHIVDLPGYGYAKVSKGEKETWGKMMETYLSSRKNLYEVILLVDIRHEPTADDKMMYDW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEVL 202
           +        ++ TK DK+S    Q+  +    +IR      PE  +IP SS+KR+GI+ L
Sbjct: 130 IKHYGYGSIVIATKSDKISRGAYQKHFK----MIREKLGMSPEDKIIPISSLKREGIDKL 185

Query: 203 RKAILE 208
             +I E
Sbjct: 186 WHSIEE 191


>gi|78186100|ref|YP_374143.1| ribosome biogenesis GTP-binding protein YsxC [Chlorobium luteolum
           DSM 273]
 gi|119369228|sp|Q3B6D1|ENGB_PELLD RecName: Full=Probable GTP-binding protein EngB
 gi|78166002|gb|ABB23100.1| GTP-binding protein [Chlorobium luteolum DSM 273]
          Length = 207

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 101/185 (54%), Gaps = 13/185 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+R V  +  LP    PEI F+GRSNVGKSSL+N L  RK LA+TS+ PG+T+ LN+F+ 
Sbjct: 8   FIRSVSALQDLPDERVPEIVFAGRSNVGKSSLLNSLTGRKGLAKTSSTPGKTRLLNYFLI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          +  VD+PGYGYA       D+WG L+  Y+  R  +  V LL+D RH 
Sbjct: 68  ND---------DLYFVDIPGYGYAAVSHTEKDAWGRLLAGYVGGRQAIALVVLLLDSRHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
             + D+++  FL      Y IVLTK DKL+    Q+   K K +  +       ++  SS
Sbjct: 119 AMESDREMMEFLAYHDRPYGIVLTKDDKLT----QKERAKAKRVTASCALNAEFIVSYSS 174

Query: 194 VKRKG 198
           +  KG
Sbjct: 175 ISGKG 179


>gi|332667993|ref|YP_004450781.1| GTP-binding protein engB [Haliscomenobacter hydrossis DSM 1100]
 gi|332336807|gb|AEE53908.1| GTP-binding protein engB [Haliscomenobacter hydrossis DSM 1100]
          Length = 227

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 106/198 (53%), Gaps = 13/198 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F    P IG  PK   PE AF GRSNVGKSSLIN+L ++K LA TS  PG+TQ LN+++ 
Sbjct: 30  FKGSFPSIGQCPKEEWPEFAFIGRSNVGKSSLINMLCDKKELAHTSQKPGKTQLLNYYLI 89

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                         +VD+PGYGYA+  +     W  +I  YL +R +L C ++L+D    
Sbjct: 90  NQ---------QWYIVDLPGYGYAKISQSKRKEWRKMIQDYLVKRPSLCCAFVLVDSNIK 140

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ D +  ++L +  + + +V TK D+L P   +E ++  +  +  Y    P+   TS+
Sbjct: 141 PQEKDIEFINWLGEMHIPFVLVFTKTDRLKPQDIEENIKLMQEKLLEYWNELPQQFFTSA 200

Query: 194 VKRKGIEVLRKAILETIN 211
            KR G    R  IL+ I 
Sbjct: 201 SKRVG----RTEILDYIE 214


>gi|253702485|ref|YP_003023674.1| ribosome biogenesis GTP-binding protein YsxC [Geobacter sp. M21]
 gi|259645898|sp|C6E8C5|ENGB_GEOSM RecName: Full=Probable GTP-binding protein EngB
 gi|251777335|gb|ACT19916.1| small GTP-binding protein [Geobacter sp. M21]
          Length = 214

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 92/151 (60%), Gaps = 11/151 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-V 72
           F++        P+   PEIAF+GRSNVGKSSL+N+LVNRKNL RTS+ PGRTQ +NFF V
Sbjct: 8   FIKSATRPAHYPEGHLPEIAFAGRSNVGKSSLVNVLVNRKNLVRTSSTPGRTQLINFFQV 67

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
             DF           LVD+PGYGYA+ P      W  ++  YLS+R  LR V L++D R 
Sbjct: 68  NDDF----------MLVDLPGYGYAKVPLAVKKEWRPMMETYLSKRRNLRGVVLILDIRR 117

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
              + D  + ++L   +V   IV+TK DK+S
Sbjct: 118 TPTEEDLQMLTWLRAFSVPPVIVITKCDKVS 148


>gi|308233841|ref|ZP_07664578.1| small GTP-binding protein domain [Atopobium vaginae DSM 15829]
          Length = 195

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 102/185 (55%), Gaps = 13/185 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP +  PEI F GRSNVGKSSLIN L+ RK LARTS+ PG+T ++NFF          N+
Sbjct: 20  LPASTTPEIIFCGRSNVGKSSLINKLLKRKALARTSSQPGKTANINFF----------NV 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             +  VD+PGYG+A+  K   + W  LI  Y  +  +   V  LID R   +Q+D+D+ +
Sbjct: 70  DGIRFVDLPGYGFAKVSKAERERWSSLISGYFEDNRSFNLVICLIDIRIDAQQLDKDMLT 129

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           ++  + + Y +  TK DKL+ + A   L     L +       + I TS+   +G+  LR
Sbjct: 130 YVIHEELPYVVAFTKADKLTHSKA---LAARTKLCKALEVPQDKTIITSAETGEGMADLR 186

Query: 204 KAILE 208
           + I E
Sbjct: 187 RCIEE 191


>gi|293363371|ref|ZP_06610193.1| ribosome biogenesis GTP-binding protein YsxC [Mycoplasma
           alligatoris A21JP2]
 gi|292553040|gb|EFF41791.1| ribosome biogenesis GTP-binding protein YsxC [Mycoplasma
           alligatoris A21JP2]
          Length = 195

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/178 (41%), Positives = 100/178 (56%), Gaps = 12/178 (6%)

Query: 31  EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVD 90
           EI F GRSNVGKSSL+N +VN K+LAR S  PGRTQ LN+F          N     +VD
Sbjct: 21  EICFWGRSNVGKSSLLNAIVNNKSLARVSKTPGRTQLLNYF---------ENSQKQVIVD 71

Query: 91  MPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAV 150
           +PGYGYA+  K   D    +I  YL + + L+ + LLID RHG+  ID+D+  +L    +
Sbjct: 72  LPGYGYAKLSKSQKDKMLIMIDEYLQKNTRLKALILLIDSRHGITNIDRDIIKYLFSIKI 131

Query: 151 SYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILE 208
              +V TKIDKL+     +  + +K   +NY   +   I  SS  + GI+ L K I E
Sbjct: 132 PIYLVYTKIDKLNQKEKSQLSKLSKEEYKNYNCPY---IFVSSQNKFGIDALNKNIQE 186


>gi|284038921|ref|YP_003388851.1| ribosome biogenesis GTP-binding protein YsxC [Spirosoma linguale
           DSM 74]
 gi|283818214|gb|ADB40052.1| ribosome biogenesis GTP-binding protein YsxC [Spirosoma linguale
           DSM 74]
          Length = 201

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/177 (40%), Positives = 104/177 (58%), Gaps = 11/177 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PE AF GRSNVGKSSLIN+L +R +LA+ S  PG+TQ +N F+  +         
Sbjct: 19  PKPDRPEYAFIGRSNVGKSSLINMLTSRSSLAKISGKPGKTQLINHFIIDN--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  K   + +  LI  YL+ R  L C+++L+D R   +++D D  + 
Sbjct: 70  EWYLVDLPGYGYAQVSKTEREKFAALIDGYLTSRPNLLCIFVLVDSRIAPQKLDLDFMAN 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTK-YLIRNYPTAHPEVIPTSSVKRKGIE 200
           L ++ + + IV TK +KL PT  Q TLE  +  L+ ++  A P+   TS+V   G E
Sbjct: 130 LGERGLPFVIVFTKTEKLGPTKLQATLETYRDRLLEDWEEA-PQFFVTSAVTAVGRE 185


>gi|229824055|ref|ZP_04450124.1| hypothetical protein GCWU000282_01359 [Catonella morbi ATCC 51271]
 gi|229786409|gb|EEP22523.1| hypothetical protein GCWU000282_01359 [Catonella morbi ATCC 51271]
          Length = 195

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 90/151 (59%), Gaps = 9/151 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A +GRSNVGKSS IN ++ RK LARTS+ PG+TQ LNF+   D +       
Sbjct: 19  PQDALPEVALAGRSNVGKSSFINKMIGRKGLARTSSQPGKTQTLNFY---DINQ------ 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYAR  K     WG +I  YL  R  +R ++LL+D RH   ++D+ +  F
Sbjct: 70  TFRFVDVPGYGYARVSKTARAEWGKMIEHYLLNRDNVRVLFLLMDFRHEPTELDKAMKDF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTK 175
            D+  + Y I+LTK+DK+  +   + L   K
Sbjct: 130 ADEAQIPYAIILTKVDKIKKSQWNKHLSMYK 160


>gi|39998104|ref|NP_954055.1| ribosome biogenesis GTP-binding protein YsxC [Geobacter
           sulfurreducens PCA]
 gi|81831965|sp|Q748I9|ENGB_GEOSL RecName: Full=Probable GTP-binding protein EngB
 gi|39985049|gb|AAR36405.1| GTP-binding protein [Geobacter sulfurreducens PCA]
          Length = 206

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/181 (40%), Positives = 104/181 (57%), Gaps = 16/181 (8%)

Query: 22  GLLPKAGPP----EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
           G  P+  PP    EIAF GRSNVGKSSLIN+LVNRK+L RTS+ PGRTQ +NFF      
Sbjct: 13  GTRPEHYPPGDLLEIAFVGRSNVGKSSLINVLVNRKSLVRTSSTPGRTQLINFFRVNG-- 70

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                  ++ LVD+PGYG+AR P +    WG ++  YL+ RS L CV L++D R    + 
Sbjct: 71  -------SLMLVDLPGYGFARVPPEVKRQWGPMVETYLAGRSCLACVVLIVDVRRTPAEE 123

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           D+ +  +L    +   +V+TK DK+S     E  ++   + R    A  E+   S++ R+
Sbjct: 124 DRLMLQWLRAYDIPVLVVITKCDKVS---KNERAKQASLISRTLGLAPDEMAFFSALSRE 180

Query: 198 G 198
           G
Sbjct: 181 G 181


>gi|330800863|ref|XP_003288452.1| hypothetical protein DICPUDRAFT_34085 [Dictyostelium purpureum]
 gi|325081511|gb|EGC35024.1| hypothetical protein DICPUDRAFT_34085 [Dictyostelium purpureum]
          Length = 451

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 112/205 (54%), Gaps = 11/205 (5%)

Query: 3   SHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAP 62
           +++ F+K A +    +  +   PK   P++AF G+SN GKSSL+N ++NR ++A  S  P
Sbjct: 187 ANSFFSKGASLDSMAIKGVDF-PKKSYPQVAFLGKSNAGKSSLLNAILNR-DMAYVSKKP 244

Query: 63  GRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLR 122
           G T+ +NF+              + LVD+PGYG+A+  KK    WG  I  YL     L 
Sbjct: 245 GCTKSINFYQL---------WEKIYLVDLPGYGFAKVSKKKSSVWGEAISEYLLTTPNLF 295

Query: 123 CVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP 182
            ++LLID R G+ + D +    +D+  VS+QIVLTKIDK  P+  +    + K +I    
Sbjct: 296 KIFLLIDSRIGIHKNDIEAIELIDQHKVSFQIVLTKIDKTKPSILKGIYNQLKDIINETS 355

Query: 183 TAHPEVIPTSSVKRKGIEVLRKAIL 207
              P +I TS+++  G+  +R  IL
Sbjct: 356 CCLPTIIQTSALESSGLNEIRSVIL 380


>gi|71274790|ref|ZP_00651078.1| GTP-binding protein, HSR1-related [Xylella fastidiosa Dixon]
 gi|71901070|ref|ZP_00683179.1| GTP-binding protein, HSR1-related [Xylella fastidiosa Ann-1]
 gi|170729963|ref|YP_001775396.1| ribosome biogenesis GTP-binding protein YsxC [Xylella fastidiosa
           M12]
 gi|71164522|gb|EAO14236.1| GTP-binding protein, HSR1-related [Xylella fastidiosa Dixon]
 gi|71729152|gb|EAO31274.1| GTP-binding protein, HSR1-related [Xylella fastidiosa Ann-1]
 gi|167964756|gb|ACA11766.1| GTP-binding protein [Xylella fastidiosa M12]
          Length = 219

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 102/193 (52%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           +L     I  LP     E+AF+GRSN GKSS++N L  +  LAR S  PGRTQ L +F  
Sbjct: 26  YLLSAHTIHQLPSDDGSEVAFAGRSNAGKSSVLNTLTRQNALARVSKTPGRTQQLVYFTV 85

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P   LVD+PGYGYA+ PK+    W   I  Y  +R  LR + +++D RH 
Sbjct: 86  T---------PQRYLVDLPGYGYAKVPKELQIHWQTFIDSYFHQRQALRGLVVVMDIRHP 136

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K+ D  + ++  ++ +  Q +LTK DKL      +TL+K +  +  +   H ++   SS
Sbjct: 137 LKEYDLQMLAYARQRGLPAQALLTKADKLGRGQQAQTLQKVRNELTKHFADHIDIQTFSS 196

Query: 194 VKRKGIEVLRKAI 206
             R+G+E L   I
Sbjct: 197 KSRQGVEQLHTVI 209


>gi|298507043|gb|ADI85766.1| GTPase EngB [Geobacter sulfurreducens KN400]
          Length = 206

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/181 (40%), Positives = 104/181 (57%), Gaps = 16/181 (8%)

Query: 22  GLLPKAGPP----EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
           G  P+  PP    EIAF GRSNVGKSSLIN+LVNRK+L RTS+ PGRTQ +NFF      
Sbjct: 13  GTRPEHYPPGDLLEIAFVGRSNVGKSSLINVLVNRKSLVRTSSTPGRTQLINFFRVNG-- 70

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                  ++ LVD+PGYG+AR P +    WG ++  YL+ RS L CV L++D R    + 
Sbjct: 71  -------SLMLVDLPGYGFARVPPEVKRQWGPMVETYLAGRSCLACVVLIVDVRRTPAEE 123

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           D+ +  +L    +   +V+TK DK+S     E  ++   + R    A  E+   S++ R+
Sbjct: 124 DRLMLQWLRAYDIPVLVVITKCDKVS---KNERAKQASLISRTLGLAPDEMAFFSALSRE 180

Query: 198 G 198
           G
Sbjct: 181 G 181


>gi|261342937|ref|ZP_05970795.1| hypothetical protein ENTCAN_09535 [Enterobacter cancerogenus ATCC
           35316]
 gi|288314685|gb|EFC53623.1| ribosome biogenesis GTP-binding protein YsxC [Enterobacter
           cancerogenus ATCC 35316]
          Length = 209

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 111/193 (57%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVTSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            LVD+PGYGYA+ P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 71  AE---------GKRLVDLPGYGYAQVPEEMKIKWQRALGEYLEKRLCLKGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ + ++  +  ++  ++LTK DKL+    +  +   +  +  +     +V P SS
Sbjct: 122 LKDLDQQMIAWAVESDIAVLVLLTKADKLASGARKAQVNMVREAVLAF-NGDVQVEPFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|118581676|ref|YP_902926.1| ribosome biogenesis GTP-binding protein YsxC [Pelobacter
           propionicus DSM 2379]
 gi|166225967|sp|A1AU48|ENGB_PELPD RecName: Full=Probable GTP-binding protein EngB
 gi|118504386|gb|ABL00869.1| small GTP-binding protein [Pelobacter propionicus DSM 2379]
          Length = 200

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/178 (41%), Positives = 102/178 (57%), Gaps = 12/178 (6%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
           PE+AF GRSNVGKSSLIN+L NRK+L RTS+ PGRTQ +NFF   D + +      + LV
Sbjct: 24  PEVAFVGRSNVGKSSLINVLANRKSLVRTSSTPGRTQLINFF---DINGV------LTLV 74

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYGYA+AP      WG +I  YL+ R  LR V L++D R      D  +  +L+   
Sbjct: 75  DLPGYGYAKAPPDVRKQWGPMIETYLARRGNLRAVVLILDIRRIPSDGDLQMLGWLETYD 134

Query: 150 VSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAIL 207
           +    VLTK DKLS     E  ++T  +         E++  S++ R G + + K +L
Sbjct: 135 IPPIFVLTKCDKLSKV---ERAKQTALIASAIKRDRNELLHFSALSRDGRDAVWKEVL 189


>gi|238650566|ref|YP_002916418.1| GTPase EngB [Rickettsia peacockii str. Rustic]
 gi|259645906|sp|C4K1B9|ENGB_RICPU RecName: Full=Probable GTP-binding protein EngB
 gi|238624664|gb|ACR47370.1| GTPase EngB [Rickettsia peacockii str. Rustic]
          Length = 212

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 86/150 (57%), Gaps = 9/150 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  +P    PEIAF G+SNVGKSSLIN + N KNLA+ SN  GRT+ +NFF  
Sbjct: 24  FVAGAMNINQIPNFSLPEIAFVGKSNVGKSSLINTICNNKNLAKVSNTAGRTRQINFFNL 83

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A  P    + WG LI  YL     LR V LLID R G
Sbjct: 84  AD---------KLIIVDLPGYGFANVPISVKEQWGVLISYYLRNSYNLRLVNLLIDSRRG 134

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
           +K+ D+ V   L      +QI+ TK DK++
Sbjct: 135 IKENDKKVADLLLANKREFQIIFTKSDKVT 164


>gi|168335351|ref|ZP_02693446.1| GTPase EngB [Epulopiscium sp. 'N.t. morphotype B']
          Length = 196

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 106/177 (59%), Gaps = 11/177 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
            P     EIAF+G+SNVGKSSLIN+L+NRK LARTS+ PG+TQ +NF+  +D  N     
Sbjct: 18  FPDNNQIEIAFAGKSNVGKSSLINVLINRKALARTSSTPGKTQTINFYNIQDKFN----- 72

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
                VD+PGYGYA+  K   +SWG  I  YL +RS+L+ V LLID RH   + D+ +++
Sbjct: 73  ----FVDLPGYGYAKVSKTLRESWGKFIEDYLGKRSSLKQVVLLIDIRHAPSENDKLMYN 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
           ++     +  +V TK+DK+  +   + +   K +++   T    +IP S+  + G E
Sbjct: 129 WISFFHDNVLVVATKVDKIKRSQIAKHISIIKSVLQLRTT--DRIIPFSAATKVGKE 183


>gi|54293086|ref|YP_125501.1| GTPase EngB [Legionella pneumophila str. Lens]
 gi|54296120|ref|YP_122489.1| ribosome biogenesis GTP-binding protein YsxC [Legionella
           pneumophila str. Paris]
 gi|81601577|sp|Q5X097|ENGB_LEGPL RecName: Full=Probable GTP-binding protein EngB
 gi|81602058|sp|Q5X8V4|ENGB_LEGPA RecName: Full=Probable GTP-binding protein EngB
 gi|53749905|emb|CAH11287.1| hypothetical protein lpp0139 [Legionella pneumophila str. Paris]
 gi|53752918|emb|CAH14354.1| hypothetical protein lpl0124 [Legionella pneumophila str. Lens]
 gi|307608869|emb|CBW98267.1| hypothetical protein LPW_01251 [Legionella pneumophila 130b]
          Length = 200

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/193 (37%), Positives = 104/193 (53%), Gaps = 16/193 (8%)

Query: 13  IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           +FL+    +  LP+    E+AF+GRSN GKSS +N L N KNLARTS  PGRTQ +N F 
Sbjct: 10  VFLKSAARVNQLPEDSGYEVAFAGRSNAGKSSALNCLTNNKNLARTSKTPGRTQLINLFS 69

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
             +            LVD+PGYGYA+   +    W   +  YL  R  LR + LL+D RH
Sbjct: 70  LDE---------QRRLVDLPGYGYAKVAMEVKLEWQKNLAHYLEARQCLRGLILLMDVRH 120

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT- 191
            +K +DQ + ++   + +   I+LTK DKLS +  +  + K    +R Y      ++   
Sbjct: 121 PLKDLDQILVNWALHRELPVHILLTKADKLSRSEVKNAVLK----VRQYYELAEHLVSVQ 176

Query: 192 --SSVKRKGIEVL 202
             SSVK+ G+E L
Sbjct: 177 AFSSVKKDGVEEL 189


>gi|89092189|ref|ZP_01165143.1| hypothetical protein MED92_05238 [Oceanospirillum sp. MED92]
 gi|89083277|gb|EAR62495.1| hypothetical protein MED92_05238 [Oceanospirillum sp. MED92]
          Length = 218

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 106/190 (55%), Gaps = 8/190 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F +   ++   P+    E+AF+GRSN GKSS IN L N   LARTS  PGRTQ +NFF  
Sbjct: 15  FNKSAAKLHQCPEDIGAEVAFAGRSNAGKSSAINTLTNNGKLARTSKTPGRTQLINFF-- 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D      NL  + LVD+PGYGYA+ P +    W   +  YL +R  L+ V L++D RH 
Sbjct: 73  -DL-----NLEGVRLVDLPGYGYAKVPVEMKVHWQKHLGEYLEKRQCLQGVVLVMDIRHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K+ DQ +  + +   +   ++LTK DKL    AQ T+ K +  ++        V   S+
Sbjct: 127 MKEFDQMMVEWCENSQMPLHVLLTKADKLKKGPAQSTMLKLRKELQAVLGDLVTVQTFSA 186

Query: 194 VKRKGIEVLR 203
           +K++G++ LR
Sbjct: 187 LKKQGVDQLR 196


>gi|328865389|gb|EGG13775.1| hypothetical protein DFA_11536 [Dictyostelium fasciculatum]
          Length = 453

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 101/179 (56%), Gaps = 10/179 (5%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
           P+IAF GRSNVGKSSL+N L+  + LA  S  PG TQ +NF+   D          + LV
Sbjct: 229 PQIAFLGRSNVGKSSLLNALLGNQ-LANVSKTPGCTQSVNFYSIWD---------KLMLV 278

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYGY++  K     WG  I  +L     L  ++LLID R G ++ D +V   LD   
Sbjct: 279 DLPGYGYSKVSKDKAAVWGRSISEFLITSPHLIKLFLLIDSRIGCQKNDLEVMKLLDDHR 338

Query: 150 VSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILE 208
           V++QIVLTK+DK +P   +      K  I +  +  P V+  SS++ KGI+ +R  IL+
Sbjct: 339 VAFQIVLTKVDKTTPNALKRIYRTLKETINDNVSCLPNVLQCSSIEMKGIQQIRSIILD 397


>gi|330831500|ref|YP_004394452.1| GTPase EngB [Aeromonas veronii B565]
 gi|328806636|gb|AEB51835.1| GTPase EngB [Aeromonas veronii B565]
          Length = 205

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 104/194 (53%), Gaps = 10/194 (5%)

Query: 15  LRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPK 74
           +   P+I  LP  G  EIAF+GRSN GKSS +N L   KNLARTS  PGRTQ +N F  +
Sbjct: 1   MTSAPDIRHLPNDGGVEIAFAGRSNAGKSSALNTLTKHKNLARTSKTPGRTQLINLFELE 60

Query: 75  DFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGV 134
                    P   LVD+PGYGYA+ P +    W   +  YL  R +L+ + +L+D RH +
Sbjct: 61  ---------PGKRLVDLPGYGYAQVPLEMKLKWQKSLAEYLQRRESLKGLVILMDIRHPL 111

Query: 135 KQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSV 194
           K  D ++  +   + +   ++LTK DKLSP      + K +  + N   +  +V   SS+
Sbjct: 112 KDTDMNMLEWSSHRQLPVMLLLTKADKLSPGPRNNQVIKVRQAVANL-GSQIQVEAFSSL 170

Query: 195 KRKGIEVLRKAILE 208
              G+E L + + E
Sbjct: 171 TNIGVEKLAQTLTE 184


>gi|154707542|ref|YP_001423657.1| ribosome biogenesis GTP-binding protein YsxC [Coxiella burnetii
           Dugway 5J108-111]
 gi|165919241|ref|ZP_02219327.1| GTP-binding protein [Coxiella burnetii RSA 334]
 gi|212211813|ref|YP_002302749.1| ribosome biogenesis GTP-binding protein YsxC [Coxiella burnetii
           CbuG_Q212]
 gi|189037175|sp|A9KBW2|ENGB_COXBN RecName: Full=Probable GTP-binding protein EngB
 gi|238058982|sp|B6J2X4|ENGB_COXB2 RecName: Full=Probable GTP-binding protein EngB
 gi|154356828|gb|ABS78290.1| GTP-binding protein [Coxiella burnetii Dugway 5J108-111]
 gi|165917035|gb|EDR35639.1| GTP-binding protein [Coxiella burnetii RSA 334]
 gi|212010223|gb|ACJ17604.1| GTP-binding protein [Coxiella burnetii CbuG_Q212]
          Length = 205

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 94/168 (55%), Gaps = 9/168 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           +L    E   LP     EIAF GRSN GKSS +NI+   K LARTS  PGRTQ +NFF  
Sbjct: 15  YLTSAAEFDQLPPDQGAEIAFIGRSNAGKSSALNIITGIKGLARTSKTPGRTQMINFFAL 74

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +   L         VD+PGYGYA+ P+     W  L+  YL +R  L+ + +++D RH 
Sbjct: 75  NEHERL---------VDLPGYGYAKVPRMVQKRWEELVDSYLKKRRCLKGLVVVMDIRHP 125

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY 181
           +K++D+DV  +     +   I+LTK DKLS   A++TL + +  I  Y
Sbjct: 126 LKEMDEDVIEWAVNYDIPIHILLTKSDKLSQNAAKKTLGEVQTAISAY 173


>gi|309388897|gb|ADO76777.1| ribosome biogenesis GTP-binding protein YsxC [Halanaerobium
           praevalens DSM 2228]
          Length = 199

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 90/150 (60%), Gaps = 9/150 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F + V +    P+   PE+AFSGRSNVGKSSLIN +  +K LARTSN PGRTQ LN+F  
Sbjct: 8   FYKSVYKYEDCPRLQQPEVAFSGRSNVGKSSLINRMTKQKKLARTSNTPGRTQCLNYFNV 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYG+A  P+K  D W  LI  YL+ R  L  V  +ID RH 
Sbjct: 68  DD---------KFYLVDLPGYGFANVPQKVKDDWAELIDTYLNYRENLVGVVQIIDSRHK 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
             + D+ + ++L    +++ IV TK+DK+S
Sbjct: 119 PTKDDKLMVNWLQASGLNFLIVATKVDKIS 148


>gi|222152936|ref|YP_002562113.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus uberis
           0140J]
 gi|254783213|sp|B9DU74|ENGB_STRU0 RecName: Full=Probable GTP-binding protein EngB
 gi|222113749|emb|CAR41756.1| putative GTP-binding protein [Streptococcus uberis 0140J]
          Length = 199

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/188 (42%), Positives = 99/188 (52%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+ RKNLARTS  PG+TQ LNFF   D         
Sbjct: 25  PEDDIPEIALAGRSNVGKSSFINTLLGRKNLARTSGKPGKTQLLNFFNIDD--------- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 76  KIRFVDVPGYGYAKVSKVERARWGKMIEEYLTSRDNLRAVVSLVDLRHEPSTEDVQMYEF 135

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E++ K K    N+       I  SSV R GI+  
Sbjct: 136 LKYYEIPVIVVATKADKIPRGKWNKHESMIKKKL---NFEQEDA-FILFSSVDRIGIDQA 191

Query: 203 RKAILETI 210
             AILE I
Sbjct: 192 WDAILEQI 199


>gi|52840380|ref|YP_094179.1| ribosome biogenesis GTP-binding protein YsxC [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|148358283|ref|YP_001249490.1| GTP binding protein EngB [Legionella pneumophila str. Corby]
 gi|296105634|ref|YP_003617334.1| GTP binding protein EngB [Legionella pneumophila 2300/99 Alcoy]
 gi|81603580|sp|Q5ZZ86|ENGB_LEGPH RecName: Full=Probable GTP-binding protein EngB
 gi|166225963|sp|A5I9U4|ENGB_LEGPC RecName: Full=Probable GTP-binding protein EngB
 gi|52627491|gb|AAU26232.1| GTP binding protein EngB [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|148280056|gb|ABQ54144.1| GTP binding protein EngB [Legionella pneumophila str. Corby]
 gi|295647535|gb|ADG23382.1| GTP binding protein EngB [Legionella pneumophila 2300/99 Alcoy]
          Length = 200

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/193 (37%), Positives = 104/193 (53%), Gaps = 16/193 (8%)

Query: 13  IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           +FL+    +  LP+    E+AF+GRSN GKSS +N L N KNLARTS  PGRTQ +N F 
Sbjct: 10  VFLKSAARVNQLPEDSGYEVAFAGRSNAGKSSALNCLTNNKNLARTSKTPGRTQLINLFS 69

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
             +            LVD+PGYGYA+   +    W   +  YL  R  LR + LL+D RH
Sbjct: 70  LDE---------QRRLVDLPGYGYAKVAMEVKLEWQKNLAHYLEARQCLRGLILLMDVRH 120

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT- 191
            +K +DQ + ++   + +   I+LTK DKLS +  +  + K    +R Y      ++   
Sbjct: 121 PLKDLDQILVNWALHRELPVHILLTKADKLSRSEVKNAVLK----VRQYYELAEHLVSVQ 176

Query: 192 --SSVKRKGIEVL 202
             SSVK+ G+E L
Sbjct: 177 AFSSVKKDGVEEL 189


>gi|323703639|ref|ZP_08115282.1| ribosome biogenesis GTP-binding protein YsxC [Desulfotomaculum
           nigrificans DSM 574]
 gi|323531411|gb|EGB21307.1| ribosome biogenesis GTP-binding protein YsxC [Desulfotomaculum
           nigrificans DSM 574]
          Length = 197

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 88/142 (61%), Gaps = 9/142 (6%)

Query: 22  GLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN 81
           G  P    PE+AF GRSNVGKSSLIN LVNR+ LA+TS+ PGRTQ +NFF       + N
Sbjct: 16  GGYPPEDLPEVAFVGRSNVGKSSLINKLVNRRGLAKTSSTPGRTQLINFF------KVNN 69

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDV 141
                 LVD+PGYG+A+ P+     WG +I  YL  R +L+ V+ L+DCRH     D+ +
Sbjct: 70  RF---LLVDLPGYGFAKVPETVRAKWGQMIEGYLKNRESLKGVFQLVDCRHTPTVQDRQM 126

Query: 142 FSFLDKKAVSYQIVLTKIDKLS 163
           + +L    V   +V TK+DKLS
Sbjct: 127 YEWLLHYQVPTVVVATKVDKLS 148


>gi|125973114|ref|YP_001037024.1| GTP-binding protein [Clostridium thermocellum ATCC 27405]
 gi|256003908|ref|ZP_05428894.1| GTP-binding protein HSR1-related protein [Clostridium thermocellum
           DSM 2360]
 gi|281417306|ref|ZP_06248326.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium
           thermocellum JW20]
 gi|125713339|gb|ABN51831.1| GTP-binding protein [Clostridium thermocellum ATCC 27405]
 gi|255992036|gb|EEU02132.1| GTP-binding protein HSR1-related protein [Clostridium thermocellum
           DSM 2360]
 gi|281408708|gb|EFB38966.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium
           thermocellum JW20]
 gi|316940660|gb|ADU74694.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium
           thermocellum DSM 1313]
          Length = 207

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/184 (39%), Positives = 105/184 (57%), Gaps = 11/184 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PEI F GRSNVGKSSLIN ++NRKNLA+ +  PGRT+ +NF+      N+ + L 
Sbjct: 25  PKNDLPEITFVGRSNVGKSSLINTMLNRKNLAKVAATPGRTRVINFY------NIDDKL- 77

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYG+A+ PK     W  +I  YL ER  L+ V +L+D RH     D  +  +
Sbjct: 78  --YFVDLPGYGFAKVPKTMKTGWKDIIETYLIERKQLKKVIMLVDIRHSPTSDDVLMHEW 135

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L     SY +V TK+DK+  T  +E +   + +++       ++IP SS  R+G + L  
Sbjct: 136 LKAMRKSYVVVATKLDKIPRTKIKERISDIRSILKLEDDV--KIIPFSSETRQGRDELWD 193

Query: 205 AILE 208
            IL+
Sbjct: 194 EILD 197


>gi|289422733|ref|ZP_06424573.1| ribosome biogenesis GTP-binding protein YsxC [Peptostreptococcus
           anaerobius 653-L]
 gi|289156912|gb|EFD05537.1| ribosome biogenesis GTP-binding protein YsxC [Peptostreptococcus
           anaerobius 653-L]
          Length = 259

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/186 (38%), Positives = 106/186 (56%), Gaps = 15/186 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA +GRSNVGKSS+IN L++RKN ARTS+ PG+T+ +NF++  +         
Sbjct: 71  PGEGIPEIALAGRSNVGKSSVINGLLSRKNFARTSSTPGKTRTINFYLINE--------- 121

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K   + WG ++  YLS+R  L  ++LL+DCRH     D+ ++ +
Sbjct: 122 EFYFVDLPGYGYAKVAKTEKEKWGAIMEMYLSDRRELCAIFLLVDCRHEPTADDKMMYEW 181

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEVL 202
           +     +  +V TK DK+S    Q    K   +IR       E  +I TSS    G++VL
Sbjct: 182 IKHFGYNCVVVATKADKISRGQYQ----KHTSIIRKKLEMAKEDKIILTSSSSNVGMKVL 237

Query: 203 RKAILE 208
              I++
Sbjct: 238 WDEIVD 243


>gi|260101783|ref|ZP_05752020.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           helveticus DSM 20075]
 gi|260084427|gb|EEW68547.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           helveticus DSM 20075]
          Length = 196

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/187 (41%), Positives = 106/187 (56%), Gaps = 12/187 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PEIA SGRSNVGKSSLIN L+NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PKDNLPEIALSGRSNVGKSSLINTLLNRKNLARTSSQPGKTQTLNFYLIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYAR  +K    +G +I  YL  R  L+ + +LID RH   + D  ++++
Sbjct: 70  EFYLVDVPGYGYARVSQKKRQEFGEMIQDYLETRPNLKGLVILIDSRHEPTKDDIAMYNY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR-NYPTAHPEVIPTSSVKRKGIEVLR 203
                +   +V TKIDK+  +   + + + K  I  NY   +  V+  SSV +  +  L 
Sbjct: 130 AQYLNLPILVVCTKIDKIKKSQVNKAMSRLKKNIDLNYD--YVTVLTFSSVTKLHVAELG 187

Query: 204 KAILETI 210
             I E I
Sbjct: 188 NWIEEKI 194


>gi|161507350|ref|YP_001577304.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           helveticus DPC 4571]
 gi|172048268|sp|A8YUS5|ENGB_LACH4 RecName: Full=Probable GTP-binding protein EngB
 gi|160348339|gb|ABX27013.1| GTP-binding protein [Lactobacillus helveticus DPC 4571]
          Length = 196

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/187 (41%), Positives = 106/187 (56%), Gaps = 12/187 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PEIA SGRSNVGKSSLIN L+NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PKDNLPEIALSGRSNVGKSSLINTLLNRKNLARTSSQPGKTQTLNFYLIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYAR  +K    +G +I  YL  R  L+ + +LID RH   + D  ++++
Sbjct: 70  EFYLVDVPGYGYARVSQKKRQEFGEMIQDYLETRPNLKGLVILIDSRHEPTKDDIAMYNY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR-NYPTAHPEVIPTSSVKRKGIEVLR 203
                +   +V TKIDK+  +   + + + K  I  NY   +  V+  SSV +  +  L 
Sbjct: 130 AQYLNLPILVVCTKIDKIKKSQVNKVMSRLKKNIDLNYD--YVTVLTFSSVTKLHVAELG 187

Query: 204 KAILETI 210
             I E I
Sbjct: 188 NWIEEKI 194


>gi|224585811|ref|YP_002639610.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|254783207|sp|C0Q3G7|ENGB_SALPC RecName: Full=Probable GTP-binding protein EngB
 gi|224470339|gb|ACN48169.1| GTP-binding protein [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 210

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDCGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  VD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRRSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +  +  +   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIQWAVESNIQVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVEAFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|308274309|emb|CBX30908.1| Probable GTP-binding protein engB [uncultured Desulfobacterium sp.]
          Length = 202

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 91/152 (59%), Gaps = 9/152 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++   +    P+   PEIAF+GRSNVGKSSLIN L+NRKNL +TS+ PGRTQ +NFF+ 
Sbjct: 8   FVKSAVKPSQYPEESQPEIAFAGRSNVGKSSLINTLLNRKNLVKTSSTPGRTQLINFFLI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          +  VD+PGYGYA+ P     +WG +I  Y+  R TL+ V L++D R  
Sbjct: 68  ND---------TLGFVDIPGYGYAKVPAAVRKTWGTMIETYIQTRKTLKGVVLILDLRRI 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPT 165
               +     +L+   + + +VLTK DKLS T
Sbjct: 119 PGPEEITFMDWLNYYNIPFILVLTKADKLSKT 150


>gi|28378737|ref|NP_785629.1| GTPase EngB [Lactobacillus plantarum WCFS1]
 gi|254556940|ref|YP_003063357.1| GTPase EngB [Lactobacillus plantarum JDM1]
 gi|300768255|ref|ZP_07078160.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           plantarum subsp. plantarum ATCC 14917]
 gi|308180929|ref|YP_003925057.1| GTPase EngB [Lactobacillus plantarum subsp. plantarum ST-III]
 gi|38257507|sp|Q88VE3|ENGB_LACPL RecName: Full=Probable GTP-binding protein EngB
 gi|28271574|emb|CAD64479.1| GTP-binding protein [Lactobacillus plantarum WCFS1]
 gi|254045867|gb|ACT62660.1| GTPase EngB [Lactobacillus plantarum JDM1]
 gi|300494319|gb|EFK29482.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           plantarum subsp. plantarum ATCC 14917]
 gi|308046420|gb|ADN98963.1| GTPase EngB [Lactobacillus plantarum subsp. plantarum ST-III]
          Length = 197

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 86/138 (62%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEI  +GRSNVGKSSLIN+L+NR + ARTS+ PG+TQ LNF+  +D         
Sbjct: 19  PTTGFPEIGLAGRSNVGKSSLINVLINRNSYARTSSQPGKTQTLNFYKVED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  KK  + WG +I  YL+ R TLR V +L+D RH   + D  ++ +
Sbjct: 70  QLYFVDVPGYGYAKVSKKEREKWGQMIETYLTSRETLRGVVILVDARHAPTKDDVAMYEW 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           +    +   +V TK DK+
Sbjct: 130 MRYYEMPLLVVATKSDKI 147


>gi|257884403|ref|ZP_05664056.1| GTP-binding protein [Enterococcus faecium 1,231,501]
 gi|257820241|gb|EEV47389.1| GTP-binding protein [Enterococcus faecium 1,231,501]
          Length = 195

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 84/138 (60%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L++RKNLARTS  PG+TQ LNF++ ++         
Sbjct: 19  PETQLPEIALAGRSNVGKSSFINTLIDRKNLARTSGKPGKTQTLNFYLIEN--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+  VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   Q D  ++ F
Sbjct: 70  ALHFVDVPGYGYAKVSKTERAKWGKMIETYLTTREQLRAVVSLVDLRHKPSQEDIQMYQF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   +V TK DK+
Sbjct: 130 LKYYDIPVIVVATKADKI 147


>gi|295425158|ref|ZP_06817863.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           amylolyticus DSM 11664]
 gi|295065217|gb|EFG56120.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           amylolyticus DSM 11664]
          Length = 196

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 68/139 (48%), Positives = 88/139 (63%), Gaps = 11/139 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-VPKDFSNLKNNL 83
           PK   PEIA +GRSNVGKSSLIN LVNRKNLARTS+ PG+TQ LNF+ V K F       
Sbjct: 19  PKDDLPEIALAGRSNVGKSSLINTLVNRKNLARTSSQPGKTQTLNFYLVNKSF------- 71

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYA+  +K    +G +I  YL  R+ L+ + +L+D RH   + DQ ++ 
Sbjct: 72  ---YLVDVPGYGYAKVSQKKRQEFGEMIQDYLETRANLKGLIILVDSRHVPSKDDQSMYE 128

Query: 144 FLDKKAVSYQIVLTKIDKL 162
           +     +   +V TKIDKL
Sbjct: 129 YAQYLNLPILVVCTKIDKL 147


>gi|150008077|ref|YP_001302820.1| ribosome biogenesis GTP-binding protein YsxC [Parabacteroides
           distasonis ATCC 8503]
 gi|255014915|ref|ZP_05287041.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp.
           2_1_7]
 gi|256840744|ref|ZP_05546252.1| ribosome biogenesis GTP-binding protein YsxC [Parabacteroides sp.
           D13]
 gi|262381349|ref|ZP_06074487.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp.
           2_1_33B]
 gi|298376570|ref|ZP_06986525.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp.
           3_1_19]
 gi|166225966|sp|A6LBY4|ENGB_PARD8 RecName: Full=Probable GTP-binding protein EngB
 gi|149936501|gb|ABR43198.1| GTP-binding protein [Parabacteroides distasonis ATCC 8503]
 gi|256738016|gb|EEU51342.1| ribosome biogenesis GTP-binding protein YsxC [Parabacteroides sp.
           D13]
 gi|262296526|gb|EEY84456.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp.
           2_1_33B]
 gi|298266448|gb|EFI08106.1| ribosome biogenesis GTP-binding protein YsxC [Bacteroides sp.
           3_1_19]
          Length = 200

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 109/187 (58%), Gaps = 15/187 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE AF GRSNVGKSSLIN+L N+K LA TS  PG+T  +N F       L NN  
Sbjct: 19  PEGNKPEYAFIGRSNVGKSSLINMLTNKKGLAMTSQTPGKTLLINHF-------LINN-- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYG+A+  K+N +    +I  Y+ +R  L  +++L+DCRH  ++ID +   +
Sbjct: 70  EWYLVDLPGYGFAQRGKENREQLKRIIENYILDREQLTNLFVLLDCRHEAQKIDLEFMEW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLE-KTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           L +  V + I+ TKIDK+S    +E L+  T  L+  +    P +  +SS K++G    R
Sbjct: 130 LGESGVPFSIIFTKIDKISKGRLKENLKVYTDKLLETWEELPP-IFLSSSEKKEG----R 184

Query: 204 KAILETI 210
             IL+ I
Sbjct: 185 DEILDYI 191


>gi|227551677|ref|ZP_03981726.1| GTPase [Enterococcus faecium TX1330]
 gi|257895723|ref|ZP_05675376.1| GTP-binding protein [Enterococcus faecium Com12]
 gi|293377668|ref|ZP_06623857.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           PC4.1]
 gi|293571861|ref|ZP_06682877.1| GTP-binding protein [Enterococcus faecium E980]
 gi|227179240|gb|EEI60212.1| GTPase [Enterococcus faecium TX1330]
 gi|257832288|gb|EEV58709.1| GTP-binding protein [Enterococcus faecium Com12]
 gi|291608115|gb|EFF37421.1| GTP-binding protein [Enterococcus faecium E980]
 gi|292643668|gb|EFF61789.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           PC4.1]
          Length = 195

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 84/138 (60%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L++RKNLARTS  PG+TQ LNF++ ++         
Sbjct: 19  PETQLPEIALAGRSNVGKSSFINTLIDRKNLARTSGKPGKTQTLNFYLIEN--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+  VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   Q D  ++ F
Sbjct: 70  ALHFVDVPGYGYAKVSKTERAKWGKMIETYLTTREQLRAVVSLVDLRHKPSQEDIQMYQF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   +V TK DK+
Sbjct: 130 LKYYDIPVIVVATKADKI 147


>gi|157964167|ref|YP_001498991.1| ribosome biogenesis GTP-binding protein YsxC [Rickettsia massiliae
           MTU5]
 gi|157843943|gb|ABV84444.1| Hypothetical GTP-binding protein [Rickettsia massiliae MTU5]
          Length = 213

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 86/150 (57%), Gaps = 9/150 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  +     PEIAF G+SNVGKSSLIN + N KNLA+ SN PGRT+ +NFF  
Sbjct: 25  FVAGAMNINQILNFSLPEIAFVGKSNVGKSSLINTICNNKNLAKVSNTPGRTRQINFFNL 84

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A  P    + WG LI  YL     LR V LLID R G
Sbjct: 85  AD---------KLIIVDLPGYGFANVPISVKEQWGVLISYYLRNSYNLRLVNLLIDSRRG 135

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
           +K+ D+ V   L      +QI+ TK DK++
Sbjct: 136 IKENDKKVADLLLANKREFQIIFTKSDKVT 165


>gi|118602244|ref|YP_903459.1| ribosome biogenesis GTP-binding protein YsxC [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|166225977|sp|A1AVN1|ENGB_RUTMC RecName: Full=Probable GTP-binding protein EngB
 gi|118567183|gb|ABL01988.1| cell division checkpoint GTPase YihA [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
          Length = 199

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 102/190 (53%), Gaps = 13/190 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-V 72
           FL   P +   P     E+ F+GRSN GKSS+IN L  +  LA+ S  PG+TQH  FF +
Sbjct: 10  FLLSCPSLKGCPPDEGYEVIFAGRSNAGKSSVINTLTLQNKLAKVSRTPGKTQHFVFFEL 69

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
            KD            LVD+PGYGYA+ PK+    W   I  Y ++R  LR   L++D RH
Sbjct: 70  DKD----------RRLVDLPGYGYAKVPKRVKTKWHKDINEYFNKRDCLRGTVLVMDIRH 119

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
             K  DQ V ++     +S QI+LTK DKL    A  T  K    I+ YP    ++   S
Sbjct: 120 PFKLFDQMVLNWCHSINLSTQIILTKSDKLKKGAASNTYLKVHNQIKKYPYVDVQLF--S 177

Query: 193 SVKRKGIEVL 202
           S+K++G+E+L
Sbjct: 178 SLKKQGLEIL 187


>gi|139438420|ref|ZP_01771936.1| Hypothetical protein COLAER_00926 [Collinsella aerofaciens ATCC
           25986]
 gi|133775959|gb|EBA39779.1| Hypothetical protein COLAER_00926 [Collinsella aerofaciens ATCC
           25986]
          Length = 196

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 103/196 (52%), Gaps = 13/196 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    ++  +P++  PE++F GRSNVGKSS++N L  RKNL + S+ PG+T ++NFF  
Sbjct: 12  FVASYGKVSQIPESTCPEVSFVGRSNVGKSSIMNKLFGRKNLVKVSSTPGKTSNINFFEA 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          +  VD+PGYG+AR  K   D W  LI  +     +   V  L+D RH 
Sbjct: 72  DD----------VHFVDLPGYGFARRSKAERDRWAELIGDFFDSERSFNLVVSLVDIRHD 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
             ++D D+  +L     ++ + LTK DKLS T         K  + N P  +  VI TSS
Sbjct: 122 PSKLDHDMIDYLQGNEFNFIVCLTKADKLSRTQQARQAAAIKKQL-NVPAEN--VIITSS 178

Query: 194 VKRKGIEVLRKAILET 209
               GI+ L+K I E 
Sbjct: 179 QTGTGIDELKKRIAEA 194


>gi|257898294|ref|ZP_05677947.1| GTP-binding protein [Enterococcus faecium Com15]
 gi|293557137|ref|ZP_06675691.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           E1039]
 gi|294614148|ref|ZP_06694069.1| GTP-binding protein [Enterococcus faecium E1636]
 gi|257836206|gb|EEV61280.1| GTP-binding protein [Enterococcus faecium Com15]
 gi|291592998|gb|EFF24586.1| GTP-binding protein [Enterococcus faecium E1636]
 gi|291600706|gb|EFF31004.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           E1039]
          Length = 195

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 84/138 (60%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L++RKNLARTS  PG+TQ LNF++ ++         
Sbjct: 19  PETQLPEIALAGRSNVGKSSFINTLIDRKNLARTSGKPGKTQTLNFYLIEN--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+  VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   Q D  ++ F
Sbjct: 70  ALHFVDVPGYGYAKVSKTERAKWGKMIETYLTTREQLRAVVSLVDLRHKPSQEDIQMYQF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   +V TK DK+
Sbjct: 130 LKYYDIPVIVVATKADKI 147


>gi|313906309|ref|ZP_07839652.1| ribosome biogenesis GTP-binding protein YsxC [Eubacterium
           cellulosolvens 6]
 gi|313468865|gb|EFR64224.1| ribosome biogenesis GTP-binding protein YsxC [Eubacterium
           cellulosolvens 6]
          Length = 196

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 107/180 (59%), Gaps = 17/180 (9%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-VPKDFSNLKNN 82
           LP  G  EIAF+G+SNVGKSSLIN L+NRK+LARTS+ PG+TQ +NF+ + ++F      
Sbjct: 18  LPDTGQAEIAFAGKSNVGKSSLINGLMNRKSLARTSSQPGKTQTINFYHINEEF------ 71

Query: 83  LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVF 142
                LVD+PGYGY  A      SWG +I RYL   + L+ V+LL+D RH     D+ ++
Sbjct: 72  ----YLVDLPGYGYTTASVNVRQSWGRMIERYLKTATNLKAVFLLLDIRHAPNANDKQMY 127

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH--PEVIPTSSVKRKGIE 200
            ++     +  ++ TK+DK+  +  Q+ L+    L+R+        ++ P SSV + G E
Sbjct: 128 DWVLDNGYTPIVIATKLDKIKRSQVQKQLK----LLRDTLGMEKGAKLFPYSSVTKAGRE 183


>gi|71897603|ref|ZP_00679848.1| GTP-binding protein [Xylella fastidiosa Ann-1]
 gi|71732506|gb|EAO34559.1| GTP-binding protein [Xylella fastidiosa Ann-1]
          Length = 219

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 101/193 (52%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           +L     I  LP     E+AF+GRSN GKSS++N L  +  LAR S  PGRTQ L +F  
Sbjct: 26  YLLSAHTIHQLPSDDGSEVAFAGRSNAGKSSVLNTLTRQNALARVSKTPGRTQQLVYFTV 85

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                     P   LVD+PGYGYA+ PK+    W   I  Y   R +LR + +++D RH 
Sbjct: 86  T---------PQRYLVDLPGYGYAKVPKELQIHWQAFIDTYFHHRQSLRGLVVVMDIRHP 136

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K+ D  + ++  ++ +  Q +LTK DKL      +TL+K +  +  +   H  +   SS
Sbjct: 137 LKEYDLQMLAYARQRGLPAQALLTKADKLGRGQQAQTLQKVRNELTKHFADHINIQTFSS 196

Query: 194 VKRKGIEVLRKAI 206
             R+G+E L   I
Sbjct: 197 KSRQGVEQLHTVI 209


>gi|281425242|ref|ZP_06256155.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella oris
           F0302]
 gi|299142639|ref|ZP_07035769.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella oris C735]
 gi|281400708|gb|EFB31539.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella oris
           F0302]
 gi|298575854|gb|EFI47730.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella oris C735]
          Length = 198

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 109/198 (55%), Gaps = 10/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P +   PK   PE AF GRSNVGKSSLIN+L N K LA+TS  PG+T  +N F+ 
Sbjct: 8   FVISAPTVSKCPKDDKPEYAFIGRSNVGKSSLINMLCNHKGLAKTSATPGKTLLINHFII 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                  NN     LVD+PGYG+A+  K        +I  Y+ +R  L  V++LID RH 
Sbjct: 68  -------NN--EWYLVDLPGYGFAKRSKTVQQKLEQMIASYILQRKQLINVFVLIDIRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID++   +L +  V + IV TK DKL P  A++  +K    +++     P    TSS
Sbjct: 119 QQKIDREFIDWLGESNVPFTIVFTKADKLGPGKAKQNAQKWLEQLKDRWETLPPYYITSS 178

Query: 194 VKRKGIEVLRKAILETIN 211
            K+ G E L  A ++ IN
Sbjct: 179 EKKLGREELL-AYIDEIN 195


>gi|29655060|ref|NP_820752.1| ribosome biogenesis GTP-binding protein YsxC [Coxiella burnetii RSA
           493]
 gi|81628492|sp|Q83AV6|ENGB_COXBU RecName: Full=Probable GTP-binding protein EngB
 gi|29542329|gb|AAO91266.1| GTP-binding protein [Coxiella burnetii RSA 493]
          Length = 205

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 93/168 (55%), Gaps = 9/168 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           +L    E   LP     EIAF GRSN GKSS +NI+   K LARTS  PGRTQ +NFF  
Sbjct: 15  YLTSAAEFDQLPPDQGAEIAFIGRSNAGKSSALNIITGIKGLARTSKTPGRTQMINFFAL 74

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +   L         VD+PGYGYA+ P+     W  L+  YL  R  L+ + +++D RH 
Sbjct: 75  NEHERL---------VDLPGYGYAKVPRMVQKRWEELVDSYLKNRRCLKGLVVVMDIRHP 125

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY 181
           +K++D+DV  +     +   I+LTK DKLS   A++TL + +  I  Y
Sbjct: 126 LKEMDEDVIEWAVNYDIPIHILLTKSDKLSQNAAKKTLGEVQTAISAY 173


>gi|251793793|ref|YP_003008523.1| ribosome biogenesis GTP-binding protein YsxC [Aggregatibacter
           aphrophilus NJ8700]
 gi|247535190|gb|ACS98436.1| GTP-binding protein [Aggregatibacter aphrophilus NJ8700]
          Length = 204

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/189 (37%), Positives = 104/189 (55%), Gaps = 10/189 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P +  LP+    EIAF+GRSN GKS+ +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 13  FLTSAPNLKSLPEDSGIEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  L  + +L+D RH 
Sbjct: 73  E---------PQCKLVDLPGYGYAAVPEQMKQQWQHALGEYLQKRECLAGIIVLMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKLS +   + ++  +  I  +     +V   S+
Sbjct: 124 LKDLDQQMIEWAVSADLPILLLLTKADKLSQSERSKQVKMVREAILPF-QGDIQVEAFSA 182

Query: 194 VKRKGIEVL 202
           +KR GI+ L
Sbjct: 183 LKRTGIDRL 191


>gi|294673629|ref|YP_003574245.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella ruminicola
           23]
 gi|294471615|gb|ADE81004.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella ruminicola
           23]
          Length = 200

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 107/197 (54%), Gaps = 13/197 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F    P   + PK   PE AF GRSNVGKSSLIN+L  +KNLA+TS  PG+T  +N F+ 
Sbjct: 8   FTLSAPMESMCPKDTKPEYAFIGRSNVGKSSLINMLTGKKNLAKTSATPGKTLLINHFII 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                  NN     LVD+PGYG+A+  KK V     +I  Y+ +R  L  V+LLID R  
Sbjct: 68  -------NN--EWYLVDLPGYGFAKRSKKEVQKLEQMINGYILQREQLVNVFLLIDIRLE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID +   ++   +V + I+ TK DKLS +   + L   K ++       P +  TSS
Sbjct: 119 AQKIDLEFMEWMGTSSVPFAIIFTKADKLSASKVLQNLNAYKKVLSETWEELPPIFVTSS 178

Query: 194 VKRKGIEVLRKAILETI 210
            K++G    R  +L+ I
Sbjct: 179 EKKQG----RDEVLDYI 191


>gi|145300976|ref|YP_001143817.1| ribosome biogenesis GTP-binding protein YsxC [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|166225938|sp|A4ST47|ENGB_AERS4 RecName: Full=Probable GTP-binding protein EngB
 gi|142853748|gb|ABO92069.1| GTP binding protein [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 217

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 73/194 (37%), Positives = 103/194 (53%), Gaps = 12/194 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP  G  EIAF+GRSN GKSS +N L   KNLARTS  PGRTQ +N F  
Sbjct: 13  FVTSAPDIRHLPNDGGVEIAFAGRSNAGKSSALNTLTKHKNLARTSKTPGRTQLINLFEL 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA+ P +    W   +  YL  R +L+ + +L+D RH 
Sbjct: 73  E---------PGKRLVDLPGYGYAQVPLEMKLKWQKSLAEYLQRRESLKGLVILMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY-PTAHPEVIPTS 192
           +K  D ++  +   + +   ++LTK DKLSP      + K +  I +  P    E    S
Sbjct: 124 LKDTDMNMLEWSSHRELPVMLLLTKADKLSPGPRNNQVIKVRQAIADLGPQIQVEAF--S 181

Query: 193 SVKRKGIEVLRKAI 206
           S+   G+E L + +
Sbjct: 182 SLNNIGVEKLAQTL 195


>gi|161830201|ref|YP_001597597.1| ribosome biogenesis GTP-binding protein YsxC [Coxiella burnetii RSA
           331]
 gi|189037176|sp|A9NAD8|ENGB_COXBR RecName: Full=Probable GTP-binding protein EngB
 gi|161762068|gb|ABX77710.1| GTP-binding protein [Coxiella burnetii RSA 331]
          Length = 205

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 93/168 (55%), Gaps = 9/168 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           +L    E   LP     EIAF GRSN GKSS +NI+   K LARTS  PGRTQ +NFF  
Sbjct: 15  YLTSAAEFDQLPPDQGAEIAFIGRSNAGKSSALNIITGIKGLARTSKTPGRTQMINFFAL 74

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +   L         VD+PGYGYA+ P+     W  L+  YL  R  L+ + +++D RH 
Sbjct: 75  NEHERL---------VDLPGYGYAKVPRMVQKRWEELVDSYLKNRRCLKGLVVVMDIRHP 125

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY 181
           +K++D+DV  +     +   I+LTK DKLS   A++TL + +  I  Y
Sbjct: 126 LKEMDEDVIEWAVNYDIPIHILLTKSDKLSQNAAKKTLGEVQTAISAY 173


>gi|257887187|ref|ZP_05666840.1| GTP-binding protein [Enterococcus faecium 1,141,733]
 gi|257823241|gb|EEV50173.1| GTP-binding protein [Enterococcus faecium 1,141,733]
          Length = 195

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 84/138 (60%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L++RKNLARTS  PG+TQ LNF++ ++         
Sbjct: 19  PETQLPEIALAGRSNVGKSSFINTLIDRKNLARTSGKPGKTQTLNFYLIEN--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+  VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   Q D  ++ F
Sbjct: 70  ALHFVDVPGYGYAKVSKTERAKWGKMIETYLTTREQLRAVVSLVDLRHKPSQEDIQMYQF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   +V TK DK+
Sbjct: 130 LKYYDIPVIVVATKADKI 147


>gi|323466766|gb|ADX70453.1| Probable GTP-binding protein engB [Lactobacillus helveticus H10]
          Length = 196

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/187 (41%), Positives = 105/187 (56%), Gaps = 12/187 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK    EIA SGRSNVGKSSLIN L+NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PKDNLSEIALSGRSNVGKSSLINTLLNRKNLARTSSQPGKTQTLNFYLIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYAR  +K    +G +I  YL  R  L+ + +LID RH   + D  ++++
Sbjct: 70  EFYLVDVPGYGYARVSQKKRQEFGEMIQDYLETRPNLKGLVILIDSRHEPTKDDIAMYNY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR-NYPTAHPEVIPTSSVKRKGIEVLR 203
                +   +V TKIDK+  +   + + + K  I  NY   H  V+  SSV +  +  L 
Sbjct: 130 AQYLNLPILVVCTKIDKIKKSQVNKVMSRLKKNIDLNYD--HVTVLTFSSVTKLHVAELG 187

Query: 204 KAILETI 210
             I E I
Sbjct: 188 NWIEEKI 194


>gi|306821418|ref|ZP_07455023.1| ribosome biogenesis GTP-binding protein YsxC [Eubacterium yurii
           subsp. margaretiae ATCC 43715]
 gi|304550540|gb|EFM38526.1| ribosome biogenesis GTP-binding protein YsxC [Eubacterium yurii
           subsp. margaretiae ATCC 43715]
          Length = 195

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 101/178 (56%), Gaps = 11/178 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    P IA +GRSNVGKSSLIN L+NRK+LAR S  PG+T+ +NFF+  +         
Sbjct: 19  PDDNLPCIALAGRSNVGKSSLINSLLNRKSLARVSGTPGKTRTINFFIINE--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           +  LVD+PGYGYA+  K   +SWG  +  Y S+   L+ V+LL+D RH  K  D+ ++ +
Sbjct: 70  SFYLVDLPGYGYAKLSKTEQESWGKTMELYFSKSKNLKHVFLLLDIRHEPKASDKQMYDY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
                +   I+ TK DK+S    Q++    K  ++       ++ P SS+ + GIE L
Sbjct: 130 CKYYDIPVDIIATKSDKISRGAYQKSFSIMKKFLQ--IKEEIKIFPISSLNKSGIEEL 185


>gi|296135140|ref|YP_003642382.1| ribosome biogenesis GTP-binding protein YsxC [Thiomonas intermedia
           K12]
 gi|295795262|gb|ADG30052.1| ribosome biogenesis GTP-binding protein YsxC [Thiomonas intermedia
           K12]
          Length = 230

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 97/184 (52%), Gaps = 14/184 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV--PKDFSNLKN 81
           LP  G PEIAF GRSN GKS+ IN L  ++ LA  S  PGRTQH+NFF   PKD      
Sbjct: 17  LPVTGLPEIAFVGRSNAGKSTAINTLCQQRQLAFASKTPGRTQHINFFAVGPKDS----- 71

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDV 141
             P+  LVD+PGYGYA   K +   W   + +YL+ER  L  + LL D R G+ + D  +
Sbjct: 72  --PSGLLVDLPGYGYAAVAKTDKKRWQLFLAQYLAERGPLVGLILLADSRLGLTETDLSL 129

Query: 142 FSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT-----SSVKR 196
            +F+   +V   ++LTK DKL+    Q   +  +  +  +  A     P      S+ K 
Sbjct: 130 LAFMAPASVPLHVLLTKADKLNRQEGQRAAQAARDQLAQHAQAVGMTAPISLQLFSATKL 189

Query: 197 KGIE 200
            G+E
Sbjct: 190 SGVE 193


>gi|228473700|ref|ZP_04058448.1| ribosome biogenesis GTP-binding protein YsxC [Capnocytophaga
           gingivalis ATCC 33624]
 gi|228274847|gb|EEK13664.1| ribosome biogenesis GTP-binding protein YsxC [Capnocytophaga
           gingivalis ATCC 33624]
          Length = 200

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 108/199 (54%), Gaps = 12/199 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLN-FFV 72
           F+    ++   P    PE AF GRSNVGKSSLIN+L N K LA+TS+ PG+TQ +N F +
Sbjct: 8   FVVSNTQVAKCPTHKLPEYAFIGRSNVGKSSLINMLTNHKGLAKTSSKPGKTQLINHFLI 67

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
            K++           LVD+PGYGYA+  K++  ++   I  Y  +R  L   ++L+D RH
Sbjct: 68  NKEW----------YLVDLPGYGYAKVSKQSKKTFQQFITDYFKKRRELVNAFVLVDIRH 117

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
             ++ID +   +L + A+ + IV TK DKL+    QE +     ++       P    TS
Sbjct: 118 EPQKIDLEFMQWLGENAIPFAIVFTKADKLTEKQIQEHVTSYSEILLQQWEEMPPYFITS 177

Query: 193 SVKRKGIEVLRKAILETIN 211
           S  R G E L   I ETIN
Sbjct: 178 SENRLGKEDLLSYI-ETIN 195


>gi|225028674|ref|ZP_03717866.1| hypothetical protein EUBHAL_02953 [Eubacterium hallii DSM 3353]
 gi|224953984|gb|EEG35193.1| hypothetical protein EUBHAL_02953 [Eubacterium hallii DSM 3353]
          Length = 197

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 85/139 (61%), Gaps = 9/139 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LPK   PE+AF+G+SNVGKSSLIN LVNRK+LARTS  PG+TQ +NF+         N  
Sbjct: 18  LPKNTLPEVAFAGKSNVGKSSLINALVNRKSLARTSGQPGKTQTINFY---------NVN 68

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             M +VD+PGYGYA+  K+    WG +I  YL     LR V+LLID RH     D  ++ 
Sbjct: 69  EEMYIVDLPGYGYAKVSKEVAAKWGPMIENYLHTSEQLRMVFLLIDLRHKPTNNDVQMYR 128

Query: 144 FLDKKAVSYQIVLTKIDKL 162
           ++     S  IV TK DK+
Sbjct: 129 WILSNGFSPVIVATKADKI 147


>gi|168821667|ref|ZP_02833667.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194443397|ref|YP_002043224.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|198244514|ref|YP_002217923.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|238690342|sp|B5FNZ2|ENGB_SALDC RecName: Full=Probable GTP-binding protein EngB
 gi|238693565|sp|B4SZ98|ENGB_SALNS RecName: Full=Probable GTP-binding protein EngB
 gi|194402060|gb|ACF62282.1| putative GTP-binding protein EngB [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|197939030|gb|ACH76363.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|205341881|gb|EDZ28645.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|320088406|emb|CBY98165.1| probable GTP-binding protein engB [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|326625712|gb|EGE32057.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|326629545|gb|EGE35888.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 210

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDCGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLF-- 68

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                    +    LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 69  -------EVVEGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +  +  +   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIQWAVESNIQVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVEAFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|283787469|ref|YP_003367334.1| GTP-binding protein [Citrobacter rodentium ICC168]
 gi|282950923|emb|CBG90600.1| probable GTP-binding protein [Citrobacter rodentium ICC168]
          Length = 198

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
            P+I  LP     E+AF+GRSN GKSS +N L N+KNLARTS  PGRTQ +N F   D  
Sbjct: 3   APDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKNLARTSKTPGRTQLINLFEVVD-- 60

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                     LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH +K +
Sbjct: 61  -------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDL 113

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           DQ +  +  +  +   ++LTK DKL+    +  L   +  +  +     +V   SS+K++
Sbjct: 114 DQQMILWAVESNIQVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVEAFSSLKKQ 172

Query: 198 GIEVLRKAI 206
           G++ LR+ +
Sbjct: 173 GVDKLRQKL 181


>gi|24418386|sp|Q92JC9|ENGB_RICCN RecName: Full=Probable GTP-binding protein EngB
          Length = 212

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 86/150 (57%), Gaps = 9/150 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  +     PEIAF G+SNVGKSSLIN + N KNLA+ SN PGRT+ +NFF  
Sbjct: 24  FVAGAMNINQILNFSLPEIAFVGKSNVGKSSLINTICNNKNLAKVSNTPGRTRQINFFNL 83

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A  P    + WG LI  YL     LR V LLID R G
Sbjct: 84  AD---------KLIIVDLPGYGFANVPISVKEQWGVLISYYLRNSYNLRLVNLLIDSRRG 134

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
           +K+ D+ V   L      +QI+ TK DK++
Sbjct: 135 IKENDKKVADLLLANKREFQIIFTKSDKVT 164


>gi|294339191|emb|CAZ87545.1| putative GTP-binding protein engB [Thiomonas sp. 3As]
          Length = 230

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 99/190 (52%), Gaps = 14/190 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV--PKDFSNLKN 81
           LP  G PEIAF GRSN GKS+ IN L  ++ LA  S  PGRTQH+NFF   PKD      
Sbjct: 17  LPVTGLPEIAFVGRSNAGKSTAINTLCQQRQLAFASKTPGRTQHINFFAVGPKDS----- 71

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDV 141
             P+  LVD+PGYGYA   K +   W   + +YL+ER  L  + LL D R G+ + D  +
Sbjct: 72  --PSGLLVDLPGYGYAAVAKTDKKRWQLFLAQYLAERGPLVGLILLADSRLGLTETDLSL 129

Query: 142 FSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT-----SSVKR 196
            +F+   +V   ++LTK DKL+    Q   +  +  +  +  A     P      S+ K 
Sbjct: 130 LAFMAPASVPLHVLLTKADKLNRQEGQRAAQAARDQLAQHAQAVGMTAPISLQLFSATKL 189

Query: 197 KGIEVLRKAI 206
            G+E   + I
Sbjct: 190 SGVESASQLI 199


>gi|237727973|ref|ZP_04558454.1| GTPase EngB [Citrobacter sp. 30_2]
 gi|226910230|gb|EEH96148.1| GTPase EngB [Citrobacter sp. 30_2]
          Length = 210

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 106/193 (54%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K LARTS  PGRTQ +N F  
Sbjct: 11  FVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKGLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH 
Sbjct: 71  VD---------GKRLVDLPGYGYAEVPEEMKRKWQRALAEYLEKRQSLQGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +  +  V   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMILWAVESNVQVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVEAFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 181 LKKLGVDKLRQKL 193


>gi|94312216|ref|YP_585426.1| ribosome biogenesis GTP-binding protein YsxC [Cupriavidus
           metallidurans CH34]
 gi|93356068|gb|ABF10157.1| GTP-binding protein [Cupriavidus metallidurans CH34]
 gi|222833714|gb|EEE72191.1| predicted protein [Populus trichocarpa]
          Length = 250

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 107/199 (53%), Gaps = 10/199 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP    PE+AF+GRSN GKS+ INIL N+K LA +S  PGRTQH+NFF  
Sbjct: 32  FFTTVNHLRDLPATAVPEVAFAGRSNAGKSTAINILCNQKRLAFSSRTPGRTQHINFFT- 90

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
              + +K   P   LVD+PGYGYA         W GL+  Y+  R+ L  + L++D R  
Sbjct: 91  --VAPVKAPDPVGFLVDLPGYGYAEVSGSAKFHWQGLLSDYVQARTQLSGLILMMDARRP 148

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT-- 191
              +D  +  +         ++LTK DKL+ +   + L +T+ ++ +Y  A  E  P   
Sbjct: 149 FTDLDCQMVEWFLPTGKPIHVLLTKADKLTTSDNAKALRETRKVLADY-AAQMENPPALT 207

Query: 192 ----SSVKRKGIEVLRKAI 206
               SS+KR+GIE  ++ +
Sbjct: 208 AQLFSSLKRRGIEEAQRVV 226


>gi|328468551|gb|EGF39553.1| GTP-binding protein YsxC [Lactobacillus helveticus MTCC 5463]
          Length = 194

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 91/151 (60%), Gaps = 9/151 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PEIA SGRSNVGKSSLIN L+NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PKDNLPEIALSGRSNVGKSSLINTLLNRKNLARTSSQPGKTQTLNFYLIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYAR  +K    +G +I  YL  R  L+ + +LID RH   + D  ++++
Sbjct: 70  EFYLVDVPGYGYARVSQKKRQEFGEMIQDYLETRPNLKGLVILIDSRHEPTKDDIAMYNY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTK 175
                +   +V TKIDK+  +   + + + K
Sbjct: 130 AQYLNLPILVVCTKIDKIKKSQVNKAMSRLK 160


>gi|255505868|ref|ZP_05348579.3| ribosome biogenesis GTP-binding protein YsxC [Bryantella
           formatexigens DSM 14469]
 gi|255265477|gb|EET58682.1| ribosome biogenesis GTP-binding protein YsxC [Bryantella
           formatexigens DSM 14469]
          Length = 258

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 107/188 (56%), Gaps = 16/188 (8%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP     E+AF+G+SNVGKSSLIN L+NRK LARTS  PG+TQ +NF+      N+ N  
Sbjct: 71  LPVNDKIEVAFAGKSNVGKSSLINALMNRKALARTSAQPGKTQTINFY------NINN-- 122

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
            AM LVD+PGYGYA+  +   + WG +I RYL +   L+ V+LLID RH     D+ ++ 
Sbjct: 123 -AMYLVDLPGYGYAKVAQSEKEKWGRMIERYLQKSQMLKAVFLLIDIRHDPSANDKLMYD 181

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           ++        I+ TK+DK+  +  Q   ++ K +          VIP S+  ++G    R
Sbjct: 182 WILYNGYEPIIIATKLDKIKRSQVQ---KQVKAVREGLGMKGGTVIPFSAETKQG----R 234

Query: 204 KAILETIN 211
             I E I+
Sbjct: 235 DEIWEMID 242


>gi|28198564|ref|NP_778878.1| GTPase EngB [Xylella fastidiosa Temecula1]
 gi|32129522|sp|Q87DM6|ENGB_XYLFT RecName: Full=Probable GTP-binding protein EngB
 gi|28056648|gb|AAO28527.1| GTP-binding protein [Xylella fastidiosa Temecula1]
 gi|307579692|gb|ADN63661.1| ribosome biogenesis GTP-binding protein YsxC [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 203

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/183 (36%), Positives = 98/183 (53%), Gaps = 9/183 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP     E+AF+GRSN GKSS++N L  +  LAR S  PGRTQ L +F            
Sbjct: 20  LPSDDGSEVAFAGRSNAGKSSVLNTLTRQNALARVSKTPGRTQQLVYFTVT--------- 70

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P   LVD+PGYGYA+ PK+    W   I  Y   R +LR + +++D RH +K+ D  + +
Sbjct: 71  PQRYLVDLPGYGYAKVPKELQIHWQAFIDTYFHHRQSLRGLVVVMDIRHPLKEYDLQMLA 130

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +  ++ +  Q +LTK DKL      +TL+K +  +  +   H  +   SS  R+G+E L 
Sbjct: 131 YARQRGLPAQALLTKADKLGRGQQAQTLQKVRNELTKHFADHINIQTFSSKSRQGVEQLH 190

Query: 204 KAI 206
             I
Sbjct: 191 TVI 193


>gi|119369240|sp|Q1LI69|ENGB_RALME RecName: Full=Probable GTP-binding protein EngB
          Length = 227

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 107/199 (53%), Gaps = 10/199 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP    PE+AF+GRSN GKS+ INIL N+K LA +S  PGRTQH+NFF  
Sbjct: 9   FFTTVNHLRDLPATAVPEVAFAGRSNAGKSTAINILCNQKRLAFSSRTPGRTQHINFFT- 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
              + +K   P   LVD+PGYGYA         W GL+  Y+  R+ L  + L++D R  
Sbjct: 68  --VAPVKAPDPVGFLVDLPGYGYAEVSGSAKFHWQGLLSDYVQARTQLSGLILMMDARRP 125

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT-- 191
              +D  +  +         ++LTK DKL+ +   + L +T+ ++ +Y  A  E  P   
Sbjct: 126 FTDLDCQMVEWFLPTGKPIHVLLTKADKLTTSDNAKALRETRKVLADY-AAQMENPPALT 184

Query: 192 ----SSVKRKGIEVLRKAI 206
               SS+KR+GIE  ++ +
Sbjct: 185 AQLFSSLKRRGIEEAQRVV 203


>gi|307256115|ref|ZP_07537902.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306865296|gb|EFM97192.1| GTP-binding protein engB [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
          Length = 206

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 105/189 (55%), Gaps = 10/189 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P+I  LP+    EIAF+GRSN GKS+ +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 11  FLTSAPDIRHLPEDNGVEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  L  V +L+D RH 
Sbjct: 71  E---------PNCKLVDLPGYGYAAVPEQMKLQWQKALGEYLQKRECLHGVVILMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKLS +   +T++  +  I  +     +V   S+
Sbjct: 122 LKDLDQQMIEWAVSAQLPVLLLLTKADKLSQSARSKTVKMVREAILPF-QGDIQVEAYSA 180

Query: 194 VKRKGIEVL 202
           + + GI+ L
Sbjct: 181 LNKVGIDKL 189


>gi|148266199|ref|YP_001232905.1| ribosome biogenesis GTP-binding protein YsxC [Geobacter
           uraniireducens Rf4]
 gi|189037180|sp|A5G964|ENGB_GEOUR RecName: Full=Probable GTP-binding protein EngB
 gi|146399699|gb|ABQ28332.1| small GTP-binding protein [Geobacter uraniireducens Rf4]
          Length = 204

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 92/151 (60%), Gaps = 11/151 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-V 72
           F++        P    PEIAF+GRSNVGKSSLIN+LVNRK+L RTS+ PGRTQ +NFF V
Sbjct: 8   FIKSATRPAHYPAGDFPEIAFAGRSNVGKSSLINVLVNRKSLVRTSSTPGRTQLINFFDV 67

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
             +F+          LVD+PGYG+AR P      WG ++  YLS+RS LR V L++D R 
Sbjct: 68  NGEFT----------LVDLPGYGFARVPLAVKKEWGPMMETYLSKRSNLRGVILILDIRR 117

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
                D  +  +L   +V   IV+TK DK+S
Sbjct: 118 TPVAEDVQMLHWLRAYSVKPIIVVTKCDKVS 148


>gi|168056123|ref|XP_001780071.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162668474|gb|EDQ55080.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 305

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 108/191 (56%), Gaps = 23/191 (12%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PEIAF+GRSNVGKSSLIN L  +  + RTS+ PG TQ +NFF       L + L
Sbjct: 121 LPSLNLPEIAFAGRSNVGKSSLINALTRQWGVVRTSDKPGMTQSVNFFT------LGSRL 174

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYG+A A ++  ++W  L+  Y++ R  L+ V LL+D + G+K  D+++  
Sbjct: 175 ---CLVDLPGYGFAYAKEEAKEAWEDLVKEYVTTRKILKRVCLLVDSKWGLKPRDEELIE 231

Query: 144 FLDKKAVSYQIVLTKIDKLSP-------TTAQETLEKTKYLIRNYPTAHPEVIPTSSVKR 196
            ++     YQIVLTK D L P       T  QE L+  K LI   P     V+  SS   
Sbjct: 232 LMENAQTKYQIVLTKTDILPPLDLARRATQIQEALKHHKQLI--LP-----VLMVSSQTG 284

Query: 197 KGIEVLRKAIL 207
            GI  LRKA++
Sbjct: 285 GGIPHLRKALV 295


>gi|300727729|ref|ZP_07061115.1| GTP-binding protein [Prevotella bryantii B14]
 gi|299775017|gb|EFI71623.1| GTP-binding protein [Prevotella bryantii B14]
          Length = 200

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 101/187 (54%), Gaps = 9/187 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F    P +   PK   PE AF GRSNVGKSSLIN+L N K LA+TS  PG+T  +N F+ 
Sbjct: 8   FTISAPTVSKCPKDNKPEYAFIGRSNVGKSSLINMLCNHKGLAKTSATPGKTLLINHFII 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                  NN     LVD+PGYG+A+  K        +I  Y+ +R  L  V++LID RH 
Sbjct: 68  -------NN--EWYLVDLPGYGFAKRSKSVQQKLEQMISSYILQRQQLYNVFVLIDVRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID++   +L K  + + IV TK DKL P  A++  E     +++     P    TSS
Sbjct: 119 QQKIDREFVDWLGKSQIPFAIVFTKADKLGPVKAKKNAEAWMKQLQDTWEDLPPYFITSS 178

Query: 194 VKRKGIE 200
            K+ G E
Sbjct: 179 EKKLGKE 185


>gi|116621147|ref|YP_823303.1| small GTP-binding protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|122254883|sp|Q026Q1|ENGB_SOLUE RecName: Full=Probable GTP-binding protein EngB
 gi|116224309|gb|ABJ83018.1| small GTP-binding protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 191

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 107/204 (52%), Gaps = 20/204 (9%)

Query: 9   KSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHL 68
           K+ ++   G P+    P    PEIAF GRSNVGKSSLIN L   K LA TSN PGRTQ +
Sbjct: 5   KAEFVVSSGKPDT--FPSDRLPEIAFLGRSNVGKSSLINALTGHKKLAFTSNTPGRTQTI 62

Query: 69  NFF-VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLL 127
           NF+ V + F           LVD+PGYGYAR P    + W  LI  YL  R TL+   L+
Sbjct: 63  NFYRVDEKF----------YLVDLPGYGYARVPAGFAEQWKVLIEHYLEFRETLKFSCLI 112

Query: 128 IDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE 187
           +D R G  + D D+  +LD     Y +V TK DKL+ +  +  L       R       E
Sbjct: 113 LDTRRGWMEKDLDLKRWLDHHGRPYLVVATKTDKLNQSEQERGL-------RAIRQEGVE 165

Query: 188 VIPTSSVKRKGIEVLRKAILETIN 211
            +P S++  +G+  + +AI  T+ 
Sbjct: 166 PLPFSALSGRGVREIWQAITTTLQ 189


>gi|291536691|emb|CBL09803.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Roseburia
           intestinalis M50/1]
 gi|291537975|emb|CBL11086.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Roseburia
           intestinalis XB6B4]
          Length = 199

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 107/183 (58%), Gaps = 11/183 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           +P     E+AF+G+SNVGKSSLIN L+NRK LARTS  PG+TQ +NF+   D        
Sbjct: 18  VPDTAYAEVAFAGKSNVGKSSLINALMNRKALARTSAQPGKTQTINFYNIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
            AM LVD+PGYGYA+A ++    WG +I  YL     L+ V+LLID RH     D+ ++ 
Sbjct: 70  -AMYLVDLPGYGYAKASEEVKAKWGKMIENYLHTSKQLKAVFLLIDIRHDPSANDRMMYE 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           ++  +  +  I+ TK+DK+  +  Q+ ++  +  +   P     +IP S+  ++G + + 
Sbjct: 129 WMVYQGFAPIIIATKLDKIKRSQIQKNVKAIREGLNVQPGT--TIIPFSAETKQGRDEIW 186

Query: 204 KAI 206
           K I
Sbjct: 187 KLI 189


>gi|325954327|ref|YP_004237987.1| GTP-binding protein engB [Weeksella virosa DSM 16922]
 gi|323436945|gb|ADX67409.1| GTP-binding protein engB [Weeksella virosa DSM 16922]
          Length = 205

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 106/198 (53%), Gaps = 13/198 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++        PK   PE AF GRSNVGKSSLIN+L N+++LA+TS  PG+TQ LN F+ 
Sbjct: 8   FIKSAQTYKDCPKPDLPEYAFIGRSNVGKSSLINMLTNKRDLAKTSGTPGKTQLLNTFL- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                + +N     L D+PGYGYA+  K N   +  +I  YL  R+ L C ++L+D RH 
Sbjct: 67  -----INSN---WYLTDLPGYGYAKVSKTNRAGFERMIYDYLEFRTNLVCTFVLVDSRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ D     +L  K + + I+ TK+DKLS    Q+ L   K  +       P +  TSS
Sbjct: 119 PQKNDLKFMEWLGHKQIPFAIIFTKLDKLSSAKFQKNLNTYKRELLKTWEDLPMIFATSS 178

Query: 194 VKRKGIEVLRKAILETIN 211
               G    R  +L+ IN
Sbjct: 179 SSFIG----RNELLDYIN 192


>gi|13124224|sp|Q9PDE9|ENGB_XYLFA RecName: Full=Probable GTP-binding protein EngB
          Length = 203

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 67/183 (36%), Positives = 98/183 (53%), Gaps = 9/183 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP     E+AF+GRSN GKSS++N L  +  LAR S  PGRTQ L +F            
Sbjct: 20  LPADDGSEVAFAGRSNAGKSSVLNTLTRQNALARVSKTPGRTQQLVYFTVT--------- 70

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P   LVD+PGYGYA+ PK+    W   I  Y  +R  LR + +++D RH +K+ D  + +
Sbjct: 71  PQRYLVDLPGYGYAKVPKELQIHWQTFIDSYFHQRQALRGLVVVMDIRHPLKEYDLQMLA 130

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +  ++ +  Q +LTK DKL      +TL+K +  +  +   H  +   SS  R+G+E L 
Sbjct: 131 YARQRGLPAQALLTKADKLGRGQQAQTLQKVRNELTKHFADHINIQTFSSKSRQGVEQLH 190

Query: 204 KAI 206
             I
Sbjct: 191 TVI 193


>gi|312868996|ref|ZP_07729173.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus oris
           PB013-T2-3]
 gi|311095422|gb|EFQ53689.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus oris
           PB013-T2-3]
          Length = 196

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/186 (38%), Positives = 106/186 (56%), Gaps = 15/186 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PE+A  GRSNVGKSSL N+L+NR+N A TS+ PG+TQ LNF+  +D         
Sbjct: 19  PKTNYPEVALVGRSNVGKSSLTNVLINRRNFAHTSSQPGKTQTLNFYAVED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  KK  + +G +I +YL++R  LR   LL+D RH     D  ++ +
Sbjct: 70  QLYFVDVPGYGYAKVSKKERERFGQMIEQYLTQRDQLRGAILLVDGRHAPTADDVSMYQW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTT--AQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TKIDK+   T   QE+L K    +     A  +++  S+V + G + +
Sbjct: 130 LQYYHIPTLVVATKIDKVKGNTWNRQESLIKKTLGL----AAGDQLVLFSAVNKTGKDAV 185

Query: 203 RKAILE 208
            + I E
Sbjct: 186 WQWIDE 191


>gi|291612510|ref|YP_003522667.1| ribosome biogenesis GTP-binding protein YsxC [Sideroxydans
           lithotrophicus ES-1]
 gi|291582622|gb|ADE10280.1| ribosome biogenesis GTP-binding protein YsxC [Sideroxydans
           lithotrophicus ES-1]
          Length = 204

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 108/202 (53%), Gaps = 14/202 (6%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           +F+++A  F   V  +  LP  G  E+AF GRSN GKSS IN L N   LA TS  PGRT
Sbjct: 3   LFSQAA--FYTTVNHMKDLPLHGGKEVAFVGRSNAGKSSAINTLANHTRLAFTSKTPGRT 60

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           QHLN+F      +L NN     LVD+PGYGYA+ P      W  L+  YL  R  L  + 
Sbjct: 61  QHLNYF------SLGNN---NYLVDLPGYGYAKVPPDVQAHWEHLLSEYLQTREELCGLV 111

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK-YLIRNYPTA 184
           +++D RH + + DQ +  +         I+LTK DKLS   + +TL   K +L  ++P  
Sbjct: 112 VIMDARHPLTERDQGMLGWFAPTGKPIHILLTKSDKLSRQQSTQTLRDVKEFLAEHFPQC 171

Query: 185 HPEVIPTSSVKRKGIEVLRKAI 206
             ++   SS+K+ G++     I
Sbjct: 172 TAQLF--SSLKKAGMDEAEAMI 191


>gi|88705359|ref|ZP_01103070.1| GTP-binding protein engB [Congregibacter litoralis KT71]
 gi|88700449|gb|EAQ97557.1| GTP-binding protein engB [Congregibacter litoralis KT71]
          Length = 230

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 97/174 (55%), Gaps = 11/174 (6%)

Query: 2   VSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNA 61
           VS   + K+A  FL    ++   P+    E+AF+GRSN GKSS IN L     LARTS  
Sbjct: 17  VSKPAYRKAA--FLTSAAKVSQCPEDIGWEVAFAGRSNAGKSSAINSLTQNHKLARTSKT 74

Query: 62  PGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTL 121
           PGRTQ +NFF   +            +VD+PGYGYA+ P+K    W   +  YL ER +L
Sbjct: 75  PGRTQLINFFTVGE---------QQRIVDLPGYGYAKVPQKLKQDWTKQMEAYLQERQSL 125

Query: 122 RCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK 175
           R + LL DCRH ++  DQ + ++  +  +   ++LTK DKLS    ++TL K +
Sbjct: 126 RGLILLSDCRHPLQPFDQQMLTWAAEADMPVHMLLTKCDKLSKGAGKQTLLKVR 179


>gi|110639099|ref|YP_679308.1| ribosome biogenesis GTP-binding protein YsxC [Cytophaga
           hutchinsonii ATCC 33406]
 gi|119369188|sp|Q11RJ8|ENGB_CYTH3 RecName: Full=Probable GTP-binding protein EngB
 gi|110281780|gb|ABG59966.1| GTP-binding protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 199

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 105/196 (53%), Gaps = 11/196 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    +    P+   PE AF GRSNVGKSSLIN L   KNLA TS+ PG+TQ +N F  
Sbjct: 7   FISSYDDYQKCPEITKPEYAFIGRSNVGKSSLINSLTGVKNLAMTSSKPGKTQLINLFTI 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           ++            L D+PGYG+A+A + +   WG ++  YL  R+ L  V+LL+D RH 
Sbjct: 67  EE---------TWILADLPGYGFAKASQSSRIKWGRMVHDYLKNRTNLTTVFLLVDSRHE 117

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEK-TKYLIRNYPTAHPEVIPTS 192
             + D +  ++L    + + ++ TKIDK S T   + L   TK L  N+    P++  TS
Sbjct: 118 PMKSDLEQITWLASNGIPFSLIFTKIDKQSLTQTNKILASWTKVLSENWEEL-PKMFLTS 176

Query: 193 SVKRKGIEVLRKAILE 208
           S   KG E L   I E
Sbjct: 177 SESGKGTEELLTYIDE 192


>gi|73662400|ref|YP_301181.1| ribosome biogenesis GTP-binding protein YsxC [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
 gi|119369267|sp|Q49YA5|ENGB_STAS1 RecName: Full=Probable GTP-binding protein EngB
 gi|72494915|dbj|BAE18236.1| putative GTP-binding protein [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 195

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 68/171 (39%), Positives = 101/171 (59%), Gaps = 11/171 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G  E+  SGRSNVGKS+ IN ++ RKN+ARTS  PG+TQ LNF+      N+ N L 
Sbjct: 21  PETGLSEVGLSGRSNVGKSTFINSMIGRKNMARTSQQPGKTQTLNFY------NIDNQL- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  KK  +++G +I +Y+S+R  L+ V  L+D RH   + D  ++++
Sbjct: 74  --VFVDVPGYGYAKVSKKQREAFGKMIEKYISQREELKLVIQLVDLRHNPTEDDILMYNY 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVK 195
           L    +   +V TK DK++    Q+ L   +  +   P    E+I  SSVK
Sbjct: 132 LKYYEIPTFVVATKEDKIAKGKVQKHLANIQQKLEMEP--EDEIISYSSVK 180


>gi|269120910|ref|YP_003309087.1| GTP-binding protein HSR1-related protein [Sebaldella termitidis
           ATCC 33386]
 gi|268614788|gb|ACZ09156.1| GTP-binding protein HSR1-related protein [Sebaldella termitidis
           ATCC 33386]
          Length = 204

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 111/197 (56%), Gaps = 17/197 (8%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-V 72
           F++    I   P+    E AF GRSNVGKSSLIN L NR+NLARTS  PGRTQ +NFF V
Sbjct: 8   FIKSAVVINDYPETTEIEFAFIGRSNVGKSSLINSLTNRRNLARTSKTPGRTQLINFFDV 67

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYL-SERSTLRCVYLLIDCR 131
            +DF            VD+PGYG+A+ P+    +WG +I  YL S+R   + V+LL+D R
Sbjct: 68  NEDF----------YFVDLPGYGFAKVPEAVKKNWGKIIADYLNSDRE--KIVFLLLDIR 115

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
                 D ++  +L+  +++Y I+ TK DKLS     + L++ K   +     + +V   
Sbjct: 116 RVPSAEDIEMLKWLEHYSINYYIIFTKTDKLSNNQKFKQLKEIK---KKLEFDNKDVFFY 172

Query: 192 SSVKRKGIEVLRKAILE 208
           S++K  G E L + I +
Sbjct: 173 SALKNTGREELEEFIFD 189


>gi|326802551|ref|YP_004320370.1| GTP-binding protein engB [Sphingobacterium sp. 21]
 gi|326553315|gb|ADZ81700.1| GTP-binding protein engB [Sphingobacterium sp. 21]
          Length = 206

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 105/201 (52%), Gaps = 11/201 (5%)

Query: 1   MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSN 60
           M+S  I    +  F+     I  LP    PE AF GRSNVGKSSLIN L   K LA+TS 
Sbjct: 1   MLSLPIMIIKSAEFVCSNTRIDKLPPPTIPEYAFIGRSNVGKSSLINALTQHKGLAKTSQ 60

Query: 61  APGRTQHLN-FFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERS 119
            PG+TQ +N F V K++           LVD+PGYGYA+  K N   W   I +YL  R 
Sbjct: 61  TPGKTQLINHFLVNKEW----------FLVDLPGYGYAKTSKTNRSEWEKFIKKYLFNRE 110

Query: 120 TLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR 179
            L+CV++LID R   ++ D D    L +K + + ++ TK DK S   ++  +E  +  + 
Sbjct: 111 NLQCVFVLIDSRLTPQKNDLDFCCLLGEKGIPFILIFTKADKQSKIKSEHNIELFRKALL 170

Query: 180 NYPTAHPEVIPTSSVKRKGIE 200
            +    P  I TSS  R G +
Sbjct: 171 TWFEEVPPHILTSSETRNGCD 191


>gi|187776854|ref|ZP_02993327.1| hypothetical protein CLOSPO_00393 [Clostridium sporogenes ATCC
           15579]
 gi|187775513|gb|EDU39315.1| hypothetical protein CLOSPO_00393 [Clostridium sporogenes ATCC
           15579]
          Length = 199

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 109/185 (58%), Gaps = 15/185 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G PEIAF GRSNVGKS+LIN L NR+ L + S+ PG+T+ +NFF+  +         
Sbjct: 26  PEDGRPEIAFVGRSNVGKSTLINTLTNRRKLVKVSSTPGKTRLINFFLINE--------- 76

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYA+  KK  ++WG ++ +YL ER  L+ + LL+D RH     D +++++
Sbjct: 77  NMYFVDLPGYGYAKVSKKEKENWGYIMEQYLVERDQLKKIVLLVDSRHKPTSDDINMYNW 136

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIEVL 202
           +        +V TK+DKL     +  + K K +IR+      +  ++  SS+ ++G E +
Sbjct: 137 IKHYNYEVLVVGTKLDKLK----RNDINKNKKIIRDTLKMDKDDKILLISSLNKEGKEEV 192

Query: 203 RKAIL 207
            + IL
Sbjct: 193 LEQIL 197


>gi|296105443|ref|YP_003615589.1| GTP-binding protein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295059902|gb|ADF64640.1| GTP-binding protein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 209

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 11  FVTSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKNLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            LVD+PGYGYA+ P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 71  AE---------GKRLVDLPGYGYAQVPEEMKIKWQRALGEYLEKRMCLKGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     ++  ++LTK DKL+    +  +   +  +  +     +V   SS
Sbjct: 122 LKDLDQQMIDWAVASDIAVLVLLTKADKLASGARKAQVNMVREAVLAF-NGDVQVEAFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 181 LKKQGVDKLRQKL 193


>gi|240146202|ref|ZP_04744803.1| ribosome biogenesis GTP-binding protein YsxC [Roseburia
           intestinalis L1-82]
 gi|257201678|gb|EEU99962.1| ribosome biogenesis GTP-binding protein YsxC [Roseburia
           intestinalis L1-82]
          Length = 208

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 108/188 (57%), Gaps = 15/188 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           +P     E+AF+G+SNVGKSSLIN L+NRK LARTS  PG+TQ +NF+   D        
Sbjct: 18  VPDTAYAEVAFAGKSNVGKSSLINALMNRKVLARTSAQPGKTQTINFYNIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
            AM LVD+PGYGYA+A ++    WG +I  YL     L+ V+LLID RH     D+ ++ 
Sbjct: 70  -AMYLVDLPGYGYAKASEEVKAKWGKMIENYLHTSKQLKAVFLLIDIRHDPSANDRMMYE 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           ++  +  +  I+ TK+DK+  +  Q+ ++  +  +   P     +IP S+  ++G    R
Sbjct: 129 WMVYQGFAPIIIATKLDKIKRSQIQKNVKAIREGLNVQPGTM--IIPFSAETKQG----R 182

Query: 204 KAILETIN 211
             I E I+
Sbjct: 183 DEIWELID 190


>gi|15892061|ref|NP_359775.1| GTPase EngB [Rickettsia conorii str. Malish 7]
 gi|15619181|gb|AAL02676.1| hypothetical GTP-binding protein [Rickettsia conorii str. Malish 7]
          Length = 236

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 86/150 (57%), Gaps = 9/150 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  +     PEIAF G+SNVGKSSLIN + N KNLA+ SN PGRT+ +NFF  
Sbjct: 48  FVAGAMNINQILNFSLPEIAFVGKSNVGKSSLINTICNNKNLAKVSNTPGRTRQINFFNL 107

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYG+A  P    + WG LI  YL     LR V LLID R G
Sbjct: 108 AD---------KLIIVDLPGYGFANVPISVKEQWGVLISYYLRNSYNLRLVNLLIDSRRG 158

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
           +K+ D+ V   L      +QI+ TK DK++
Sbjct: 159 IKENDKKVADLLLANKREFQIIFTKSDKVT 188


>gi|89110163|ref|AP_003943.1| GTP-binding protein [Escherichia coli str. K-12 substr. W3110]
 gi|170083337|ref|YP_001732657.1| GTP-binding protein [Escherichia coli str. K-12 substr. DH10B]
 gi|209921338|ref|YP_002295422.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           SE11]
 gi|218556424|ref|YP_002389338.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           IAI1]
 gi|218560940|ref|YP_002393853.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli S88]
 gi|218692151|ref|YP_002400363.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           ED1a]
 gi|218697578|ref|YP_002405245.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           55989]
 gi|218701436|ref|YP_002409065.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           IAI39]
 gi|218707490|ref|YP_002415009.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           UMN026]
 gi|254163816|ref|YP_003046924.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli B
           str. REL606]
 gi|300819243|ref|ZP_07099443.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           107-1]
 gi|300823684|ref|ZP_07103810.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           119-7]
 gi|300896904|ref|ZP_07115391.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           198-1]
 gi|300906179|ref|ZP_07123892.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           84-1]
 gi|300919046|ref|ZP_07135591.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           115-1]
 gi|300925949|ref|ZP_07141782.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           182-1]
 gi|300931705|ref|ZP_07147011.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           187-1]
 gi|300937087|ref|ZP_07151950.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           21-1]
 gi|300948175|ref|ZP_07162303.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           116-1]
 gi|300958280|ref|ZP_07170425.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           175-1]
 gi|301023770|ref|ZP_07187506.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           69-1]
 gi|301303330|ref|ZP_07209454.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           124-1]
 gi|301328178|ref|ZP_07221308.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           78-1]
 gi|301648437|ref|ZP_07248169.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           146-1]
 gi|309797830|ref|ZP_07692213.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           145-7]
 gi|312971850|ref|ZP_07786024.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|85676194|dbj|BAE77444.1| GTP-binding protein [Escherichia coli str. K12 substr. W3110]
 gi|169891172|gb|ACB04879.1| GTP-binding protein [Escherichia coli str. K-12 substr. DH10B]
 gi|209914597|dbj|BAG79671.1| GTP-binding protein [Escherichia coli SE11]
 gi|218354310|emb|CAQ86984.2| GTP-binding protein [Escherichia coli 55989]
 gi|218363193|emb|CAR00835.1| GTP-binding protein [Escherichia coli IAI1]
 gi|218367709|emb|CAR05498.1| GTP-binding protein [Escherichia coli S88]
 gi|218371422|emb|CAR19255.1| GTP-binding protein [Escherichia coli IAI39]
 gi|218429715|emb|CAV18037.1| GTP-binding protein [Escherichia coli ED1a]
 gi|218434587|emb|CAR15516.1| GTP-binding protein [Escherichia coli UMN026]
 gi|242379402|emb|CAQ34216.1| cell division protein; predicted checkpoint GTPase [Escherichia
           coli BL21(DE3)]
 gi|253975717|gb|ACT41388.1| GTP-binding protein [Escherichia coli B str. REL606]
 gi|253979873|gb|ACT45543.1| GTP-binding protein [Escherichia coli BL21(DE3)]
 gi|300315049|gb|EFJ64833.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           175-1]
 gi|300359270|gb|EFJ75140.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           198-1]
 gi|300396884|gb|EFJ80422.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           69-1]
 gi|300402015|gb|EFJ85553.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           84-1]
 gi|300413838|gb|EFJ97148.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           115-1]
 gi|300417986|gb|EFK01297.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           182-1]
 gi|300452285|gb|EFK15905.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           116-1]
 gi|300457830|gb|EFK21323.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           21-1]
 gi|300460511|gb|EFK24004.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           187-1]
 gi|300523746|gb|EFK44815.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           119-7]
 gi|300528129|gb|EFK49191.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           107-1]
 gi|300841284|gb|EFK69044.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           124-1]
 gi|300845351|gb|EFK73111.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           78-1]
 gi|301073492|gb|EFK88298.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           146-1]
 gi|308118586|gb|EFO55848.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           145-7]
 gi|309704290|emb|CBJ03639.1| probable GTP-binding protein [Escherichia coli ETEC H10407]
 gi|310334227|gb|EFQ00432.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|315254226|gb|EFU34194.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           85-1]
 gi|315618770|gb|EFU99354.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|323161075|gb|EFZ46993.1| hypothetical protein ECE128010_2621 [Escherichia coli E128010]
 gi|323167490|gb|EFZ53197.1| hypothetical protein SS53G_2212 [Shigella sonnei 53G]
 gi|323174271|gb|EFZ59898.1| hypothetical protein ECLT68_1102 [Escherichia coli LT-68]
 gi|323177874|gb|EFZ63458.1| hypothetical protein ECOK1180_3470 [Escherichia coli 1180]
 gi|323182381|gb|EFZ67788.1| hypothetical protein ECOK1357_4237 [Escherichia coli 1357]
 gi|324019780|gb|EGB88999.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli MS
           117-3]
          Length = 198

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
            P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F   D  
Sbjct: 3   APDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVAD-- 60

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                     LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH +K +
Sbjct: 61  -------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDL 113

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS+K++
Sbjct: 114 DQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSSLKKQ 172

Query: 198 GIEVLRKAI 206
           G++ LR+ +
Sbjct: 173 GVDKLRQKL 181


>gi|331675323|ref|ZP_08376073.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           TA280]
 gi|331685601|ref|ZP_08386184.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           H299]
 gi|12518743|gb|AAG59053.1|AE005617_2 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|331067383|gb|EGI38788.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           TA280]
 gi|331077072|gb|EGI48287.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           H299]
          Length = 199

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
            P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F   D  
Sbjct: 4   APDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVAD-- 61

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                     LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH +K +
Sbjct: 62  -------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDL 114

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS+K++
Sbjct: 115 DQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSSLKKQ 173

Query: 198 GIEVLRKAI 206
           G++ LR+ +
Sbjct: 174 GVDKLRQKL 182


>gi|113869399|ref|YP_727888.1| ribosome biogenesis GTP-binding protein YsxC [Ralstonia eutropha
           H16]
 gi|123133546|sp|Q0K651|ENGB_CUPNH RecName: Full=Probable GTP-binding protein EngB
 gi|113528175|emb|CAJ94520.1| Predicted GTPase [Ralstonia eutropha H16]
          Length = 233

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 103/193 (53%), Gaps = 8/193 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PE+AF+GRSN GKS+ INIL N+K LA +S  PGRTQH+N+F     + +K   
Sbjct: 19  LPATAVPEVAFAGRSNAGKSTAINILCNQKRLAFSSRTPGRTQHINYF---SVAPVKAPD 75

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P   LVD+PGYGYA         W GL+  Y+  R  L  + L++D R     +D  +  
Sbjct: 76  PLAFLVDLPGYGYAEVSGSAKYHWQGLLSDYVQTRQQLSGLILMMDARRPFTDLDCQMVE 135

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT-----SSVKRKG 198
           +         ++LTK DKL+ +   + L +T+ +++ Y       +P      SS+KR+G
Sbjct: 136 WFLPTGRPIHVLLTKADKLTNSDNAKALRETRKMLQGYAEQMETPVPMTAQLFSSLKRRG 195

Query: 199 IEVLRKAILETIN 211
           IE  +  I   +N
Sbjct: 196 IEEAQGVIAGWLN 208


>gi|218550896|ref|YP_002384687.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia
           fergusonii ATCC 35469]
 gi|218358437|emb|CAQ91084.1| GTP-binding protein [Escherichia fergusonii ATCC 35469]
          Length = 198

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
            P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F   D  
Sbjct: 3   APDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVAD-- 60

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                     LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH +K +
Sbjct: 61  -------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDL 113

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS+K++
Sbjct: 114 DQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSSLKKQ 172

Query: 198 GIEVLRKAI 206
           G++ LR+ +
Sbjct: 173 GVDKLRQKL 181


>gi|295135644|ref|YP_003586320.1| GTPase EngB [Zunongwangia profunda SM-A87]
 gi|294983659|gb|ADF54124.1| GTPase EngB [Zunongwangia profunda SM-A87]
          Length = 200

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 99/186 (53%), Gaps = 11/186 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLN-FFV 72
           F+    ++   P +  PE AF GRSNVGKSSLIN+L  RKNLA+TS  PG+TQ +N F +
Sbjct: 8   FVVSNSKVAKCPNSPLPEYAFIGRSNVGKSSLINMLTGRKNLAKTSAKPGKTQLINHFLI 67

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
            K++           LVD+PGYGYA+  K     +   I  Y  ER  L C ++LID RH
Sbjct: 68  NKNWH----------LVDLPGYGYAKVSKSAKKVFQKFITNYFEERKQLVCAFVLIDSRH 117

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
             + ID +   +L + A+ + ++ TK DKL P   ++ +   +  +       P    TS
Sbjct: 118 KPQPIDMEFMQWLGEHAIPFCMIFTKADKLKPKELEKNILNYQEEMLQVWEQMPHFFVTS 177

Query: 193 SVKRKG 198
           S  + G
Sbjct: 178 STAKTG 183


>gi|157273342|gb|ABV27241.1| GTP-binding protein [Candidatus Chloracidobacterium thermophilum]
          Length = 201

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 77/193 (39%), Positives = 106/193 (54%), Gaps = 15/193 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL+        P    PE+AF GRSNVGKSSLIN L+  + LARTSN PGRTQ +NFF  
Sbjct: 8   FLKSATVAADYPPPTLPEVAFLGRSNVGKSSLINSLLGVRGLARTSNTPGRTQLINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                +   L     VD+PGYGYAR P+K  + W  +I  YL  RS L    L++D R  
Sbjct: 66  ----EINREL---RFVDLPGYGYARVPQKIRERWRPMIESYLYHRSALALCVLIVDVRLA 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            + +D+ ++ +L   +  + +V TK DKLS     + L +   L   Y    P+V+P SS
Sbjct: 119 PQPLDRTMYEWLVATSRPFCLVATKADKLS---RSQLLSQLSVLRAAY---GPDVLPYSS 172

Query: 194 VKRKGIEVLRKAI 206
           + R G + + +AI
Sbjct: 173 LTRAGADQVWEAI 185


>gi|260220214|emb|CBA27528.1| Probable GTP-binding protein engB [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 251

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 100/190 (52%), Gaps = 13/190 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++  LP+   PEIAF GRSN GKS+ IN L  +K LA  S  PGRTQH+N F  
Sbjct: 44  FLTTAPQLHFLPELDVPEIAFVGRSNAGKSTCINTLTQQKQLAFASKKPGRTQHINLFAL 103

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                 K       L D+PGYGYA  PK++   W  ++  YL  R  L+ + L+ D RHG
Sbjct: 104 G-----KQGATDAVLTDLPGYGYAAVPKQDKIRWQQVMANYLVTRKNLKAIVLMCDPRHG 158

Query: 134 VKQIDQ---DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP 190
           + ++D+   DV      + + + +VLTK DKL+ +   + L  TK           EV  
Sbjct: 159 MTELDEILLDVIRPRVAEGLKFLVVLTKADKLTRSEGAKVLSITK-----LQAGGGEVRL 213

Query: 191 TSSVKRKGIE 200
            S+ KR GI+
Sbjct: 214 FSATKRTGID 223


>gi|331644593|ref|ZP_08345712.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           H736]
 gi|331655546|ref|ZP_08356538.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           M718]
 gi|331665512|ref|ZP_08366410.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           TA143]
 gi|331670706|ref|ZP_08371542.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           TA271]
 gi|331679971|ref|ZP_08380633.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           H591]
 gi|26111058|gb|AAN83241.1|AE016770_41 Probable GTP-binding protein engB [Escherichia coli CFT073]
 gi|147313|gb|AAA24403.1| unidentified protein [Escherichia coli]
 gi|304970|gb|AAB02999.1| matches PS00017: ATP_GTP_A [Escherichia coli str. K-12 substr.
           MG1655]
 gi|73857847|gb|AAZ90554.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81243109|gb|ABB63819.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|91074985|gb|ABE09866.1| probable GTP-binding cell division protein [Escherichia coli UTI89]
 gi|331036055|gb|EGI08291.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           H736]
 gi|331046647|gb|EGI18732.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           M718]
 gi|331057197|gb|EGI29187.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           TA143]
 gi|331061961|gb|EGI33884.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           TA271]
 gi|331072297|gb|EGI43630.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli
           H591]
          Length = 199

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
            P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F   D  
Sbjct: 4   APDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVAD-- 61

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                     LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH +K +
Sbjct: 62  -------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDL 114

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS+K++
Sbjct: 115 DQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSSLKKQ 173

Query: 198 GIEVLRKAI 206
           G++ LR+ +
Sbjct: 174 GVDKLRQKL 182


>gi|30250379|ref|NP_842449.1| GTPase EngB [Nitrosomonas europaea ATCC 19718]
 gi|81584537|sp|Q82S94|ENGB_NITEU RecName: Full=Probable GTP-binding protein EngB
 gi|30181174|emb|CAD86370.1| putative GTP-binding protein [Nitrosomonas europaea ATCC 19718]
          Length = 222

 Score =  124 bits (311), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 107/200 (53%), Gaps = 14/200 (7%)

Query: 2   VSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNA 61
           ++H +F  +   F   V  +  LP+    E+AF+GRSN GKSS IN LV R+  A  S  
Sbjct: 1   MTHPLFRHAE--FYTTVNRLQDLPQTAGVEVAFAGRSNAGKSSAINTLVGRERFAFVSKT 58

Query: 62  PGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTL 121
           PGRTQH+NFF   +            +VD+PGYGYA+ P      WG L+  YL  R +L
Sbjct: 59  PGRTQHINFFQLGE---------ERFMVDLPGYGYAQVPLAIRQHWGHLLSSYLQTRQSL 109

Query: 122 RCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETL-EKTKYLIRN 180
             + L++D RH + ++D  +  +  +      ++LTK DKLS + A   L E  ++L  N
Sbjct: 110 YGMILIMDIRHPLTKLDLQMLDWFRQTKKPVHVLLTKADKLSKSRALVALNEVRQFLTVN 169

Query: 181 YPTAHPEVIPTSSVKRKGIE 200
           YP  H  V   SS+K  G+E
Sbjct: 170 YP--HCTVQTFSSLKVAGVE 187


>gi|319403767|emb|CBI77351.1| GTP-binding protein (fragment) [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 121

 Score =  124 bits (311), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 82/120 (68%)

Query: 91  MPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAV 150
           MPGYG+A APK  +++W  LI  YL  R+TL+ VY+LID RHG+K+ D D  + LDK AV
Sbjct: 1   MPGYGFAEAPKNLINAWTHLIFDYLRGRTTLKRVYVLIDSRHGIKKNDTDTLNLLDKAAV 60

Query: 151 SYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI 210
           SYQIVLTK DK+   T +  +  TK  +  +P A+PE++ TS+ K  G+E LR AI++ I
Sbjct: 61  SYQIVLTKSDKIKFNTLEALITMTKTKLLKHPAAYPEILVTSAEKASGLEELRAAIIQAI 120


>gi|224476764|ref|YP_002634370.1| ribosome biogenesis GTP-binding protein YsxC [Staphylococcus
           carnosus subsp. carnosus TM300]
 gi|254783209|sp|B9DNB9|ENGB_STACT RecName: Full=Probable GTP-binding protein EngB
 gi|222421371|emb|CAL28185.1| putative GTP-binding protein [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 195

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 102/182 (56%), Gaps = 11/182 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G  E+A +GRSNVGKS+ IN ++ RKN+ARTS  PG+TQ LNF+   D         
Sbjct: 21  PETGLEEVALAGRSNVGKSTFINSMIGRKNMARTSQQPGKTQTLNFYNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            M  VD+PGYGYA+  KK  + +G +I +Y+++R  L+ V  LID RH   + D  ++ F
Sbjct: 72  QMIFVDVPGYGYAKVSKKQREQFGKMIEKYITQREQLKVVVQLIDIRHNPTEDDVLMYDF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   I+ TK DK++    Q+ L+  K  +         +I  SSV  K  +V+  
Sbjct: 132 LKYYDLPVLIIATKEDKIAKGKVQKHLKNIKDKLE--LEEEDTIISYSSVTNKNQQVIWD 189

Query: 205 AI 206
           AI
Sbjct: 190 AI 191


>gi|256847018|ref|ZP_05552464.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           coleohominis 101-4-CHN]
 gi|256715682|gb|EEU30657.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           coleohominis 101-4-CHN]
          Length = 196

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 74/181 (40%), Positives = 102/181 (56%), Gaps = 14/181 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PEIA  GRSNVGKSSL N L+NRKN A TS+ PG+TQ LNF+  +D         
Sbjct: 19  PSTDYPEIALVGRSNVGKSSLTNALINRKNFAHTSSQPGKTQTLNFYNVED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  KK  + +G +I  YL++RS LR V +L+D RH     D  ++ +
Sbjct: 70  KLYFVDVPGYGYAKVSKKQREEFGQMIENYLTQRSQLRGVIMLVDGRHAPTADDVQMYQW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPT--TAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TKIDK+ P+  T  + L K K     +    P V+ ++  KR   +V 
Sbjct: 130 LAYYELPILVVATKIDKVKPSQFTRVQKLVKDKL---EFQEKQPLVLFSAMSKRGKEDVW 186

Query: 203 R 203
           R
Sbjct: 187 R 187


>gi|225870477|ref|YP_002746424.1| GTP-binding protein [Streptococcus equi subsp. equi 4047]
 gi|254783210|sp|C0MA50|ENGB_STRE4 RecName: Full=Probable GTP-binding protein EngB
 gi|225699881|emb|CAW93776.1| putative GTP-binding protein [Streptococcus equi subsp. equi 4047]
          Length = 199

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 99/184 (53%), Gaps = 11/184 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++ RK+LARTS+ PG+TQ LNFF   D         
Sbjct: 25  PQDDLPEIALAGRSNVGKSSFINTILGRKSLARTSSKPGKTQLLNFFNVDD--------- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            + LVD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   Q D  ++ F
Sbjct: 76  KLRLVDVPGYGYAKVSKAERARWGKMIEEYLTTRQNLRAVVSLVDFRHESSQDDIQMYEF 135

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+ P       E       N+      +I  SSV+R GI+    
Sbjct: 136 LKYYEIPVIIVATKADKV-PRGRWNKHESMVKKSLNFDQTDAFII-FSSVERIGIDESWD 193

Query: 205 AILE 208
            ILE
Sbjct: 194 TILE 197


>gi|320660847|gb|EFX28293.1| GTP-binding protein YsxC [Escherichia coli O55:H7 str. USDA 5905]
          Length = 198

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
            P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F   D  
Sbjct: 3   APDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVAD-- 60

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                     LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH +K +
Sbjct: 61  -------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDL 113

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS+K++
Sbjct: 114 DQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSSLKKQ 172

Query: 198 GIEVLRKAI 206
           G++ LR+ +
Sbjct: 173 GVDKLRQKL 181


>gi|294501425|ref|YP_003565125.1| hypothetical protein BMQ_4688 [Bacillus megaterium QM B1551]
 gi|295706773|ref|YP_003599848.1| hypothetical protein BMD_4674 [Bacillus megaterium DSM 319]
 gi|294351362|gb|ADE71691.1| GTP-binding conserved hypothetical protein [Bacillus megaterium QM
           B1551]
 gi|294804432|gb|ADF41498.1| conserved hypothetical protein [Bacillus megaterium DSM 319]
          Length = 195

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 90/148 (60%), Gaps = 9/148 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PE A +GRSNVGKSS IN ++NRK+LARTS+ PG+TQ LNFF+  +         
Sbjct: 19  PKENLPEFALAGRSNVGKSSFINKMLNRKSLARTSSKPGKTQTLNFFLINEI-------- 70

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYG+A+  KK  ++WG +I  YL+ R  L+ V +++D RH   + D  ++ F
Sbjct: 71  -LHFVDVPGYGFAKVSKKEREAWGKMIETYLTNREQLKAVLMIVDLRHAPSKDDVMMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLE 172
           L    +   ++ TK DK+     Q+ L+
Sbjct: 130 LKHHDLPVMVIATKADKIPKGKWQKHLK 157


>gi|51473248|ref|YP_067005.1| GTPase EngB [Rickettsia typhi str. Wilmington]
 gi|81610845|sp|Q68XW9|ENGB_RICTY RecName: Full=Probable GTP-binding protein EngB
 gi|51459560|gb|AAU03523.1| probable GTP-binding protein EngB [Rickettsia typhi str.
           Wilmington]
          Length = 214

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 109/202 (53%), Gaps = 18/202 (8%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+ G   I  +P    PEI F G+SNVGKSS+IN + N K+LA+ SN PGRT+ +NFF  
Sbjct: 26  FVAGANHINQIPDFSLPEIVFVGKSNVGKSSIINTICNNKSLAKVSNIPGRTRQINFF-- 83

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                  N +  + +VD+PGYG+A  P    + W  LI  YL     L  V LLID R G
Sbjct: 84  -------NIIDKLIIVDLPGYGFANVPISVKEQWEVLITYYLRNSHNLMLVNLLIDSRRG 136

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY-PTAH--PEVIP 190
           +K+ D+ V   L      +QI+ TK DK+   T ++ L    Y  +N+  T H    VI 
Sbjct: 137 IKENDKKVAELLLANKREFQIIFTKSDKV---TDRKNLN---YEAQNFLATLHYSCNVIY 190

Query: 191 TSSVKRKGIEVLRKAILETINY 212
            SS  ++G + L+ ++ + I Y
Sbjct: 191 VSSRSKEGTKELKASLAKCIKY 212


>gi|167761300|ref|ZP_02433427.1| hypothetical protein CLOSCI_03705 [Clostridium scindens ATCC 35704]
 gi|167660966|gb|EDS05096.1| hypothetical protein CLOSCI_03705 [Clostridium scindens ATCC 35704]
          Length = 200

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 71/178 (39%), Positives = 105/178 (58%), Gaps = 17/178 (9%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PEIAF+G+SNVGKSSLIN L+NRK+ AR S  PG+TQ +NF+         N  
Sbjct: 18  LPDNQLPEIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFY---------NIN 68

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + LVD+PGYGYA+  ++    WG LI RYL   + L+ V+LLID RH     D+ ++ 
Sbjct: 69  EELYLVDLPGYGYAKVSEQEKAKWGKLIERYLHGSAQLKAVFLLIDIRHDPSANDKMMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKY---LIRNYPTAHPEVIPTSSVKRKG 198
           ++  +  +  I+ TK+DK+  +   + L+  +    L+R       +V+P SSV ++G
Sbjct: 129 WIVAQGYNPIIIATKLDKIKRSQVDKHLKAVRQGLNLVRG-----TKVLPFSSVTKQG 181


>gi|69246839|ref|ZP_00604148.1| GTP-binding protein [Enterococcus faecium DO]
 gi|257878468|ref|ZP_05658121.1| GTP-binding protein [Enterococcus faecium 1,230,933]
 gi|257882890|ref|ZP_05662543.1| GTP-binding protein [Enterococcus faecium 1,231,502]
 gi|257889332|ref|ZP_05668985.1| GTP-binding protein [Enterococcus faecium 1,231,410]
 gi|257894345|ref|ZP_05673998.1| GTP-binding protein [Enterococcus faecium 1,231,408]
 gi|258616007|ref|ZP_05713777.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           DO]
 gi|260560057|ref|ZP_05832235.1| GTP-binding protein [Enterococcus faecium C68]
 gi|261207454|ref|ZP_05922140.1| GTP-binding protein [Enterococcus faecium TC 6]
 gi|289565865|ref|ZP_06446306.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           D344SRF]
 gi|293559816|ref|ZP_06676334.1| GTP-binding protein [Enterococcus faecium E1162]
 gi|293568081|ref|ZP_06679418.1| GTP-binding protein [Enterococcus faecium E1071]
 gi|294617406|ref|ZP_06697040.1| GTP-binding protein [Enterococcus faecium E1679]
 gi|294623405|ref|ZP_06702261.1| GTP-binding protein [Enterococcus faecium U0317]
 gi|314939703|ref|ZP_07846927.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           TX0133a04]
 gi|314942231|ref|ZP_07849083.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           TX0133C]
 gi|314948864|ref|ZP_07852234.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           TX0082]
 gi|314950806|ref|ZP_07853878.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           TX0133A]
 gi|314993229|ref|ZP_07858608.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           TX0133B]
 gi|314995228|ref|ZP_07860341.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           TX0133a01]
 gi|68195072|gb|EAN09534.1| GTP-binding protein [Enterococcus faecium DO]
 gi|257812696|gb|EEV41454.1| GTP-binding protein [Enterococcus faecium 1,230,933]
 gi|257818548|gb|EEV45876.1| GTP-binding protein [Enterococcus faecium 1,231,502]
 gi|257825692|gb|EEV52318.1| GTP-binding protein [Enterococcus faecium 1,231,410]
 gi|257830724|gb|EEV57331.1| GTP-binding protein [Enterococcus faecium 1,231,408]
 gi|260073892|gb|EEW62216.1| GTP-binding protein [Enterococcus faecium C68]
 gi|260078345|gb|EEW66050.1| GTP-binding protein [Enterococcus faecium TC 6]
 gi|289162325|gb|EFD10184.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           D344SRF]
 gi|291589163|gb|EFF20974.1| GTP-binding protein [Enterococcus faecium E1071]
 gi|291596312|gb|EFF27571.1| GTP-binding protein [Enterococcus faecium E1679]
 gi|291597171|gb|EFF28366.1| GTP-binding protein [Enterococcus faecium U0317]
 gi|291606235|gb|EFF35651.1| GTP-binding protein [Enterococcus faecium E1162]
 gi|313590558|gb|EFR69403.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           TX0133a01]
 gi|313592284|gb|EFR71129.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           TX0133B]
 gi|313597021|gb|EFR75866.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           TX0133A]
 gi|313599003|gb|EFR77848.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           TX0133C]
 gi|313641038|gb|EFS05618.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           TX0133a04]
 gi|313644737|gb|EFS09317.1| ribosome biogenesis GTP-binding protein YsxC [Enterococcus faecium
           TX0082]
          Length = 195

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 83/138 (60%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PEIA +GRSNVGKSS IN L++RKNLARTS  PG+TQ LNF++ ++         
Sbjct: 19  PDTQLPEIALAGRSNVGKSSFINTLIDRKNLARTSGKPGKTQTLNFYLIEN--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+  VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   Q D  ++ F
Sbjct: 70  ALHFVDVPGYGYAKVSKTERAKWGKMIETYLTTRDQLRAVVSLVDLRHKPSQEDIQMYQF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   +V TK DK+
Sbjct: 130 LKYYDIPVIVVATKADKI 147


>gi|146299560|ref|YP_001194151.1| GTPase EngB [Flavobacterium johnsoniae UW101]
 gi|189037178|sp|A5FIZ1|ENGB_FLAJ1 RecName: Full=Probable GTP-binding protein EngB
 gi|146153978|gb|ABQ04832.1| GTP-binding protein, HSR1-related [Flavobacterium johnsoniae UW101]
          Length = 210

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 74/196 (37%), Positives = 102/196 (52%), Gaps = 10/196 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    +    PK   PE AF GRSNVGKSSLIN++ N KNLA+TS  PG+TQ +N F  
Sbjct: 8   FIVSNSDAAKCPKDFLPEYAFIGRSNVGKSSLINMITNHKNLAKTSGKPGKTQLINHF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                + NN     LVD+PGYGYA+  KK    +   I  Y   R  L C ++LID RH 
Sbjct: 66  ----KINNNW---FLVDLPGYGYAKVSKKTKSIFQQFITDYFENREQLVCAFVLIDIRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEK-TKYLIRNYPTAHPEVIPTS 192
            ++ID +  S++ +  + + I+ TK DK+S       +    K +  N     P+   TS
Sbjct: 119 AQKIDIEFMSYMGESEIPFCIIFTKADKISKGKIDSHIAAYRKQMYANNWAEMPQYFVTS 178

Query: 193 SVKRKGIEVLRKAILE 208
           S +  G + L   I E
Sbjct: 179 STESIGKDELLTYIDE 194


>gi|329116776|ref|ZP_08245493.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           parauberis NCFD 2020]
 gi|326907181|gb|EGE54095.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           parauberis NCFD 2020]
          Length = 199

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 102/188 (54%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PEIA +GRSNVGKSS IN ++ RKNLARTS+ PG+TQ LNFF      N+ + L 
Sbjct: 25  PDDDLPEIALAGRSNVGKSSFINTILGRKNLARTSSKPGKTQLLNFF------NIDDKL- 77

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 78  --RFVDVPGYGYAKVSKSERAKWGKMIEEYLTTRDNLRAVVSLVDLRHEPSTEDVQMYDF 135

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E++ K K    N+  +  + I  SSV R GI+  
Sbjct: 136 LKYYEIPVIVVATKADKIPRGKWNKHESMVKKKL---NFDKS-DQFIVFSSVDRIGIDQA 191

Query: 203 RKAILETI 210
              IL+ I
Sbjct: 192 WDTILDQI 199


>gi|160933533|ref|ZP_02080921.1| hypothetical protein CLOLEP_02379 [Clostridium leptum DSM 753]
 gi|156867410|gb|EDO60782.1| hypothetical protein CLOLEP_02379 [Clostridium leptum DSM 753]
          Length = 199

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 97/185 (52%), Gaps = 12/185 (6%)

Query: 22  GLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN 81
           G LP    PEI FSG+SNVGKSSLIN L+NRKNLAR S  PG+T  +NF+          
Sbjct: 16  GQLPAGDLPEIVFSGKSNVGKSSLINKLLNRKNLARVSATPGKTATINFY---------- 65

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDV 141
            L    LVD+PGYGYA+        W  L+  Y  +   L  V  L+D RH   + D  +
Sbjct: 66  RLDQARLVDLPGYGYAKVSLAEKKRWAELVEGYFQQERNLALVVQLVDMRHPPTKDDLHM 125

Query: 142 FSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEV 201
             FL      + + LTK DKL+ T  ++ L   +    +Y      +IP SSV  +G+E 
Sbjct: 126 IEFLCDGGFPFLVALTKSDKLNQTERRQRLAALEEAFSDYEGLR--LIPFSSVTGEGVEE 183

Query: 202 LRKAI 206
           LR+ +
Sbjct: 184 LREIL 188


>gi|291563762|emb|CBL42578.1| ribosome biogenesis GTP-binding protein YsxC/EngB
           [butyrate-producing bacterium SS3/4]
          Length = 226

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 106/179 (59%), Gaps = 15/179 (8%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PE AF+G+SNVGKSSLIN L+NRK LARTS+ PG+TQ +NF+      N+  +L
Sbjct: 18  LPENTLPEFAFAGKSNVGKSSLINALMNRKALARTSSQPGKTQTINFY------NINGDL 71

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
                VD+PGYGYA+ P+     WG +I  YL +   L+CV+LL+D RH     D+ ++ 
Sbjct: 72  ---YYVDLPGYGYAKVPQSEKVKWGRMIENYLHKSQMLKCVFLLVDIRHEPSANDKTMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIE 200
           ++        I+ TK+DK+  +  Q+ ++    LIR       +  +IP S+  ++G E
Sbjct: 129 WIVYNGFRPVIIATKLDKIKRSQIQKQVK----LIRTGLGMEKQDILIPFSAETKQGRE 183


>gi|225378746|ref|ZP_03755967.1| hypothetical protein ROSEINA2194_04416 [Roseburia inulinivorans DSM
           16841]
 gi|225209405|gb|EEG91759.1| hypothetical protein ROSEINA2194_04416 [Roseburia inulinivorans DSM
           16841]
          Length = 204

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 105/176 (59%), Gaps = 11/176 (6%)

Query: 31  EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVD 90
           E+AF+G+SNVGKSS+IN L+NRK+LARTS  PG+TQ +NF+   D         AM LVD
Sbjct: 25  EVAFAGKSNVGKSSMINALLNRKSLARTSAQPGKTQTINFYNVND---------AMYLVD 75

Query: 91  MPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAV 150
           +PGYGYA+      + WG +I  YL     L+ V+LLID RH     D+ ++ ++  +  
Sbjct: 76  LPGYGYAKTSSSEKEKWGKMIENYLHTSKKLQAVFLLIDIRHDPSANDKMMYDWMVYQGF 135

Query: 151 SYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAI 206
           +  I+ TK+DK+  +  Q+ ++  +  ++  P     +IP SS  ++G + L + I
Sbjct: 136 TPIIIATKLDKIKRSQIQKNVKAIREGLKVKPGTV--IIPFSSETKQGRDELWEVI 189


>gi|192361932|ref|YP_001983930.1| putative GTPase [Cellvibrio japonicus Ueda107]
 gi|190688097|gb|ACE85775.1| putative GTPase, involved in coordination of cell cycle (EngB)
           [Cellvibrio japonicus Ueda107]
          Length = 219

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 107/198 (54%), Gaps = 11/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P I   P     E+AF+GRSN GKSS IN L N   LARTS  PGRTQ +NFF  
Sbjct: 12  FLTSAPSIRQCPPETGREVAFAGRSNAGKSSAINALTNNHRLARTSKTPGRTQLINFFTL 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D         A  LVD+PGYGYA+  ++  + W   +  YL  R TL+ + LL+D RH 
Sbjct: 72  GD--------EAYRLVDLPGYGYAKVSRELKEQWQRDLSEYLERRKTLQGLVLLMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVI--PT 191
           +++ D  +  +  +  +   I+LTK DKLS +    TL K    ++N      ++   P 
Sbjct: 124 LQEFDSAILHWAMQGQMPVHILLTKADKLSRSQVNNTLFKVHKELKNLGLHDNKLSLQPF 183

Query: 192 SSVKRKGIEVLRKAILET 209
           S++   G++ L K++L++
Sbjct: 184 SALSNSGVDEL-KSVLQS 200


>gi|219856299|ref|YP_002473421.1| hypothetical protein CKR_2956 [Clostridium kluyveri NBRC 12016]
 gi|219570023|dbj|BAH08007.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 201

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 104/188 (55%), Gaps = 11/188 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK    EIAF GRSNVGKSSLIN L NRK L + S  PG+T+ +NFF       L NN  
Sbjct: 23  PKDKRIEIAFVGRSNVGKSSLINALTNRKKLVKVSGTPGKTRLINFF-------LINN-- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K    SWG ++  YL  R  L+ V LL+DCRH     D  ++ +
Sbjct: 74  EFYFVDLPGYGYAKISKTEKKSWGKVVEDYLRGREELKRVILLLDCRHKPTNDDITMYKW 133

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L     +  IV TK+DK+S +   + L+  K  ++  P    E++  SS+ ++G E   K
Sbjct: 134 LKYYNYNTIIVATKVDKVSKSQLFKNLKIIKDTLK--PETGDEILTFSSLNKQGKEEFLK 191

Query: 205 AILETINY 212
            +   I++
Sbjct: 192 VLESVIDF 199


>gi|117620801|ref|YP_854796.1| ribosome biogenesis GTP-binding protein YsxC [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|166225937|sp|A0KEY0|ENGB_AERHH RecName: Full=Probable GTP-binding protein EngB
 gi|117562208|gb|ABK39156.1| GTP-binding protein YihA [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 216

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 103/194 (53%), Gaps = 12/194 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP  G  EIAF+GRSN GKSS +N L   KNLARTS  PGRTQ +N F  
Sbjct: 13  FVTSAPDIRHLPNDGGVEIAFAGRSNAGKSSALNTLTKHKNLARTSKTPGRTQLINLFEL 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA+ P +    W   +  YL  R +L+ + +L+D RH 
Sbjct: 73  E---------PGKRLVDLPGYGYAQVPLEMKLKWQKSLAEYLQRRESLKGLVILMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY-PTAHPEVIPTS 192
           +K  D ++  +   + +   ++LTK DKLSP      + K +  +    P    E    S
Sbjct: 124 LKDTDMNMLEWSSHRKLPVMLLLTKADKLSPGPRNNQVIKVRQAVAELGPQIQVEAF--S 181

Query: 193 SVKRKGIEVLRKAI 206
           S+ + G+E L + +
Sbjct: 182 SLTQIGVEKLAQTL 195


>gi|326803637|ref|YP_004321455.1| ribosome biogenesis GTP-binding protein YsxC [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326650781|gb|AEA00964.1| ribosome biogenesis GTP-binding protein YsxC [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 200

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 100/187 (53%), Gaps = 15/187 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P +  PEIA +GRSNVGKSS IN + N K +AR S+ PG+TQ LN++      NL N+L 
Sbjct: 20  PVSDRPEIALAGRSNVGKSSFINTMTNHKKIARISSKPGKTQQLNYY------NLDNSL- 72

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  K     W   +  Y  +R  L  V+LL+D RH   + D ++  F
Sbjct: 73  --YLVDVPGYGYAKVSKTERSRWQKQLADYFIQRENLEAVFLLVDFRHRPSKDDINMKDF 130

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           LD+  V Y I+ TK DK+        L+  K  +        +++P SS  R+G    R 
Sbjct: 131 LDQCQVPYFIIATKADKVKKNQWHNHLQAIKEDLD--LVTEDQILPYSSANREG----RD 184

Query: 205 AILETIN 211
              E IN
Sbjct: 185 EAWEVIN 191


>gi|152990528|ref|YP_001356250.1| GTP-binding protein [Nitratiruptor sp. SB155-2]
 gi|151422389|dbj|BAF69893.1| GTP-binding protein [Nitratiruptor sp. SB155-2]
          Length = 202

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 79/200 (39%), Positives = 110/200 (55%), Gaps = 16/200 (8%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P I   P A   E+AF GRSNVGKSSL+N L +RKNLA++S  PG+T+ +NFF  
Sbjct: 9   FVTSAPTIKQAPPASMSEVAFLGRSNVGKSSLLNALTDRKNLAKSSATPGKTKLINFF-D 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            ++       P +  VD+PGYGYA+A K   + W   + ++L+ R  +R    LID RH 
Sbjct: 68  VEYKIGDKRFP-LRFVDLPGYGYAKASKTLKNEWQKHLTQFLANRDAIRVFVHLIDARHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVL---TKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP 190
              ID+   SFL       QIV+   TK DKL     Q+ L   K   + YP A    + 
Sbjct: 127 YMMIDEQTRSFLQSIKKKDQIVIEVFTKADKLK----QKELAALK---KRYPNA----LL 175

Query: 191 TSSVKRKGIEVLRKAILETI 210
            S++ ++GIE L+  ILE +
Sbjct: 176 ISNMTKRGIEELKHKILEHV 195


>gi|81247620|gb|ABB68328.1| conserved hypothetical protein [Shigella boydii Sb227]
          Length = 199

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
            P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F   D  
Sbjct: 4   APDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVAD-- 61

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                     LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH +K +
Sbjct: 62  -------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRHSLQGLVVLMDIRHPLKDL 114

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS+K++
Sbjct: 115 DQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSSLKKQ 173

Query: 198 GIEVLRKAI 206
           G++ LR+ +
Sbjct: 174 GVDKLRQKL 182


>gi|194290991|ref|YP_002006898.1| ribosome biogenesis gtp-binding protein ysxc [Cupriavidus
           taiwanensis LMG 19424]
 gi|238692783|sp|B3R7D7|ENGB_CUPTR RecName: Full=Probable GTP-binding protein EngB
 gi|193224826|emb|CAQ70837.1| GTPase binding protein, involved in coordination of cell cycle
           [Cupriavidus taiwanensis LMG 19424]
          Length = 237

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 103/193 (53%), Gaps = 8/193 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PE+AF+GRSN GKS+ INIL N+K LA +S  PGRTQH+N+F     + +K   
Sbjct: 19  LPATAVPEVAFAGRSNAGKSTAINILCNQKRLAFSSRTPGRTQHINYF---SVAPVKAPD 75

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P   LVD+PGYGYA         W GL+  Y+  R  L  + L++D R     +D  +  
Sbjct: 76  PLAFLVDLPGYGYAEVSGSAKYHWQGLLSDYVQTRQQLAGLILMMDARRPFTDLDCQMVE 135

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT-----SSVKRKG 198
           +         ++LTK DKL+ +   + L +T+ +++ Y       +P      SS+KR+G
Sbjct: 136 WFLPTGRPIHVLLTKADKLTNSENAKALRETRKMLQGYAEQLETPVPMTAQLFSSLKRRG 195

Query: 199 IEVLRKAILETIN 211
           IE  +  I   +N
Sbjct: 196 IEEAQAVIAGWLN 208


>gi|153955957|ref|YP_001396722.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium kluyveri
           DSM 555]
 gi|189037173|sp|A5N2K5|ENGB_CLOK5 RecName: Full=Probable GTP-binding protein EngB
 gi|146348815|gb|EDK35351.1| EngB [Clostridium kluyveri DSM 555]
          Length = 197

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 104/188 (55%), Gaps = 11/188 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK    EIAF GRSNVGKSSLIN L NRK L + S  PG+T+ +NFF       L NN  
Sbjct: 19  PKDKRIEIAFVGRSNVGKSSLINALTNRKKLVKVSGTPGKTRLINFF-------LINN-- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K    SWG ++  YL  R  L+ V LL+DCRH     D  ++ +
Sbjct: 70  EFYFVDLPGYGYAKISKTEKKSWGKVVEDYLRGREELKRVILLLDCRHKPTNDDITMYKW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L     +  IV TK+DK+S +   + L+  K  ++  P    E++  SS+ ++G E   K
Sbjct: 130 LKYYNYNTIIVATKVDKVSKSQLFKNLKIIKDTLK--PETGDEILTFSSLNKQGKEEFLK 187

Query: 205 AILETINY 212
            +   I++
Sbjct: 188 VLESVIDF 195


>gi|116512007|ref|YP_809223.1| GTPase EngB [Lactococcus lactis subsp. cremoris SK11]
 gi|125624159|ref|YP_001032642.1| GTPase EngB [Lactococcus lactis subsp. cremoris MG1363]
 gi|13124218|sp|Q9L6G1|ENGB_LACLM RecName: Full=Probable GTP-binding protein EngB
 gi|123320395|sp|Q02Z21|ENGB_LACLS RecName: Full=Probable GTP-binding protein EngB
 gi|7546984|gb|AAF63739.1|AF236863_3 hypothetical GTP-binding protein [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|24935311|gb|AAN64304.1| YsxL protein [Lactococcus lactis subsp. cremoris MG1363]
 gi|116107661|gb|ABJ72801.1| Predicted GTPase [Lactococcus lactis subsp. cremoris SK11]
 gi|124492967|emb|CAL97930.1| Probable GTP-binding protein engB [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300070935|gb|ADJ60335.1| ribosome biogenesis GTP-binding protein YsxC [Lactococcus lactis
           subsp. cremoris NZ9000]
          Length = 195

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/184 (40%), Positives = 99/184 (53%), Gaps = 11/184 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKN ARTS  PG+TQ LNF+   D         
Sbjct: 21  PENDWPEIALAGRSNVGKSSFINTLLNRKNFARTSGQPGKTQLLNFYNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK  + WG +I  YL+ R  L+ V  L+D RH   + D  ++ F
Sbjct: 72  QLHFVDVPGYGYARVSKKEREKWGKMIEEYLTTRENLKAVVSLVDIRHEPSEDDLMMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   +V TK DK+      +     K  ++   T   + I  SS  + GIE    
Sbjct: 132 LKYYHIPVILVATKADKVPRGKWNKHESIIKKAMKFDST--DDFIIFSSTDKTGIEEAWT 189

Query: 205 AILE 208
           AIL+
Sbjct: 190 AILK 193


>gi|182681243|ref|YP_001829403.1| ribosome biogenesis GTP-binding protein YsxC [Xylella fastidiosa
           M23]
 gi|182631353|gb|ACB92129.1| GTP-binding protein HSR1-related [Xylella fastidiosa M23]
          Length = 219

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/183 (36%), Positives = 98/183 (53%), Gaps = 9/183 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP     E+AF+GRSN GKSS++N L  +  LAR S  PGRTQ L +F            
Sbjct: 36  LPSDDGSEVAFAGRSNAGKSSVLNTLTRQNALARVSKTPGRTQQLVYFTVT--------- 86

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P   LVD+PGYGYA+ PK+    W   I  Y   R +LR + +++D RH +K+ D  + +
Sbjct: 87  PQRYLVDLPGYGYAKVPKELQIHWQAFIDTYFHHRQSLRGLVVVMDIRHPLKEYDLQMLA 146

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +  ++ +  Q +LTK DKL      +TL+K +  +  +   H  +   SS  R+G+E L 
Sbjct: 147 YARQRGLPAQALLTKADKLGRGQQAQTLQKVRNELTKHFADHINIQTFSSKSRQGVEQLH 206

Query: 204 KAI 206
             I
Sbjct: 207 TVI 209


>gi|313887819|ref|ZP_07821499.1| ribosome biogenesis GTP-binding protein YsxC [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312846162|gb|EFR33543.1| ribosome biogenesis GTP-binding protein YsxC [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 198

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 99/177 (55%), Gaps = 13/177 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P     E AF+GRSNVGKSS IN ++NRKNLARTS+ PG+T+ +NF+   D         
Sbjct: 19  PDTSIKEFAFAGRSNVGKSSFINAMLNRKNLARTSSTPGKTRTINFYKVND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            + LVD+PGYGYA+  K   + W G+I RYL  R  L    LL+D RH    +D+ ++ +
Sbjct: 70  DLRLVDLPGYGYAKVAKTEKEKWAGIINRYLEHRDNLVETILLVDIRHEPTALDKQMYDY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE-VIPTSSVKRKGIE 200
           + +   S  ++ TK DK+  +   + +     + +     H E +IP SS K+  ++
Sbjct: 130 IIESGFSGIVIATKKDKIKKSQVDKHIS---VIAKKLGVKHKENIIPFSSSKKDEVK 183


>gi|110807451|ref|YP_690971.1| ribosome biogenesis GTP-binding protein YsxC [Shigella flexneri 5
           str. 8401]
 gi|30043106|gb|AAP18828.1| hypothetical protein S3811 [Shigella flexneri 2a str. 2457T]
 gi|56384010|gb|AAN45370.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|110616999|gb|ABF05666.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|332751660|gb|EGJ82059.1| hypothetical protein SF434370_3790 [Shigella flexneri 4343-70]
          Length = 198

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
            P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F   D  
Sbjct: 3   APDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVAD-- 60

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                     LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH +K +
Sbjct: 61  -------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDL 113

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           DQ +  +     ++  ++LTK DKL+    +  L   +  +  +     +V   SS+K++
Sbjct: 114 DQQMIEWAVDSNIAVLVLLTKADKLASGARKALLNMVREAVLAF-NGDVQVETFSSLKKQ 172

Query: 198 GIEVLRKAI 206
           G++ LR+ +
Sbjct: 173 GVDKLRQKL 181


>gi|161505499|ref|YP_001572611.1| hypothetical protein SARI_03659 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160866846|gb|ABX23469.1| hypothetical protein SARI_03659 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 198

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
            P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F   D  
Sbjct: 3   APDIRHLPSDSGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVVD-- 60

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                     LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH +K +
Sbjct: 61  -------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDL 113

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           DQ +  +  +  +   ++LTK DKL+    +  L   +  +  +     +V   SS+K++
Sbjct: 114 DQQMIQWAVESNIQVLVLLTKADKLASGARKAQLNIVREAVLAF-NGDVQVEAFSSLKKQ 172

Query: 198 GIEVLRKAI 206
           G++ LR+ +
Sbjct: 173 GVDKLRQKL 181


>gi|294792179|ref|ZP_06757327.1| ribosome biogenesis GTP-binding protein YsxC [Veillonella sp.
           6_1_27]
 gi|294457409|gb|EFG25771.1| ribosome biogenesis GTP-binding protein YsxC [Veillonella sp.
           6_1_27]
          Length = 232

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 106/187 (56%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF---VPKDFSNLKN 81
           P+    EIAF GRSNVGKSSLIN L N + LA  S  PG+T+ +N+F     +D S+ + 
Sbjct: 43  PEGDTVEIAFLGRSNVGKSSLINSLCNYRGLALVSGQPGKTKTINYFDIESKEDISDTEE 102

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYL--SERSTLRCVYLLIDCRHGVKQIDQ 139
                 LVD+PGYG+A+  K N + W   I  Y+  SER  L C  LLID RH    ID+
Sbjct: 103 RRYNWFLVDLPGYGFAKTNKGNRNLWSSFIADYILHSERLMLLC--LLIDGRHPEMAIDK 160

Query: 140 DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI 199
             F +L +  V  QIV+TK DKL+       L   K L   YPTA P ++  SS+K  G 
Sbjct: 161 VAFDWLVEAGVPLQIVVTKADKLTAKEKSANLSIIKEL---YPTATPPIL-YSSLKHTGR 216

Query: 200 EVLRKAI 206
           E+L++ I
Sbjct: 217 ELLQQRI 223


>gi|187925584|ref|YP_001897226.1| ribosome biogenesis GTP-binding protein YsxC [Burkholderia
           phytofirmans PsJN]
 gi|238689618|sp|B2T719|ENGB_BURPP RecName: Full=Probable GTP-binding protein EngB
 gi|187716778|gb|ACD18002.1| GTP-binding protein HSR1-related [Burkholderia phytofirmans PsJN]
          Length = 217

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 102/197 (51%), Gaps = 9/197 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP    PEI F+GRSN GKS+ INIL N+K LA  S  PGRTQH+N+   
Sbjct: 10  FFTTVNHLRDLPATSQPEICFAGRSNAGKSTAINILCNQKRLAFASKTPGRTQHINY--- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
             FS  K + P   LVD+PGYGYA  P      W  L+  YL  RS LR + L++D R  
Sbjct: 67  --FSVGKADEPTAHLVDLPGYGYAEVPGAAKAHWEALLSTYLQTRSQLRGMILMMDSRRP 124

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT-- 191
           +  +D+ +  +          +LTK DKL+   +   L  T+  +  Y TA  +   T  
Sbjct: 125 LTDLDRRMIEWFAPTGKPIHTLLTKCDKLTRQESVNALRATQKGLAEYRTAGYQGELTAQ 184

Query: 192 --SSVKRKGIEVLRKAI 206
             S++KR GI+   + I
Sbjct: 185 LFSALKRVGIDEAHELI 201


>gi|73667065|ref|YP_303081.1| GTPase EngB [Ehrlichia canis str. Jake]
 gi|119369194|sp|Q3YS22|ENGB_EHRCJ RecName: Full=Probable GTP-binding protein EngB
 gi|72394206|gb|AAZ68483.1| GTP-binding domain [Ehrlichia canis str. Jake]
          Length = 200

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 111/198 (56%), Gaps = 12/198 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-V 72
           F+ G   +   P    PEIA +GRSNVGKSSLIN + N K  A+TS+ PG T+ +NF+ +
Sbjct: 12  FIIGATHVKSFPNFSIPEIAIAGRSNVGKSSLINAITNNKKNAKTSSRPGCTKQINFYLI 71

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
            K F         M LVD+PGYGY++A +  ++++  L+  YL     L  V LLID + 
Sbjct: 72  NKSF---------MVLVDLPGYGYSKATRATINNYLFLMEYYLLNSKNLLKVILLIDVKV 122

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
           G K+ID D  ++L+   + YQ+VLTKID++S       +   K L   +   +P VI  S
Sbjct: 123 GFKEIDLDFINWLELNHIYYQLVLTKIDRVSKEILDVNINYIKNLNLGF-VIYP-VISAS 180

Query: 193 SVKRKGIEVLRKAILETI 210
           S  ++GI  L   I + I
Sbjct: 181 SKYKQGIGELIYEIAQCI 198


>gi|148284762|ref|YP_001248852.1| GTP-binding protein [Orientia tsutsugamushi str. Boryong]
 gi|146740201|emb|CAM80484.1| Hypothetical GTP-binding protein [Orientia tsutsugamushi str.
           Boryong]
          Length = 186

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 103/192 (53%), Gaps = 13/192 (6%)

Query: 17  GVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDF 76
           G       P    PE  F G+SNVGKSSLIN+L N+ +LAR S  PGRT+ +NFF+  + 
Sbjct: 3   GASHKSQFPATNLPEFVFVGKSNVGKSSLINLLCNKHSLARVSKTPGRTREINFFLIAN- 61

Query: 77  SNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQ 136
                    + LVD+PGYGY++       +W  LI+ YL +R  LR +Y+LID R G+K 
Sbjct: 62  --------KLILVDLPGYGYSKTAVVTCKNWEKLILSYLEDRKNLRLIYVLIDARRGIKD 113

Query: 137 IDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKR 196
            D  V + +     + +IV TK DK+S       +  +K L+      + ++I TS   +
Sbjct: 114 NDLAVINLVHHFNYTMKIVFTKEDKISDLEKNSLIATSKNLL----DYNDKIIFTSIRNK 169

Query: 197 KGIEVLRKAILE 208
            G + ++  IL+
Sbjct: 170 NGTQEIQYNILK 181


>gi|197364777|ref|YP_002144414.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|197096254|emb|CAR61852.1| ATP/GTP-binding protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|261249117|emb|CBG26978.1| ATP/GTP-binding protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|301160509|emb|CBW20039.1| ATP/GTP-binding protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
          Length = 199

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
            P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F   D  
Sbjct: 4   APDIRHLPSDCGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVVD-- 61

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                     LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH +K +
Sbjct: 62  -------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDL 114

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           DQ +  +  +  +   ++LTK DKL+    +  L   +  +  +     +V   SS+K++
Sbjct: 115 DQQMIQWAVESNIQVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVEAFSSLKKQ 173

Query: 198 GIEVLRKAI 206
           G++ LR+ +
Sbjct: 174 GVDKLRQKL 182


>gi|322421712|ref|YP_004200935.1| ribosome biogenesis GTP-binding protein YsxC [Geobacter sp. M18]
 gi|320128099|gb|ADW15659.1| ribosome biogenesis GTP-binding protein YsxC [Geobacter sp. M18]
          Length = 211

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/151 (45%), Positives = 93/151 (61%), Gaps = 11/151 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-V 72
           F++        P+   PEIAF+GRSNVGKSSL+N+LVNRK+L RTS+ PGRTQ +NFF V
Sbjct: 8   FIKSATRPAHYPEGNLPEIAFAGRSNVGKSSLVNVLVNRKSLVRTSSTPGRTQLINFFQV 67

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
             DF           LVD+PGYGYA+ P      W  ++  YL++R+ LR V L++D R 
Sbjct: 68  NDDF----------MLVDLPGYGYAKVPLAVKKDWRPMMETYLAKRANLRGVVLILDIRR 117

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
              + D  + ++L   +V   IV+TK DKLS
Sbjct: 118 VPNEDDLQMLAWLRAYSVPPIIVVTKCDKLS 148


>gi|206575834|ref|YP_002241256.1| putative GTP-binding protein EngB [Klebsiella pneumoniae 342]
 gi|288937895|ref|YP_003441954.1| ribosome biogenesis GTP-binding protein YsxC [Klebsiella variicola
           At-22]
 gi|290513118|ref|ZP_06552481.1| ribosome biogenesis GTP-binding protein YsxC [Klebsiella sp.
           1_1_55]
 gi|238058986|sp|B5XZJ3|ENGB_KLEP3 RecName: Full=Probable GTP-binding protein EngB
 gi|206564892|gb|ACI06668.1| putative GTP-binding protein EngB [Klebsiella pneumoniae 342]
 gi|288892604|gb|ADC60922.1| ribosome biogenesis GTP-binding protein YsxC [Klebsiella variicola
           At-22]
 gi|289774500|gb|EFD82505.1| ribosome biogenesis GTP-binding protein YsxC [Klebsiella sp.
           1_1_55]
          Length = 210

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVTSAPDIRHLPADTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            LVD+PGYGYA+ P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 71  AE---------GKRLVDLPGYGYAQVPEEMKIKWQRALGEYLEKRLCLKGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +  +  +   ++LTK DKL+    +  +   +  +  +     +V P SS
Sbjct: 122 LKDLDQQMIEWAVESDIQVLVLLTKADKLASGARKAQVNMVREAVLAF-NGDIQVEPFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 181 LKKSGVDKLRQKL 193


>gi|153854550|ref|ZP_01995820.1| hypothetical protein DORLON_01815 [Dorea longicatena DSM 13814]
 gi|149752859|gb|EDM62790.1| hypothetical protein DORLON_01815 [Dorea longicatena DSM 13814]
          Length = 196

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/175 (40%), Positives = 103/175 (58%), Gaps = 11/175 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PEIAF+G+SNVGKSSLIN L+NRK+ AR S  PG+TQ +NF+         N  
Sbjct: 18  LPENTLPEIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFY---------NIN 68

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + LVD+PGYGYA+  ++    WG LI RYL     L+ V+LLID RH     D+ ++ 
Sbjct: 69  EELYLVDLPGYGYAKVSEQEKIKWGQLIERYLHGSKQLKVVFLLIDIRHKPSGNDKMMYE 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           ++  +  +  I+ TK+DK+  +   + ++  K  +   P     VIP SSV ++G
Sbjct: 129 WIVSQGFNPVIIATKLDKIKRSQKDKQIKIVKEGLGVLPGTI--VIPFSSVTKQG 181


>gi|138896215|ref|YP_001126668.1| ribosome biogenesis GTP-binding protein YsxC [Geobacillus
           thermodenitrificans NG80-2]
 gi|196250171|ref|ZP_03148865.1| small GTP-binding protein [Geobacillus sp. G11MC16]
 gi|166225956|sp|A4IRG9|ENGB_GEOTN RecName: Full=Probable GTP-binding protein EngB
 gi|134267728|gb|ABO67923.1| GTP-binding protein-like protein [Geobacillus thermodenitrificans
           NG80-2]
 gi|196210355|gb|EDY05120.1| small GTP-binding protein [Geobacillus sp. G11MC16]
          Length = 195

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 84/138 (60%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P +G PE+A +GRSNVGKSS IN ++NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PDSGRPEVALAGRSNVGKSSFINKMINRKNLARTSSKPGKTQTLNFYLIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           +   VD+PGYG+AR  K+    WG ++  Y + R TL+   LL+D RH   + D  ++ F
Sbjct: 70  SFYFVDVPGYGFARVSKQERQKWGKMMETYFTTRETLKAALLLVDLRHPPTKDDVMMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
                +   ++ TK DK+
Sbjct: 130 FKHYEIPVIVIATKADKV 147


>gi|238018910|ref|ZP_04599336.1| hypothetical protein VEIDISOL_00770 [Veillonella dispar ATCC 17748]
 gi|237864394|gb|EEP65684.1| hypothetical protein VEIDISOL_00770 [Veillonella dispar ATCC 17748]
          Length = 232

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/187 (42%), Positives = 107/187 (57%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF---VPKDFSNLKN 81
           P+    EIAF GRSNVGKSSLIN L N + LA  S  PG+T+ +N+F     +D S  + 
Sbjct: 43  PEGDTVEIAFIGRSNVGKSSLINSLCNYRGLALVSGQPGKTKTINYFDVESKEDISETEE 102

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYL--SERSTLRCVYLLIDCRHGVKQIDQ 139
                 LVD+PGYG+A+  K N + W   I  Y+  SER  L C  LLID RH    ID+
Sbjct: 103 RRYHWFLVDLPGYGFAKTNKGNRNLWSSFIADYILHSERLMLLC--LLIDGRHPEMPIDK 160

Query: 140 DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI 199
             + +L +  V  QIV+TK+DKL   TA+E       +   YPTA P ++  SS+K  G 
Sbjct: 161 VAYDWLVEAGVPLQIVVTKVDKL---TAKEKSANLAIIKEMYPTATPPIL-YSSLKHTGR 216

Query: 200 EVLRKAI 206
           E+L++ I
Sbjct: 217 ELLQQRI 223


>gi|254494964|ref|ZP_01052919.2| GTPase of unknown function [Polaribacter sp. MED152]
 gi|213690546|gb|EAQ42347.2| GTPase of unknown function [Polaribacter sp. MED152]
          Length = 194

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/189 (40%), Positives = 100/189 (52%), Gaps = 17/189 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PE AF GRSNVGKSSLIN+L+ RK+LA+ S  PG+TQ +N F   D         
Sbjct: 10  PKDRIPEYAFIGRSNVGKSSLINMLMERKDLAKISGKPGKTQLINHFKIND--------- 60

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  KK    +   I  Y  ER  L C ++LID RH  ++ID D   F
Sbjct: 61  NWFLVDLPGYGYAQVSKKKRVIFQYFIENYFKEREQLVCTFVLIDSRHDPQKIDLDFMRF 120

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L +  + + +V TK DKL  S    Q T  K K L       H E +P + +      + 
Sbjct: 121 LGENQIPFCLVFTKADKLGSSKLNKQITSYKKKLL------QHWETLPMTFLTSSSTGLG 174

Query: 203 RKAILETIN 211
           RK  L+ I+
Sbjct: 175 RKEFLDFID 183


>gi|164686710|ref|ZP_02210738.1| hypothetical protein CLOBAR_00305 [Clostridium bartlettii DSM
           16795]
 gi|164604100|gb|EDQ97565.1| hypothetical protein CLOBAR_00305 [Clostridium bartlettii DSM
           16795]
          Length = 207

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 102/187 (54%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA  GRSNVGKSS +N L+NR+N ARTS  PG+T+ +NF+       L NN  
Sbjct: 23  PAEGLPEIALVGRSNVGKSSCVNALLNRRNFARTSQTPGKTRTINFY-------LINN-- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K   D WG ++  YL +R  L  ++LL+D RH     D  ++ +
Sbjct: 74  EFYFVDLPGYGYAKVAKSEKDKWGNIMETYLGDREELCAIFLLVDIRHEPTNDDVMMYEW 133

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           +        ++ TK DK+S    Q+ +   +  ++       ++IP SS K+ G+E +  
Sbjct: 134 IKHFGYECVVIATKADKISRGQYQKHMSIIRKKLQ--LEKDEKIIPLSSSKKTGVEDVWN 191

Query: 205 AILETIN 211
            ++   N
Sbjct: 192 EMVSQYN 198


>gi|315633423|ref|ZP_07888714.1| ribosome biogenesis GTP-binding protein YsxC [Aggregatibacter
           segnis ATCC 33393]
 gi|315477923|gb|EFU68664.1| ribosome biogenesis GTP-binding protein YsxC [Aggregatibacter
           segnis ATCC 33393]
          Length = 204

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/189 (37%), Positives = 104/189 (55%), Gaps = 10/189 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P +  LP+    EIAF+GRSN GKS+ +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 13  FLTSSPNLKSLPEDSGVEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  L  + +L+D RH 
Sbjct: 73  E---------PQCKLVDLPGYGYAAVPEQMKLQWQQALGEYLQKRECLAGIVILMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKLS +   + ++  +  I  +     +V   S+
Sbjct: 124 LKDLDQQMIEWAVASKLPVLLLLTKADKLSQSERSKQVKMVREAILPF-QGDIQVEAFSA 182

Query: 194 VKRKGIEVL 202
           +KR GI+ L
Sbjct: 183 LKRTGIDRL 191


>gi|304382687|ref|ZP_07365181.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella marshii
           DSM 16973]
 gi|304336312|gb|EFM02554.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella marshii
           DSM 16973]
          Length = 202

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/189 (37%), Positives = 102/189 (53%), Gaps = 9/189 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P +   P    PE AF GRSNVGKSSLIN+L N KNLA+TS  PG+T  +N F+ 
Sbjct: 8   FVISSPTVQKCPADTKPEYAFIGRSNVGKSSLINMLCNHKNLAKTSATPGKTLLINHFII 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            LVD+PGYGYA+  K        +I  Y+ +R  L  V++LID RH 
Sbjct: 68  NN---------EWYLVDLPGYGYAKRSKTVQQQLSRMITSYILQRKQLINVFVLIDIRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            +Q D++   +L + ++ + IV TK DKL    A++ +E     +++     P    TS+
Sbjct: 119 AQQNDREFIDWLGESSIPFAIVFTKADKLGAVKARQNVEAYMNALKDRWEELPPYFITSA 178

Query: 194 VKRKGIEVL 202
            KR G + L
Sbjct: 179 EKRTGRDEL 187


>gi|303229336|ref|ZP_07316126.1| ribosome biogenesis GTP-binding protein YsxC [Veillonella atypica
           ACS-134-V-Col7a]
 gi|303231340|ref|ZP_07318074.1| ribosome biogenesis GTP-binding protein YsxC [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302513936|gb|EFL55944.1| ribosome biogenesis GTP-binding protein YsxC [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302515872|gb|EFL57824.1| ribosome biogenesis GTP-binding protein YsxC [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 232

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 106/187 (56%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF---VPKDFSNLKN 81
           P+    E+AF GRSNVGKSSLIN L N + LA  S  PG+T+ +N+F     +D S  + 
Sbjct: 43  PEGDTVEVAFLGRSNVGKSSLINSLCNYRGLALVSGQPGKTKTINYFDIESKEDISETEE 102

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYL--SERSTLRCVYLLIDCRHGVKQIDQ 139
                 LVD+PGYG+A+  K N + W   I  Y+  SER  L C  LLID RH    ID+
Sbjct: 103 RRYHWFLVDLPGYGFAKTNKDNRNMWSSFISDYILHSERLMLLC--LLIDGRHPEMPIDK 160

Query: 140 DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI 199
             F +L +  V  QIV+TK+DKL+       L K K +   YPT  P ++  SS+K  G 
Sbjct: 161 VAFDWLVEAGVPLQIVVTKVDKLNAKEKSVNLAKVKAM---YPTDSPPIM-YSSLKHTGR 216

Query: 200 EVLRKAI 206
           E+L++ I
Sbjct: 217 ELLQQRI 223


>gi|295677901|ref|YP_003606425.1| ribosome biogenesis GTP-binding protein YsxC [Burkholderia sp.
           CCGE1002]
 gi|295437744|gb|ADG16914.1| ribosome biogenesis GTP-binding protein YsxC [Burkholderia sp.
           CCGE1002]
          Length = 220

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 100/187 (53%), Gaps = 9/187 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PEIAF+GRSN GKS+ IN+L N+K LA  S  PGRTQH+N+     FS  K +L
Sbjct: 20  LPATAQPEIAFAGRSNAGKSTAINVLCNQKRLAFASKTPGRTQHINY-----FSVGKADL 74

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           PA  LVD+PGYGYA  P      W  L+  YL  RS LR + L++D R  +  +D+ +  
Sbjct: 75  PAGYLVDLPGYGYAEVPGAAKAHWEALLSTYLQSRSQLRGMILMMDSRRPLTDLDRRMIE 134

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA--HPEVIPT--SSVKRKGI 199
           +          +LTK DKL+   +   L   +  +  Y  A    E+     S++KR G+
Sbjct: 135 WFAPTGKPIHTLLTKCDKLTRQESTNALRTAQKGLAEYRAAGYRGELSAQLFSALKRTGL 194

Query: 200 EVLRKAI 206
           +   + I
Sbjct: 195 DEAHELI 201


>gi|224145468|ref|XP_002325653.1| predicted protein [Populus trichocarpa]
 gi|222862528|gb|EEF00035.1| predicted protein [Populus trichocarpa]
          Length = 305

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/184 (39%), Positives = 105/184 (57%), Gaps = 12/184 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
            P  G PEIAF+GRSNVGKSSL+N L  +  +ARTS+ PG TQ +NFF           L
Sbjct: 124 FPPPGLPEIAFAGRSNVGKSSLLNSLTRQWGVARTSDKPGLTQTINFF----------EL 173

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + LVD+PGYG+A A ++  DSW  L+  Y+S R  L+ V LLID + G+K  D+++  
Sbjct: 174 GNVCLVDLPGYGFAYAKEEVKDSWEELVKEYVSMRVNLKRVCLLIDTKWGMKPRDRELID 233

Query: 144 FLDKKAVSYQIVLTKIDKLSP-TTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
            +++    YQ+V+TK D + P   A+  ++  + L  N     P V+  SS    GI  +
Sbjct: 234 LMERYQTKYQVVMTKTDLVFPIDVARRAMQIEESLKANKSLVQP-VMMVSSKSGAGIRSV 292

Query: 203 RKAI 206
           R  +
Sbjct: 293 RTVL 296


>gi|225011603|ref|ZP_03702041.1| GTP-binding protein HSR1-related [Flavobacteria bacterium MS024-2A]
 gi|225004106|gb|EEG42078.1| GTP-binding protein HSR1-related [Flavobacteria bacterium MS024-2A]
          Length = 205

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 107/199 (53%), Gaps = 14/199 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    ++   P +  PE AF GRSNVGKSSLIN L N+KNLA+TS+ PG+TQ +N F+ 
Sbjct: 8   FVISNSDVAKCPNSHLPEYAFIGRSNVGKSSLINALCNKKNLAKTSSRPGKTQLINHFL- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                +  N     LVD+PG+GYAR  K     +   +  Y  ER  L   +LLID RH 
Sbjct: 67  -----INQN---WHLVDLPGFGYARVSKTQKKVFQKFVTNYFKERKQLVNAFLLIDIRHD 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEK-TKYLIRNYPTAHPEVIPTS 192
            + ID +   +L +  + + I+ TK DKL P   +  ++  T+ ++       P +  TS
Sbjct: 119 PQPIDMNFMEWLGENQIPFSIIFTKADKLKPAARERNIKAYTEKMLATLWEELPPIFITS 178

Query: 193 SVKRKGIEVLRKAILETIN 211
           S+ + G E     ILE I+
Sbjct: 179 SLHKTGGE----EILEYIH 193


>gi|307128782|ref|YP_003880798.1| GTP-binding protein [Dickeya dadantii 3937]
 gi|306526311|gb|ADM96241.1| GTP-binding protein [Dickeya dadantii 3937]
          Length = 275

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 106/193 (54%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 73  FVTSAPDIRHLPADSGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 132

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + LVD+PGYGYA  P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 133 AD---------GVRLVDLPGYGYAEVPEEMKRKWQRALGEYLQKRDCLKGLVVLMDIRHP 183

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 184 LKDLDQQMLEWAVDVGLPVLVLLTKADKLAQGARKSQLNMVREAVLPF-MGDIQVEAFSS 242

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 243 LKKTGVDKLRQKL 255


>gi|238921710|ref|YP_002935225.1| ribosome biogenesis GTP-binding protein YsxC [Edwardsiella ictaluri
           93-146]
 gi|259645894|sp|C5BC84|ENGB_EDWI9 RecName: Full=Probable GTP-binding protein EngB
 gi|238871279|gb|ACR70990.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 217

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 109/193 (56%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 13  FVTSAPDIRHLPEDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +D          + LVD+PGYGYA  P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 73  ED---------GIRLVDLPGYGYAEVPEEMKRKWQQALGEYLQKRQCLKGLVVLMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ + ++  +  +   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 124 LKDLDQQMIAWAVEVGLPVLLLLTKADKLASGARKAQLNMVREAVLPF-MGDIQVDAFSS 182

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR  +
Sbjct: 183 LKKFGVDKLRDKL 195


>gi|329296747|ref|ZP_08254083.1| GTP-binding protein YsxC [Plautia stali symbiont]
          Length = 213

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 107/196 (54%), Gaps = 16/196 (8%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FMLSAPDIRHLPADTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLF-- 68

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                    +    LVD+PGYGYA  P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 69  -------EVVEGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLQKRQALKGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA---HPEVIP 190
           +K +DQ +  +  +  +   I+LTK DKL+    +  L     ++R    A     +V  
Sbjct: 122 LKDLDQQMVEWAGQSGIPVMILLTKADKLTSGARKAQLN----MVREASLAFMGDVQVEM 177

Query: 191 TSSVKRKGIEVLRKAI 206
            SS+K+ G++ LR+ +
Sbjct: 178 FSSLKKLGVDKLRQKL 193


>gi|269140842|ref|YP_003297543.1| GTPase [Edwardsiella tarda EIB202]
 gi|267986503|gb|ACY86332.1| GTPase [Edwardsiella tarda EIB202]
 gi|304560601|gb|ADM43265.1| GTP-binding protein EngB [Edwardsiella tarda FL6-60]
          Length = 217

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 13  FVTSAPDIRHLPADTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +D          + LVD+PGYGYA  P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 73  ED---------GIRLVDLPGYGYAEVPEEMKRKWQQALGEYLQKRQCLKGLVVLMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ + ++  +  +   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 124 LKDLDQQMIAWAVEAGLPVLLLLTKADKLASGARKAQLNMVREAVLPF-MGDIQVDAFSS 182

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR  +
Sbjct: 183 LKKFGVDKLRDKL 195


>gi|322835074|ref|YP_004215101.1| ribosome biogenesis GTP-binding protein YsxC [Rahnella sp. Y9602]
 gi|321170275|gb|ADW75974.1| ribosome biogenesis GTP-binding protein YsxC [Rahnella sp. Y9602]
          Length = 216

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 104/189 (55%), Gaps = 10/189 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L  +K+LARTS  PGRTQ +N F  
Sbjct: 13  FVMSAPDIRHLPSDAGIEVAFAGRSNAGKSSALNTLTQQKSLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           K         P + LVD+PGYGYA  P++    W   +  YL  R++L+ + +L+D RH 
Sbjct: 73  K---------PGIRLVDLPGYGYAEVPEEMKRKWQRALGEYLQMRNSLKGLVVLMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +         ++LTK DKL+    Q  ++  +  ++ +     +V   SS
Sbjct: 124 LKDLDQQMIQWAVDVGTPVMLLLTKADKLASGARQAQIKMVREAVKEF-MGDIQVEAFSS 182

Query: 194 VKRKGIEVL 202
            K+ G++ L
Sbjct: 183 PKKMGVDKL 191


>gi|317502810|ref|ZP_07960914.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella salivae
           DSM 15606]
 gi|315666082|gb|EFV05645.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella salivae
           DSM 15606]
          Length = 198

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/195 (37%), Positives = 106/195 (54%), Gaps = 9/195 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P + + PK   PE AF GRSNVGKSSLIN+L N K LA+TS  PG+T  +N F+ 
Sbjct: 8   FVISAPTVSMCPKDDKPEYAFIGRSNVGKSSLINMLCNHKGLAKTSATPGKTLLINHFII 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                  NN     LVD+PGYG+A+  K        +I  Y+ +R  +  V++LID RH 
Sbjct: 68  -------NN--EWYLVDLPGYGFAKRSKTVQQKLEQMIASYILQRKQMVNVFVLIDIRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID++   +L +  V + IV TK DKL    A++  +K    +++     P    TSS
Sbjct: 119 QQKIDREFIDWLGESNVPFTIVFTKADKLGAGKAKQNAQKWMNQLKDRWETLPPYFITSS 178

Query: 194 VKRKGIEVLRKAILE 208
            K+ G + L   I E
Sbjct: 179 EKKLGRDELLDYIDE 193


>gi|304415126|ref|ZP_07395853.1| GTPase [Candidatus Regiella insecticola LSR1]
 gi|304283022|gb|EFL91458.1| GTPase [Candidatus Regiella insecticola LSR1]
          Length = 228

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 106/190 (55%), Gaps = 10/190 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     EIAF+GRSN GKSS +N L ++K LARTS  PGRTQ +N F  
Sbjct: 34  FISSAPDIHHLPAYEGIEIAFAGRSNAGKSSALNALTHKKGLARTSKTPGRTQLINLFEV 93

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA   K+  + W   +  YL++R  L+ + +L+D RH 
Sbjct: 94  AD---------GKRLVDLPGYGYAAVKKEIKNQWQHALNDYLNKRDCLKGLVVLMDIRHP 144

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K+ DQ + S      +   ++LTK DKL+ + A+  L K +  +  +     +V   SS
Sbjct: 145 LKESDQQMISLAVAVDIPIFLLLTKADKLATSAAKTQLNKVREAVLPF-MGDIQVEKFSS 203

Query: 194 VKRKGIEVLR 203
           +K+ G++ LR
Sbjct: 204 LKKTGVDKLR 213


>gi|254282215|ref|ZP_04957183.1| GTP-binding protein EngB [gamma proteobacterium NOR51-B]
 gi|219678418|gb|EED34767.1| GTP-binding protein EngB [gamma proteobacterium NOR51-B]
          Length = 229

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 107/194 (55%), Gaps = 10/194 (5%)

Query: 13  IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           +FL+   ++   P     E+AF+GRSN GKSS IN L   K LARTS  PGRTQ +N+F 
Sbjct: 20  VFLQSASQLENSPDDSGSEVAFAGRSNSGKSSAINTLTGNKKLARTSRTPGRTQLINYF- 78

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
                   +  P   LVD+PGYGYA+ P    + W   + RYL  R +LR + LL+D RH
Sbjct: 79  --------DVGPDRRLVDLPGYGYAKVPLAMKEKWNRELERYLQHRQSLRGLVLLMDIRH 130

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
            ++  D  + ++    ++   I+LTK DKL    AQ TL K +  + ++      V   S
Sbjct: 131 PMRDQDDQMINWAATASMPVHILLTKADKLKRGPAQNTLLKLQGQLASF-GGLISVQLFS 189

Query: 193 SVKRKGIEVLRKAI 206
           ++K++G++ L K +
Sbjct: 190 ALKKQGLDSLEKTL 203


>gi|15838031|ref|NP_298719.1| ribosome biogenesis GTP-binding protein YsxC [Xylella fastidiosa
           9a5c]
 gi|9106445|gb|AAF84239.1|AE003973_7 GTP-binding protein [Xylella fastidiosa 9a5c]
          Length = 229

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/183 (36%), Positives = 98/183 (53%), Gaps = 9/183 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP     E+AF+GRSN GKSS++N L  +  LAR S  PGRTQ L +F            
Sbjct: 46  LPADDGSEVAFAGRSNAGKSSVLNTLTRQNALARVSKTPGRTQQLVYFTVT--------- 96

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P   LVD+PGYGYA+ PK+    W   I  Y  +R  LR + +++D RH +K+ D  + +
Sbjct: 97  PQRYLVDLPGYGYAKVPKELQIHWQTFIDSYFHQRQALRGLVVVMDIRHPLKEYDLQMLA 156

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +  ++ +  Q +LTK DKL      +TL+K +  +  +   H  +   SS  R+G+E L 
Sbjct: 157 YARQRGLPAQALLTKADKLGRGQQAQTLQKVRNELTKHFADHINIQTFSSKSRQGVEQLH 216

Query: 204 KAI 206
             I
Sbjct: 217 TVI 219


>gi|15673134|ref|NP_267308.1| GTPase EngB [Lactococcus lactis subsp. lactis Il1403]
 gi|281491648|ref|YP_003353628.1| GTP-binding protein EngB [Lactococcus lactis subsp. lactis KF147]
 gi|18202795|sp|Q9CGE5|ENGB_LACLA RecName: Full=Probable GTP-binding protein EngB
 gi|12724115|gb|AAK05250.1|AE006347_8 GTP-binding protein [Lactococcus lactis subsp. lactis Il1403]
 gi|281375366|gb|ADA64879.1| GTP-binding protein EngB [Lactococcus lactis subsp. lactis KF147]
 gi|326406699|gb|ADZ63770.1| GTP-binding protein [Lactococcus lactis subsp. lactis CV56]
          Length = 195

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 82/138 (59%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKN ARTS  PG+TQ LNF+   D         
Sbjct: 21  PENDWPEIALAGRSNVGKSSFINTLLNRKNFARTSGQPGKTQLLNFYNIDD--------- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK  + WG +I  YL+ R  L+ V  L+D RH   + D  ++ F
Sbjct: 72  QLHFVDVPGYGYARVSKKEREKWGKMIEEYLTTRENLKAVVSLVDIRHEPSEDDLMMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   +V TK DK+
Sbjct: 132 LKYYHIPVILVATKADKV 149


>gi|225868472|ref|YP_002744420.1| GTP-binding protein [Streptococcus equi subsp. zooepidemicus]
 gi|259645907|sp|C0MEW6|ENGB_STRS7 RecName: Full=Probable GTP-binding protein EngB
 gi|225701748|emb|CAW99123.1| putative GTP-binding protein [Streptococcus equi subsp.
           zooepidemicus]
          Length = 199

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 99/184 (53%), Gaps = 11/184 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++ RK+LARTS+ PG+TQ LNFF   D         
Sbjct: 25  PQDDLPEIALAGRSNVGKSSFINTILGRKSLARTSSKPGKTQLLNFFNVDD--------- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            + LVD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   Q D  ++ F
Sbjct: 76  KLRLVDVPGYGYAKVSKAERARWGKMIEEYLTTRQNLRAVVSLVDFRHEPSQDDIQMYEF 135

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+ P       E       N+      +I  SSV+R GI+    
Sbjct: 136 LKYYEIPVIIVATKADKV-PRGRWNKHESMVKKSLNFDQTDAFII-FSSVERIGIDESWD 193

Query: 205 AILE 208
            ILE
Sbjct: 194 TILE 197


>gi|288927638|ref|ZP_06421485.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella sp. oral
           taxon 317 str. F0108]
 gi|288330472|gb|EFC69056.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella sp. oral
           taxon 317 str. F0108]
          Length = 201

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 102/195 (52%), Gaps = 9/195 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F    P I L P     E AF GRSNVGKSSLIN+L N K LA+TS  PG+T  +N F+ 
Sbjct: 8   FTLSAPSIRLCPTDNKIEYAFIGRSNVGKSSLINMLCNHKGLAKTSATPGKTLLINHFII 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D         +  LVD+PGYG+A+  K        +I  Y+ +R  L  +++LID RH 
Sbjct: 68  ND---------SWYLVDLPGYGFAKRSKTVQQKLQQMISSYILQREQLVNLFVLIDIRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID++   +L +  V + IV TK DKL    A++  EK    + +     P    TSS
Sbjct: 119 QQKIDREFIDWLGESGVPFTIVFTKADKLGLVKAKQNAEKWMKQLEDSWEELPPYFITSS 178

Query: 194 VKRKGIEVLRKAILE 208
            KR G E L   I E
Sbjct: 179 EKRIGREELLNYIDE 193


>gi|323345334|ref|ZP_08085557.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella oralis
           ATCC 33269]
 gi|323093448|gb|EFZ36026.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella oralis
           ATCC 33269]
          Length = 199

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 105/197 (53%), Gaps = 13/197 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P IG  P    PE AF GRSNVGKSSLIN+L N K LA+TS  PG+T  +N F+ 
Sbjct: 8   FVISAPTIGKCPNDNKPEYAFIGRSNVGKSSLINMLCNHKGLAKTSATPGKTLLINHFII 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                  NN     LVD+PGYG+A+  K        +I  Y+ +R  L  V++LID RH 
Sbjct: 68  -------NN--EWYLVDLPGYGFAKRSKSVQKQLQQMISSYILQREQLANVFVLIDIRHD 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
              ID++   +L + ++ + I  TK DKL    A++  EK    +++     P    TS+
Sbjct: 119 PMTIDREFIDWLGESSIPFAIAFTKADKLGLVKARQNAEKWMKTLQDRWETLPPYFITSA 178

Query: 194 VKRKGIEVLRKAILETI 210
            K++G    R  ILE I
Sbjct: 179 EKKQG----RDEILEYI 191


>gi|315650625|ref|ZP_07903685.1| ribosome biogenesis GTP-binding protein YsxC [Eubacterium saburreum
           DSM 3986]
 gi|315487122|gb|EFU77444.1| ribosome biogenesis GTP-binding protein YsxC [Eubacterium saburreum
           DSM 3986]
          Length = 197

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 100/177 (56%), Gaps = 15/177 (8%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
            P    PEI F+G+SNVGKSSLIN L+NRK+LARTS  PG+TQ +N++   D        
Sbjct: 18  FPDNSEPEIVFAGKSNVGKSSLINALMNRKSLARTSGKPGKTQTINYYKVND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             +  VD+PGYGYA A     + WG +I RYL     ++C++LLID RH   + D+ ++ 
Sbjct: 70  -EIYFVDLPGYGYANANLATREKWGKMIERYLHTSKQIKCIFLLIDIRHEPGKNDKQMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEV--IPTSSVKRKG 198
           ++     S  I+ TK+DKL  +   + ++     +R       EV  IP SS  ++G
Sbjct: 129 WIVYNGYSPVIIATKLDKLKRSQIAKCIK----TLREGLGLQKEVVLIPFSSETKQG 181


>gi|195978195|ref|YP_002123439.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
 gi|195974900|gb|ACG62426.1| probable GTP-binding protein EngB [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
          Length = 200

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/186 (41%), Positives = 101/186 (54%), Gaps = 15/186 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++ RK+LARTS+ PG+TQ LNFF   D         
Sbjct: 26  PQDDLPEIALAGRSNVGKSSFINTILGRKSLARTSSKPGKTQLLNFFNVDD--------- 76

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            + LVD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   Q D  ++ F
Sbjct: 77  KLRLVDVPGYGYAKVSKAERARWGKMIEEYLTTRQNLRAVVSLVDFRHEPSQDDIQMYEF 136

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   IV TK DK+        E++ K      N+      +I  SSV+R GI+  
Sbjct: 137 LKYYEIPVIIVATKADKVLRGRWNKHESMVKKSL---NFDRTDAFII-FSSVERIGIDES 192

Query: 203 RKAILE 208
              ILE
Sbjct: 193 WDTILE 198


>gi|88811280|ref|ZP_01126536.1| GTP-binding protein [Nitrococcus mobilis Nb-231]
 gi|88791819|gb|EAR22930.1| GTP-binding protein [Nitrococcus mobilis Nb-231]
          Length = 254

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 103/189 (54%), Gaps = 12/189 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++  LP     E+AF+GRSN GKSS IN L  +K LARTS  PGRTQ +N F  
Sbjct: 51  FLLSAPDLRHLPPDTGREVAFAGRSNAGKSSAINTLTGQKALARTSKTPGRTQQINVFPV 110

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            L+D+PGYG+A+ P+     W   +  YL  R +LR + L++D RH 
Sbjct: 111 SD---------QRYLIDLPGYGFAKLPQAIRAHWQRTLPEYLQRRRSLRGLMLIMDVRHP 161

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKT-KYLIRNYPTAHPEVIPTS 192
           +  +DQ + ++     +   ++LTK DKL    A + L  T + L R++P    ++   S
Sbjct: 162 LTALDQQLLAWCGAVGLPVHVLLTKADKLKQGPAAQALRHTAECLARDHPDTSVQLF--S 219

Query: 193 SVKRKGIEV 201
           +++ +GIE 
Sbjct: 220 ALRARGIET 228


>gi|261866835|ref|YP_003254757.1| ribosome biogenesis GTP-binding protein YsxC [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412167|gb|ACX81538.1| GTP-binding protein [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 204

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/189 (37%), Positives = 104/189 (55%), Gaps = 10/189 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P +  LP+    EIAF+GRSN GKS+ +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 13  FLTSSPNLKSLPEDTGIEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  L  + +L+D RH 
Sbjct: 73  E---------PQCKLVDLPGYGYAAVPEQMKLQWQQALGEYLQKRECLAGIVILMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKLS +   + ++  +  I  +     +V   S+
Sbjct: 124 LKDLDQQMIEWAVASQLPVLLLLTKADKLSQSERSKQMKMVREAILPF-RGDIQVEAFSA 182

Query: 194 VKRKGIEVL 202
           +KR GI+ L
Sbjct: 183 LKRTGIDRL 191


>gi|322385236|ref|ZP_08058883.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           cristatus ATCC 51100]
 gi|321270860|gb|EFX53773.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           cristatus ATCC 51100]
          Length = 195

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 99/188 (52%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+NRKNLARTS  PG+TQ LNFF      N+ + L 
Sbjct: 21  PQDDIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFF------NIDDKL- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH     D  ++ F
Sbjct: 74  --RFVDVPGYGYAKVSKTERAKWGKMIEEYLTSRDNLRAVVSLVDLRHDPSADDVQMYEF 131

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K           + I  SSV + G++  
Sbjct: 132 LKYYEIPVIVVATKADKIPRGKWNKHESAIKKKLDF----DKTDDFIIFSSVDKTGLDQA 187

Query: 203 RKAILETI 210
             AIL  I
Sbjct: 188 WDAILGKI 195


>gi|157147356|ref|YP_001454675.1| hypothetical protein CKO_03149 [Citrobacter koseri ATCC BAA-895]
 gi|157084561|gb|ABV14239.1| hypothetical protein CKO_03149 [Citrobacter koseri ATCC BAA-895]
          Length = 198

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
            P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F      
Sbjct: 3   APDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLF------ 56

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                +    LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH +K +
Sbjct: 57  ---EVVEGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDL 113

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           DQ +  +  +  +   ++LTK DKL+    +  L   +  +  +     +V   SS+K++
Sbjct: 114 DQQMIQWAVESNIQVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVETFSSLKKQ 172

Query: 198 GIEVLRKAI 206
           G++ LR+ +
Sbjct: 173 GVDKLRQKL 181


>gi|205354414|ref|YP_002228215.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207859194|ref|YP_002245845.1| ribosome biogenesis GTP-binding protein YsxC [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|205274195|emb|CAR39213.1| ATP/GTP-binding protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206710997|emb|CAR35365.1| ATP/GTP-binding protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
          Length = 199

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 106/189 (56%), Gaps = 10/189 (5%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
            P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F      
Sbjct: 4   APDIRHLPSDCGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLF------ 57

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                +    LVD+PGYGYA  P++    W   +  YL +R +L+ + +L+D RH +K +
Sbjct: 58  ---EVVEGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDL 114

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           DQ +  +  +  +   ++LTK DKL+    +  L   +  +  +     +V   SS+K++
Sbjct: 115 DQQMIQWAVESNIQVLVLLTKADKLASGARKAQLNMVREAVLAF-NGDVQVEAFSSLKKQ 173

Query: 198 GIEVLRKAI 206
           G++ LR+ +
Sbjct: 174 GVDKLRQKL 182


>gi|256823704|ref|YP_003147667.1| GTP-binding protein HSR1-like [Kangiella koreensis DSM 16069]
 gi|256797243|gb|ACV27899.1| GTP-binding protein HSR1-related [Kangiella koreensis DSM 16069]
          Length = 207

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 105/190 (55%), Gaps = 12/190 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           +L G  ++  LP     E+AF+GRSN GKSS +N L  +K+LARTS  PGRTQ +N F  
Sbjct: 8   YLLGAAKLTQLPDDQGIEVAFAGRSNAGKSSALNTLTQQKSLARTSKTPGRTQLINVFTL 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D   L         +D+PGYGYA+ P+     W   + RYL +R  LR + LL+D RH 
Sbjct: 68  DDDRRL---------IDLPGYGYAKVPEAMKLQWQAELSRYLQQRKCLRGLVLLMDIRHF 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSP-TTAQETLEKTKYLIRNYPTAHPEVIPTS 192
           +K  DQ++  +  +  +    +L+K DKLS    ++  L+  K L   +P A  +    S
Sbjct: 119 LKDSDQEMLVWAAEVGLPVHCLLSKSDKLSQGAKSKAVLQCKKALSELHPKATVQAF--S 176

Query: 193 SVKRKGIEVL 202
           S+KR G++ L
Sbjct: 177 SLKRVGLDQL 186


>gi|325981834|ref|YP_004294236.1| ribosome biogenesis GTP-binding protein YsxC [Nitrosomonas sp.
           AL212]
 gi|325531353|gb|ADZ26074.1| ribosome biogenesis GTP-binding protein YsxC [Nitrosomonas sp.
           AL212]
          Length = 198

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 99/186 (53%), Gaps = 12/186 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LPK    EIAFSGRSN GKSS IN L NR  LA  S  PGRTQ +NFF       L +N 
Sbjct: 19  LPKHSGIEIAFSGRSNAGKSSAINALTNRNRLAFVSKTPGRTQLINFF------QLASN- 71

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYA+ P+     W  L+  YL  R++LR + L++D RH +K  D  +  
Sbjct: 72  --QFLVDLPGYGYAKVPEHVRLHWKNLLSNYLQTRNSLRGLILVMDIRHPLKPQDIQMLD 129

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN-YPTAHPEVIPTSSVKRKGIEVL 202
           +         I+LTK DKLS   A  TL+K    I+  YP    ++   SS+   G++  
Sbjct: 130 WFSSTGKVIHILLTKADKLSKQQANITLQKVALFIKEFYPQCSVQLF--SSITNIGVDDA 187

Query: 203 RKAILE 208
              I E
Sbjct: 188 MTVITE 193


>gi|239827921|ref|YP_002950545.1| ribosome biogenesis GTP-binding protein YsxC [Geobacillus sp.
           WCH70]
 gi|259645899|sp|C5D5L1|ENGB_GEOSW RecName: Full=Probable GTP-binding protein EngB
 gi|239808214|gb|ACS25279.1| small GTP-binding protein [Geobacillus sp. WCH70]
          Length = 193

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 88/148 (59%), Gaps = 9/148 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PE A +GRSNVGKSS IN ++NRKNLARTS+ PG+TQ LNF++  +         
Sbjct: 19  PDGALPEFALAGRSNVGKSSFINKMINRKNLARTSSKPGKTQTLNFYLINE--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           +   VD+PGYG+AR  KK  ++WG ++  Y + R  LR V L++D RH   + D  ++ F
Sbjct: 70  SFYFVDVPGYGFARVSKKEREAWGKMMETYFTTREQLRAVVLIVDLRHPPTKDDVMMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLE 172
           L    +   I+ TK DK+     Q+ L+
Sbjct: 130 LKHYQIPTIIIATKADKVPKGKWQKHLK 157


>gi|229828302|ref|ZP_04454371.1| hypothetical protein GCWU000342_00360 [Shuttleworthia satelles DSM
           14600]
 gi|229792896|gb|EEP29010.1| hypothetical protein GCWU000342_00360 [Shuttleworthia satelles DSM
           14600]
          Length = 204

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 102/177 (57%), Gaps = 11/177 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LPK   PE+AF+GRSNVGKSSLIN L+NRK+ ARTS+ PG+TQ +N++   D        
Sbjct: 19  LPKNQLPEVAFAGRSNVGKSSLINALMNRKSYARTSSQPGKTQTINYYRIND-------- 70

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             +  VD+PGYG+AR  ++  ++WG +I +YL     L  V+LL+D RH     D+ +F 
Sbjct: 71  -QIYCVDLPGYGFARVSREEKEAWGKMIEKYLVTSEQLAAVFLLLDIRHRPNANDKQMFD 129

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
           ++        ++ TK DK+  +     L + K  ++        +IP S++ ++G E
Sbjct: 130 WIQYMGYQAIVIATKADKIKRSQIPGQLRQMKEELK--ADEDTIIIPFSALTKQGRE 184


>gi|269798315|ref|YP_003312215.1| GTP-binding protein HSR1-related protein [Veillonella parvula DSM
           2008]
 gi|269094944|gb|ACZ24935.1| GTP-binding protein HSR1-related protein [Veillonella parvula DSM
           2008]
          Length = 232

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 105/187 (56%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF---VPKDFSNLKN 81
           P+    EIAF GRSNVGKSSLIN L N + LA  S  PG+T+ +N+F     +D S  + 
Sbjct: 43  PEGDTVEIAFLGRSNVGKSSLINSLCNYRGLALVSGQPGKTKTINYFDIESKEDISETEE 102

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYL--SERSTLRCVYLLIDCRHGVKQIDQ 139
                 LVD+PGYG+A+  K N + W   I  Y+  SER  L C  LLID RH    ID+
Sbjct: 103 RRYNWFLVDLPGYGFAKTNKGNRNLWSSFIADYILHSERLMLLC--LLIDGRHPEMAIDK 160

Query: 140 DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI 199
             F +L +  V  QIV+TK DKL+       L   K L   YPTA P ++  SS+K  G 
Sbjct: 161 VAFDWLVEAGVPLQIVVTKADKLTAKEKSVNLSIIKEL---YPTATPPIL-YSSLKHTGR 216

Query: 200 EVLRKAI 206
           E+L++ I
Sbjct: 217 ELLQQRI 223


>gi|193215228|ref|YP_001996427.1| ribosome biogenesis GTP-binding protein YsxC [Chloroherpeton
           thalassium ATCC 35110]
 gi|238692681|sp|B3QS35|ENGB_CHLT3 RecName: Full=Probable GTP-binding protein EngB
 gi|193088705|gb|ACF13980.1| GTP-binding protein HSR1-related [Chloroherpeton thalassium ATCC
           35110]
          Length = 193

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 101/185 (54%), Gaps = 13/185 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F + V  +  LPK G PEIAF+GRSNVGKSSL+N L+ +K+LAR S  PG+T+ +NFF+ 
Sbjct: 8   FYKSVTRLEDLPKDGLPEIAFAGRSNVGKSSLMNTLMGKKDLARASATPGKTREINFFLV 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                          VD+PGYG+A+  K   ++W  L+  YL  R+ L+ + LLID RH 
Sbjct: 68  NG---------KYYFVDLPGYGFAKVSKSLQENWQQLMEGYLKSRAELKLIVLLIDSRHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
              ID ++  FL      + IV TK DKL+    Q  L K+K            ++  SS
Sbjct: 119 ALPIDLEMNEFLSFFGRRFAIVRTKTDKLN----QSALAKSKRESEKAFYDFEFIMDFSS 174

Query: 194 VKRKG 198
           V  KG
Sbjct: 175 VTGKG 179


>gi|319953730|ref|YP_004164997.1| gtp-binding protein engb [Cellulophaga algicola DSM 14237]
 gi|319422390|gb|ADV49499.1| GTP-binding protein engB [Cellulophaga algicola DSM 14237]
          Length = 208

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/175 (37%), Positives = 98/175 (56%), Gaps = 10/175 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PE AF GRSNVGKSSLIN+L ++K+LA+TS  PG+TQ +N F   D         
Sbjct: 19  PKEAIPEYAFIGRSNVGKSSLINMLTDKKSLAKTSGRPGKTQLINHFKIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           +  LVD+PGYGYAR  K++  ++   I  Y  ER  L   ++L+D RH  +++D +   +
Sbjct: 70  SWYLVDLPGYGYARVSKRDKKTFQRYITDYFRERKQLVSAFVLVDIRHEPQKVDLEFLEW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEK-TKYLIRNYPTAHPEVIPTSSVKRKG 198
           + +  + + IV TK DKL P   +  ++    +L+ +     P    TS+ K  G
Sbjct: 130 MGENQIPFSIVFTKADKLKPNVIERNVQTYIDHLLESMWQEAPNYFITSASKNIG 184


>gi|120437113|ref|YP_862799.1| ribosome biogenesis GTP-binding protein YsxC [Gramella forsetii
           KT0803]
 gi|166225957|sp|A0M537|ENGB_GRAFK RecName: Full=Probable GTP-binding protein EngB
 gi|117579263|emb|CAL67732.1| protein containing GTP binding domain [Gramella forsetii KT0803]
          Length = 198

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 99/185 (53%), Gaps = 9/185 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    ++   P +  PE AF GRSNVGKSSLIN+L  RK+LA+TS  PG+TQ +N F+ 
Sbjct: 8   FVISNSKVDHCPNSTLPEYAFIGRSNVGKSSLINMLTGRKSLAKTSAKPGKTQLINHFL- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                + NN     LVD+PGYGYA+  K     +   I  Y  +R  + C ++LID RH 
Sbjct: 67  -----INNNW---HLVDLPGYGYAQVSKSTKKVFQKFITAYFKKREQMICAFVLIDSRHK 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            + ID +   +L +  + + I+ TK DKL P    + +E  K  +       PE   TS+
Sbjct: 119 PQPIDMEFMQWLGEHNIPFCIIFTKADKLKPKILDKNIENYKNEMLESWVEMPEYFITSA 178

Query: 194 VKRKG 198
             + G
Sbjct: 179 TSKLG 183


>gi|86159103|ref|YP_465888.1| ribosome biogenesis GTP-binding protein YsxC [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|119368789|sp|Q2ILB9|ENGB_ANADE RecName: Full=Probable GTP-binding protein EngB
 gi|85775614|gb|ABC82451.1| GTP-binding protein [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 216

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 92/176 (52%), Gaps = 3/176 (1%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIAF GRSNVGKSS++N L  RK LAR S+ PGRT+ L FF             
Sbjct: 21  PRGATPEIAFVGRSNVGKSSMLNALARRKGLARVSSTPGRTRALQFFDLSYRPTPAARPR 80

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+   D+PGYGYA+  +   D W  +I  YL +R  LR V L++D RH   + D+D  +F
Sbjct: 81  AIRFCDLPGYGYAKVSRAERDRWTAMIEDYLRDRDVLRAVVLIVDARHAPSESDEDAAAF 140

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
           L        +  TK DKL        L++ +   R    A  + +P S+V+  G +
Sbjct: 141 LVSAGRRLVVAATKTDKLPKARRVLALQQVE---RALGLARGDAVPFSAVEGTGTD 193


>gi|226942008|ref|YP_002797082.1| ribosome biogenesis GTP-binding protein YsxC [Laribacter
           hongkongensis HLHK9]
 gi|254783201|sp|C1D5Q6|ENGB_LARHH RecName: Full=Probable GTP-binding protein EngB
 gi|226716935|gb|ACO76073.1| engB, yihA, ysxC [Laribacter hongkongensis HLHK9]
          Length = 222

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 99/181 (54%), Gaps = 12/181 (6%)

Query: 29  PP---EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPA 85
           PP   EIAF GRSN GKSS IN L NR  LA  S  PGRTQH+NFF       L ++   
Sbjct: 20  PPTSAEIAFVGRSNAGKSSAINALANRTRLAYVSKTPGRTQHINFF------RLASHFDY 73

Query: 86  MALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFL 145
             LVD+PGYGYA  P+     W  L+ RYL  R +L  + L++D RH +K++D  +  F 
Sbjct: 74  F-LVDLPGYGYAEVPESVRAHWVELLGRYLQTRESLIGLLLIMDARHPLKELDMRMLDFF 132

Query: 146 DKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKA 205
             +     I+L+K DK++     +TL   +  +  YP    ++   SS K++G+E +   
Sbjct: 133 RMRGQPVHILLSKSDKMNRQEQNKTLATVRQALAGYPQVSIQLF--SSSKKQGLEQVETV 190

Query: 206 I 206
           +
Sbjct: 191 V 191


>gi|262198758|ref|YP_003269967.1| ribosome biogenesis GTP-binding protein YsxC [Haliangium ochraceum
           DSM 14365]
 gi|262082105|gb|ACY18074.1| ribosome biogenesis GTP-binding protein YsxC [Haliangium ochraceum
           DSM 14365]
          Length = 198

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 86/138 (62%), Gaps = 13/138 (9%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPA---- 85
           PEIAF+GRSNVGKSSLIN LV+   LARTS  PGRT+ +N+F           +PA    
Sbjct: 24  PEIAFAGRSNVGKSSLINTLVDIAGLARTSRTPGRTRLVNWF---------QIVPAKGKP 74

Query: 86  MALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFL 145
           M  VD+PGYGYA+ P     SW  LI  YLS+R+TLR + +LID R G ++ + D+  +L
Sbjct: 75  MLFVDLPGYGYAKVPTAMRASWRPLIEDYLSDRATLRALVVLIDARRGAQEEEIDLLDWL 134

Query: 146 DKKAVSYQIVLTKIDKLS 163
               V    V+TK DKLS
Sbjct: 135 RSAEVPAITVVTKADKLS 152


>gi|294794044|ref|ZP_06759181.1| ribosome biogenesis GTP-binding protein YsxC [Veillonella sp.
           3_1_44]
 gi|294455614|gb|EFG23986.1| ribosome biogenesis GTP-binding protein YsxC [Veillonella sp.
           3_1_44]
          Length = 232

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 105/187 (56%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF---VPKDFSNLKN 81
           P+    EIAF GRSNVGKSSLIN L N + LA  S  PG+T+ +N+F     +D S  + 
Sbjct: 43  PEGDTVEIAFLGRSNVGKSSLINSLCNYRGLALVSGQPGKTKTINYFDIESKEDISETEE 102

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYL--SERSTLRCVYLLIDCRHGVKQIDQ 139
                 LVD+PGYG+A+  K N + W   I  Y+  SER  L C  LLID RH    ID+
Sbjct: 103 CRYNWFLVDLPGYGFAKTNKGNRNLWSSFIADYILHSERLMLLC--LLIDGRHPEMAIDK 160

Query: 140 DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI 199
             F +L +  V  QIV+TK DKL+       L   K L   YPTA P ++  SS+K  G 
Sbjct: 161 VAFDWLVEAGVPLQIVVTKADKLTAKEKSANLSIIKEL---YPTATPPIL-YSSLKHTGR 216

Query: 200 EVLRKAI 206
           E+L++ I
Sbjct: 217 ELLQQRI 223


>gi|149278824|ref|ZP_01884959.1| GTPase EngB [Pedobacter sp. BAL39]
 gi|149230443|gb|EDM35827.1| GTPase EngB [Pedobacter sp. BAL39]
          Length = 209

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 107/193 (55%), Gaps = 9/193 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    ++  LP A  PE AF GRSNVGKSSLIN+LVN+  LA+TS  PG+TQ +N F+ 
Sbjct: 8   FICSNTKVSALPVANMPEYAFIGRSNVGKSSLINMLVNQHGLAKTSQRPGKTQLINHFLI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            +VD+PGYGYA+  K + + W   I  Y+++R +L+CV++LID R  
Sbjct: 68  NE---------KWYIVDLPGYGYAKVSKNSREKWEKFIRNYITKRESLQCVFVLIDSRLE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID +   ++ +  + + ++ TK DK S     + +   K  +  +    P    TS+
Sbjct: 119 PQKIDLEFCCWMGEIQIPFALIFTKADKQSKVKTDQNVAAFKKALGGWFEEIPPYFVTSA 178

Query: 194 VKRKGIEVLRKAI 206
            K  G + + K I
Sbjct: 179 EKALGRDEVLKFI 191


>gi|70949402|ref|XP_744115.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 gi|56523930|emb|CAH79943.1| conserved hypothetical protein [Plasmodium chabaudi chabaudi]
          Length = 929

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 104/187 (55%), Gaps = 9/187 (4%)

Query: 21  IGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK 80
           +  LP    PEIAF GRSN GKS+LIN L  R N A+ S  PG T+ ++F+        K
Sbjct: 104 VNELPLPKYPEIAFIGRSNSGKSTLINELCGRSNKAKVSKMPGCTKQIHFY--------K 155

Query: 81  NNLPAM-ALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQ 139
              P +  LVD+PGYG+A + ++    W    + YL  R+ L+ V++LIDCR G+K  D+
Sbjct: 156 IGKPCLLCLVDLPGYGFAHSKEELRLQWNEFTLFYLKNRANLKKVFVLIDCRIGLKTSDK 215

Query: 140 DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI 199
           ++F F D+  + YQIVL+K D L+       ++     I ++      +I  SS+KR+ +
Sbjct: 216 ELFHFFDRYNIKYQIVLSKCDLLNTKDLAIKIQIMNEEIVHFKNLEKNIISLSSLKRQNL 275

Query: 200 EVLRKAI 206
             LR  I
Sbjct: 276 NELRNEI 282


>gi|239907036|ref|YP_002953777.1| probable GTP-binding protein EngB [Desulfovibrio magneticus RS-1]
 gi|239796902|dbj|BAH75891.1| probable GTP-binding protein EngB [Desulfovibrio magneticus RS-1]
          Length = 208

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 86/139 (61%), Gaps = 8/139 (5%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    P+IA +GRSNVGKS+LIN L  RK+LA+TS  PG+T+ LNF++ +         
Sbjct: 25  LPTLDAPQIALAGRSNVGKSTLINCLAGRKSLAKTSATPGKTRSLNFYMAET-------- 76

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYAR  K+  D W  LI  YL+   TLR V  LIDCR   +++D ++ S
Sbjct: 77  QGYCLVDLPGYGYARCSKEERDKWAKLIEAYLATTKTLRAVTALIDCRLPPQRLDMELVS 136

Query: 144 FLDKKAVSYQIVLTKIDKL 162
           +L  + +   + LTK +K+
Sbjct: 137 WLRSRRIPVLVALTKAEKV 155


>gi|222053643|ref|YP_002536005.1| small GTP-binding protein domain protein [Geobacter sp. FRC-32]
 gi|254783197|sp|B9LZU0|ENGB_GEOSF RecName: Full=Probable GTP-binding protein EngB
 gi|221562932|gb|ACM18904.1| small GTP-binding protein domain protein [Geobacter sp. FRC-32]
          Length = 207

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 113/198 (57%), Gaps = 14/198 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-V 72
           F++        P    PEIAF+GRSNVGKSSLIN+LVNRK+L RTS+ PGRTQ +NFF V
Sbjct: 8   FIKSATRAAHYPPGDLPEIAFAGRSNVGKSSLINVLVNRKSLVRTSSTPGRTQLINFFDV 67

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
              F+          LVD+PGYG+A+ P      WG ++  YL++R+ LR V L++D R 
Sbjct: 68  NGQFT----------LVDLPGYGFAKVPLAVKKQWGPMMENYLAKRANLRGVILILDIRR 117

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
                D  +  +L   ++   +V+TK DK+S     E  ++++ + +       E+   S
Sbjct: 118 TPVAEDIQMLHWLQAYSIKPILVITKCDKVS---KNERGKQSRIIAQTLGVETEELNFFS 174

Query: 193 SVKRKGIEVLRKAILETI 210
           ++ R+G +++ + I E +
Sbjct: 175 ALNREGKDLIWRRIEEVL 192


>gi|170695712|ref|ZP_02886854.1| GTP-binding protein HSR1-related [Burkholderia graminis C4D1M]
 gi|170139317|gb|EDT07503.1| GTP-binding protein HSR1-related [Burkholderia graminis C4D1M]
          Length = 217

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 99/191 (51%), Gaps = 9/191 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP    PEIAF+GRSN GKS+ INIL N+K LA  S  PGRTQH+N+   
Sbjct: 10  FFTTVNHLRDLPATAQPEIAFAGRSNAGKSTAINILCNQKRLAFASKTPGRTQHINY--- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
             FS  + + P   LVD+PGYGYA  P      W  L+  YL  RS LR + L++D R  
Sbjct: 67  --FSVGREDEPVAHLVDLPGYGYAEVPGAAKAHWEALLSTYLQSRSQLRGMILMMDSRRP 124

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT-- 191
           +  +D+ +  +          +LTK DKL+   +   L  T+     Y  A  +   T  
Sbjct: 125 LTDLDRRMIEWFAPTGKPIHALLTKCDKLTRQESVNALRTTQKGFAEYRAAGYQGELTAQ 184

Query: 192 --SSVKRKGIE 200
             S++KR GI+
Sbjct: 185 LFSALKRVGID 195


>gi|312131612|ref|YP_003998952.1| ribosome biogenesis gtp-binding protein ysxc [Leadbetterella
           byssophila DSM 17132]
 gi|311908158|gb|ADQ18599.1| ribosome biogenesis GTP-binding protein YsxC [Leadbetterella
           byssophila DSM 17132]
          Length = 200

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 104/191 (54%), Gaps = 10/191 (5%)

Query: 13  IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           +F +   +I   P+   PEIAF GRSNVGKSSLIN+L   KNLA+TS+ PG+TQ +N ++
Sbjct: 8   VFSKSSAKIDQCPQDNLPEIAFIGRSNVGKSSLINMLTGVKNLAKTSSTPGKTQLINHYL 67

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
             +         A  LVD+PGYGYA+ P      W  +   YL +R TL  V++L+D R 
Sbjct: 68  VDN---------AWYLVDLPGYGYAKVPMSEKAKWEKMTWDYLLDRKTLLYVFVLVDIRI 118

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
             ++ D D    L +  ++ +IV TK DK+     Q  +      ++      PE   TS
Sbjct: 119 KPQKSDLDFIRKLGENGIAIKIVFTKEDKVKTMEGQRNIMAFLEALKEDWDILPEYFVTS 178

Query: 193 SVKRKG-IEVL 202
           S KR G +E+L
Sbjct: 179 SEKRSGKVEML 189


>gi|313113614|ref|ZP_07799202.1| ribosome biogenesis GTP-binding protein YsxC [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310624129|gb|EFQ07496.1| ribosome biogenesis GTP-binding protein YsxC [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 199

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 104/200 (52%), Gaps = 14/200 (7%)

Query: 7   FTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ 66
           + K+ +I   G+     LP++  PE++FSGRSNVGKSSLIN L +RKNLAR S+ PG+T 
Sbjct: 3   YNKADFIASYGIS--SQLPESDRPELSFSGRSNVGKSSLINKLCSRKNLARVSSTPGKTA 60

Query: 67  HLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYL 126
            +NF+   D             VD+PGYGYA+    + + W  LI  Y         +  
Sbjct: 61  TINFYSVDD----------CYFVDLPGYGYAKVSNADRERWDDLINSYFEAPRHHTLLVQ 110

Query: 127 LIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP 186
           L+DCRH     D+ +  +L    + Y + LTK DKL  +   +TLE  + L R  P    
Sbjct: 111 LLDCRHAPSADDEQMLRYLHYHQIPYVVALTKADKLKKSQLAKTLEDFENLCR--PYGCQ 168

Query: 187 EVIPTSSVKRKGIEVLRKAI 206
           +V+ TS     GI  L+  +
Sbjct: 169 KVVLTSGENGYGIPELQAVL 188


>gi|218962058|ref|YP_001741833.1| putative GTP-binding protein engB [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730715|emb|CAO81627.1| putative GTP-binding protein engB [Candidatus Cloacamonas
           acidaminovorans]
          Length = 203

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 103/190 (54%), Gaps = 3/190 (1%)

Query: 13  IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
            F++   E    P +  PE AF+GRSNVGKS+LIN+L N K LA+TS+ PG+T+ LNFF+
Sbjct: 8   FFVKSAIEPSDYPASAYPEFAFAGRSNVGKSTLINLLTNHKGLAKTSSTPGKTRLLNFFL 67

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
            +   +  ++   +   D+PGYGYA   +   + W  +I +Y  +R  LR + +++D RH
Sbjct: 68  IRYKIDDNDSSGFLQFTDLPGYGYAEVSQAEQEKWRRMINKYFEQRKQLRSLIVIVDIRH 127

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
                D  +   L  + + Y IV TK DK+  T   +T+   K L +        + P S
Sbjct: 128 PADSKDIMLLEMLRLRGIDYCIVATKADKIPKTKVAKTV---KDLAKGLGLKEEPIFPVS 184

Query: 193 SVKRKGIEVL 202
           ++   G+E L
Sbjct: 185 ALNNTGLEPL 194


>gi|293391510|ref|ZP_06635844.1| GTP-binding protein [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952044|gb|EFE02163.1| GTP-binding protein [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 204

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/189 (37%), Positives = 104/189 (55%), Gaps = 10/189 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P +  LP+    EIAF+GRSN GKS+ +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 13  FLTSSPNLKSLPEDTGIEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  L  + +L+D RH 
Sbjct: 73  E---------PQCKLVDLPGYGYAAVPEQMKLQWQQALGEYLQKRECLAGIVILMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKLS +   + ++  +  I  +     +V   S+
Sbjct: 124 LKDLDQQMIKWAVASQLPVLLLLTKADKLSQSERSKQMKIVREAILPF-RGEIQVEAFSA 182

Query: 194 VKRKGIEVL 202
           +KR GI+ L
Sbjct: 183 LKRTGIDRL 191


>gi|269213778|ref|ZP_05982836.2| ribosome biogenesis GTP-binding protein YsxC [Neisseria cinerea
           ATCC 14685]
 gi|269145348|gb|EEZ71766.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria cinerea
           ATCC 14685]
          Length = 211

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 105/194 (54%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 11  FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      LVD+PGYGYA+ P+     W  L+  YL +R  L  + L++D RH 
Sbjct: 68  ----ELQN---GNFLVDLPGYGYAQVPEAIRTHWVKLLGDYLQQRKQLIGLILIMDARHP 120

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT-AHPEVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y    +  V   S
Sbjct: 121 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSERQNISVQLFS 180

Query: 193 SVKRKGIEVLRKAI 206
           S+K++G+E + + +
Sbjct: 181 SLKKQGLEEVNQTV 194


>gi|189423527|ref|YP_001950704.1| ribosome biogenesis GTP-binding protein YsxC [Geobacter lovleyi SZ]
 gi|238692100|sp|B3E2D1|ENGB_GEOLS RecName: Full=Probable GTP-binding protein EngB
 gi|189419786|gb|ACD94184.1| small GTP-binding protein [Geobacter lovleyi SZ]
          Length = 200

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 111/202 (54%), Gaps = 17/202 (8%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-- 71
           F++   +    P    PEIAF+GRSNVGKSSLIN++V RK L RTS+ PGRTQ +NFF  
Sbjct: 8   FIKSAVKPADYPPVDLPEIAFAGRSNVGKSSLINVIVERKALVRTSSTPGRTQLINFFQV 67

Query: 72  --VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLID 129
             VP  FS        + LVD+PGYGYA+ P      WG ++ RYLS R +LR V L++D
Sbjct: 68  TGVP--FS--------LNLVDLPGYGYAKVPLDVKRQWGPMMERYLSGRESLRGVVLILD 117

Query: 130 CRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVI 189
            R    + D  + ++L        IVLTK DK+   T  E   +T  +         ++I
Sbjct: 118 IRRIPSEEDLQMLNWLRSYKRRPIIVLTKCDKV---TKNERARQTAAIAARLEMDKSQLI 174

Query: 190 PTSSVKRKGIEVLRKAILETIN 211
             S++ + G + + +AI + + 
Sbjct: 175 HFSALSKDGRDTVWQAIQDAVE 196


>gi|261418335|ref|YP_003252017.1| ribosome biogenesis GTP-binding protein YsxC [Geobacillus sp.
           Y412MC61]
 gi|297529187|ref|YP_003670462.1| ribosome biogenesis GTP-binding protein YsxC [Geobacillus sp.
           C56-T3]
 gi|319767706|ref|YP_004133207.1| ribosome biogenesis GTP-binding protein YsxC [Geobacillus sp.
           Y412MC52]
 gi|261374792|gb|ACX77535.1| ribosome biogenesis GTP-binding protein YsxC [Geobacillus sp.
           Y412MC61]
 gi|297252439|gb|ADI25885.1| ribosome biogenesis GTP-binding protein YsxC [Geobacillus sp.
           C56-T3]
 gi|317112572|gb|ADU95064.1| ribosome biogenesis GTP-binding protein YsxC [Geobacillus sp.
           Y412MC52]
          Length = 195

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 83/138 (60%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PE+A +GRSNVGKSS IN ++NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PDGGRPEVALAGRSNVGKSSFINKMINRKNLARTSSKPGKTQTLNFYLIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           +   VD+PGYG+AR  K+    WG ++  Y + R  L+   LL+D RH   + D  ++ F
Sbjct: 70  SFYFVDVPGYGFARVSKQERQKWGNMMETYFTTREVLKAAVLLVDLRHPPTKDDVMMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   ++ TK DK+
Sbjct: 130 LKHYEIPVIVIATKADKV 147


>gi|56421184|ref|YP_148502.1| ribosome biogenesis GTP-binding protein YsxC [Geobacillus
           kaustophilus HTA426]
 gi|81819655|sp|Q5KWK2|ENGB_GEOKA RecName: Full=Probable GTP-binding protein EngB
 gi|56381026|dbj|BAD76934.1| GTP-binding protein [Geobacillus kaustophilus HTA426]
          Length = 195

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 83/138 (60%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PE+A +GRSNVGKSS IN ++NRKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PDGGRPEVALAGRSNVGKSSFINKMINRKNLARTSSKPGKTQTLNFYLIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           +   VD+PGYG+AR  K+    WG ++  Y + R  L+   LL+D RH   + D  ++ F
Sbjct: 70  SFYFVDVPGYGFARVSKQERQKWGNMMETYFTTREALKAAVLLVDLRHPPTKDDVMMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   ++ TK DK+
Sbjct: 130 LKHYEIPVIVIATKADKV 147


>gi|255530888|ref|YP_003091260.1| GTP-binding protein HSR1-related [Pedobacter heparinus DSM 2366]
 gi|255343872|gb|ACU03198.1| GTP-binding protein HSR1-related [Pedobacter heparinus DSM 2366]
          Length = 201

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 111/198 (56%), Gaps = 10/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    ++  LP A  PE AF GRSNVGKSSLIN+LVN+  LA+TS  PG+TQ +N F+ 
Sbjct: 8   FICSNTKVSALPVANMPEYAFIGRSNVGKSSLINMLVNQHGLAKTSQRPGKTQLINHFLI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            +VD+PGYGYA+  K + ++W   I  Y+++R +L+CV++LID R  
Sbjct: 68  NE---------KWYIVDLPGYGYAKVSKTSRENWEKFIRNYITKRESLQCVFVLIDSRLE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID +   ++ +  + + ++ TK DK S     + +   K  +  +    P    TS+
Sbjct: 119 PQKIDLEFCCWMGEIQIPFALIFTKADKQSTVKTDKNVALFKKALGGWFEEIPPYFVTSA 178

Query: 194 VKRKGIEVLRKAILETIN 211
            K  G E + + I E +N
Sbjct: 179 EKGTGKEKVLEFI-EQVN 195


>gi|253995667|ref|YP_003047731.1| ribosome biogenesis GTP-binding protein YsxC [Methylotenera mobilis
           JLW8]
 gi|253982346|gb|ACT47204.1| GTP-binding protein HSR1-related [Methylotenera mobilis JLW8]
          Length = 211

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 104/187 (55%), Gaps = 13/187 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP A   E+AF+GRSN GKSS +N L N   LA  S  PGRTQ +NFF       L N+ 
Sbjct: 19  LPPASGVEVAFAGRSNAGKSSALNTLANHNRLAFVSKQPGRTQLINFFT------LGND- 71

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYA+ P+     W  ++ RYLSERS+L  + L++D RH +  +D+ +  
Sbjct: 72  --RHLVDLPGYGYAKVPEAMRAHWQNVLARYLSERSSLGGLVLVMDSRHPLTPLDRQMLD 129

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKT-KYLIR---NYPTAHPEVIPTSSVKRKGI 199
           +         ++LTK DKLS   A  TL +  K LI    N+  +   +   SS+K++G+
Sbjct: 130 WFCPSGKPVHVLLTKSDKLSRGEASLTLNRVRKELIETWGNHYNSECTIQLFSSLKKQGV 189

Query: 200 EVLRKAI 206
           E   K I
Sbjct: 190 EEAEKVI 196


>gi|221195789|ref|ZP_03568842.1| ribosome biogenesis GTP-binding protein YsxC [Atopobium rimae ATCC
           49626]
 gi|221184263|gb|EEE16657.1| ribosome biogenesis GTP-binding protein YsxC [Atopobium rimae ATCC
           49626]
          Length = 194

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 68/186 (36%), Positives = 101/186 (54%), Gaps = 13/186 (6%)

Query: 21  IGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK 80
           I  LPK   PE++F GRSNVGKSSL+N L+ RK LAR S+ PG+T ++NFF         
Sbjct: 17  IAQLPKPTTPEVSFVGRSNVGKSSLLNRLLGRKQLARVSSVPGKTANINFF--------- 67

Query: 81  NNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQD 140
            ++  +  VD+PGYGYA+        W  LI  Y  +  +   V  L+D RH  +++D  
Sbjct: 68  -DVDGVKFVDLPGYGYAKVSHIEKQRWADLIGGYFEQERSFNLVISLVDIRHEAQKLDLQ 126

Query: 141 VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
           +  FL +  + + + LTK DK+   T  +  +    L  ++  A  ++I TSS    GI+
Sbjct: 127 MVDFLTEAELPFVVALTKADKI---TRNKQNQAAAALRSSFGLAQEQIIITSSETGLGID 183

Query: 201 VLRKAI 206
            LR+ I
Sbjct: 184 ELRRRI 189


>gi|282879591|ref|ZP_06288322.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella timonensis
           CRIS 5C-B1]
 gi|281306539|gb|EFA98568.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella timonensis
           CRIS 5C-B1]
          Length = 199

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 108/198 (54%), Gaps = 13/198 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P +G  P     E AF GRSNVGKSSLIN+L N + LA+TS+ PG+T  +N F  
Sbjct: 8   FVLSSPNLGKCPTDQRIEYAFIGRSNVGKSSLINMLCNHQGLAKTSSTPGKTLLINHF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L NN     LVD+PGYGYA+  KK  +    LI  YL  R  L  V++LID RH 
Sbjct: 66  -----LINN--DWYLVDLPGYGYAKRSKKVQEEIQKLITTYLLHREQLVNVFVLIDVRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID++   +L    + + I+ TK DKL    A+  ++K    +++     P    TSS
Sbjct: 119 QQKIDREFIDWLGLNEIPFTIIFTKADKLGTVKAKMNVDKWMSQLKDVWEELPRYFITSS 178

Query: 194 VKRKGIEVLRKAILETIN 211
            K+ G    R+ +L+ I+
Sbjct: 179 EKKTG----RQELLDYID 192


>gi|253987784|ref|YP_003039140.1| ribosome biogenesis GTP-binding protein YsxC [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|211638662|emb|CAR67281.1| probable gtp-binding protein engb [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779234|emb|CAQ82394.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 246

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 107/190 (56%), Gaps = 10/190 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    E+AF+GRSN GKSS +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 51  FITSAPDIRHLPQDVGIEVAFAGRSNAGKSSALNALTNQKNLARTSKTPGRTQLINLFEV 110

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           ++          + LVD+PGYGYA  P++    W   +  YL +R  L  + +L+D RH 
Sbjct: 111 EE---------GIRLVDLPGYGYAEVPEEIKRKWQKALGEYLQKRECLLGLVVLMDIRHP 161

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     V   ++LTK DKL+ +  +  L K +  + N      +V   S+
Sbjct: 162 LKDLDQQMIQWAVTMNVPIMVLLTKADKLTSSARKSQLIKIRGELANL-NGDIQVEYFSA 220

Query: 194 VKRKGIEVLR 203
           +K+ GI+ L+
Sbjct: 221 LKKIGIDKLQ 230


>gi|55820661|ref|YP_139103.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           thermophilus LMG 18311]
 gi|55822552|ref|YP_140993.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           thermophilus CNRZ1066]
 gi|81820325|sp|Q5M0S3|ENGB_STRT1 RecName: Full=Probable GTP-binding protein EngB
 gi|81820489|sp|Q5M5A9|ENGB_STRT2 RecName: Full=Probable GTP-binding protein EngB
 gi|55736646|gb|AAV60288.1| GTP-binding protein [Streptococcus thermophilus LMG 18311]
 gi|55738537|gb|AAV62178.1| GTP-binding protein [Streptococcus thermophilus CNRZ1066]
          Length = 199

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/185 (41%), Positives = 97/185 (52%), Gaps = 15/185 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A +GRSNVGKSS IN L+ RKNLARTS  PG+TQ LNF+   D         
Sbjct: 25  PQDDLPEVALAGRSNVGKSSFINTLLGRKNLARTSGKPGKTQLLNFYNIDD--------- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK    WG +I  YL  R  LR V  L+D RH   Q D  ++ F
Sbjct: 76  KLRFVDVPGYGYARVSKKERAKWGKMIEEYLVTRDNLRVVVSLVDLRHEPTQDDIQMYEF 135

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E++ K K    N+   +   I  SSV R G +  
Sbjct: 136 LKYYEIPVIVVATKADKIPRGKWNKHESIIKKKL---NF-DKNDHFIVFSSVTRDGYDEA 191

Query: 203 RKAIL 207
              IL
Sbjct: 192 WDTIL 196


>gi|50086223|ref|YP_047733.1| ribosome biogenesis GTP-binding protein YsxC [Acinetobacter sp.
           ADP1]
 gi|49532199|emb|CAG69911.1| putative GTPase, involved in coordination of cell cycle (EngB)
           [Acinetobacter sp. ADP1]
          Length = 294

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 107/199 (53%), Gaps = 9/199 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++ L  +    EIAF+GRSN GKSS IN L N+K LAR S  PGRTQ +NFF  
Sbjct: 56  FLMSAPKLSLCVEDTGYEIAFAGRSNAGKSSAINSLTNQKQLARASKKPGRTQMINFF-- 113

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               +L N  P   LVD+PGYGYA  P+     W   +  YL  R +L+ + LL+D RH 
Sbjct: 114 ----SLGN--PDQRLVDLPGYGYAAVPEDMKRIWQKELENYLIHRQSLQGLVLLMDIRHP 167

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           ++  D  +  +   + +   I+LTK DKL+   A + L   K  ++    +   +   SS
Sbjct: 168 LQHFDTMMLEWAHSRKLFVHILLTKADKLNRGPANQVLLDVKQTLKKMKLSFS-IQLFSS 226

Query: 194 VKRKGIEVLRKAILETINY 212
           + ++G+E L   +   +NY
Sbjct: 227 LNKQGLEELASVMAGRLNY 245


>gi|156936144|ref|YP_001440060.1| ribosome biogenesis GTP-binding protein YsxC [Cronobacter sakazakii
           ATCC BAA-894]
 gi|156534398|gb|ABU79224.1| hypothetical protein ESA_04042 [Cronobacter sakazakii ATCC BAA-894]
          Length = 222

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 103/190 (54%), Gaps = 10/190 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 22  FVTSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 81

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 82  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRLCLKGLVVLMDIRHP 132

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 133 LKDLDQQMIEWAVDSGIPVLVLLTKADKLASGARKAQLNMVREAVIAF-NGDVQVEAFSS 191

Query: 194 VKRKGIEVLR 203
           +K+ G++ LR
Sbjct: 192 LKKTGVDKLR 201


>gi|322517185|ref|ZP_08070068.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           vestibularis ATCC 49124]
 gi|322124244|gb|EFX95760.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           vestibularis ATCC 49124]
          Length = 168

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 80/138 (57%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A +GRSNVGKSS IN L+ RKNLARTS  PG+TQ LNF+   D         
Sbjct: 25  PQDDLPEVALAGRSNVGKSSFINTLLGRKNLARTSGKPGKTQLLNFYNIDD--------- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK    WG +I  YL  R  LR V  L+D RH   Q D  ++ F
Sbjct: 76  KLRFVDVPGYGYARVSKKERAKWGKMIEEYLVTRDNLRVVVSLVDLRHEPTQDDIQMYEF 135

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   +V TK DK+
Sbjct: 136 LKYYEIPVIVVATKADKI 153


>gi|319778689|ref|YP_004129602.1| GTP-binding protein EngB [Taylorella equigenitalis MCE9]
 gi|317108713|gb|ADU91459.1| GTP-binding protein EngB [Taylorella equigenitalis MCE9]
          Length = 203

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 109/198 (55%), Gaps = 12/198 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-V 72
           F     ++  LP+   PE+ F GRSNVGKSS IN+L N++ LA  S  PGRT+ +N F +
Sbjct: 9   FFVSASQLNQLPEPSVPEVCFVGRSNVGKSSAINVLANQRRLAYASKTPGRTRLINLFGI 68

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
           P   S    +  A  LVD+PGYGYA   +   + W  ++  YL  RS+L  V LLID R 
Sbjct: 69  P---SKDDPDQAAAFLVDLPGYGYASVAQNTKEEWAEVLGSYLRTRSSLAAVVLLIDIRR 125

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKL---SPTTAQETLEKTKYLIRNYPTAHPEVI 189
           G+  +D+ +  ++    +   ++LTK DKL      TA   + K+   I++      +VI
Sbjct: 126 GLTTLDKLLIDWIAPYEIPLIVLLTKADKLPYGQRKTATFGINKSIKQIKDL-----KVI 180

Query: 190 PTSSVKRKGIEVLRKAIL 207
           P SS +R GIE   KAIL
Sbjct: 181 PFSSTERIGIEETEKAIL 198


>gi|258544865|ref|ZP_05705099.1| ribosome biogenesis GTP-binding protein YsxC [Cardiobacterium
           hominis ATCC 15826]
 gi|258519888|gb|EEV88747.1| ribosome biogenesis GTP-binding protein YsxC [Cardiobacterium
           hominis ATCC 15826]
          Length = 204

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 100/174 (57%), Gaps = 13/174 (7%)

Query: 31  EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMA--L 88
           EIAF+GRSN GKSS +N L N+K LAR S  PGRTQ +N+F           LP     L
Sbjct: 27  EIAFAGRSNAGKSSALNTLTNQKALARVSRTPGRTQLINYFA----------LPEAGCYL 76

Query: 89  VDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKK 148
           VD+PGYGYA  P++    W  L+ RYL  R+ LR + LL+D RH +K +D  +     ++
Sbjct: 77  VDLPGYGYAEVPEQMRAHWQALLGRYLLTRAVLRGIVLLMDIRHPMKDLDIRMLECCAER 136

Query: 149 AVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
            +   I+LTK DKLS   A + L+  +  + N+  A   V   SS+K++G+  L
Sbjct: 137 QLPAHILLTKADKLSRGAAGKQLQAVRGELANW-HAPFSVQMFSSLKKEGLPAL 189


>gi|228478240|ref|ZP_04062848.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           salivarius SK126]
 gi|312863700|ref|ZP_07723938.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           vestibularis F0396]
 gi|228249919|gb|EEK09189.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           salivarius SK126]
 gi|311101236|gb|EFQ59441.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           vestibularis F0396]
          Length = 199

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/185 (41%), Positives = 97/185 (52%), Gaps = 15/185 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A +GRSNVGKSS IN L+ RKNLARTS  PG+TQ LNF+   D         
Sbjct: 25  PQDDLPEVALAGRSNVGKSSFINTLLGRKNLARTSGKPGKTQLLNFYNIDD--------- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK    WG +I  YL  R  LR V  L+D RH   Q D  ++ F
Sbjct: 76  KLRFVDVPGYGYARVSKKERAKWGKMIEEYLVTRDNLRVVVSLVDLRHEPTQDDIQMYEF 135

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E++ K K    N+   +   I  SSV R G +  
Sbjct: 136 LKYYEIPVIVVATKADKIPRGKWNKHESIIKKKL---NF-DKNDHFIVFSSVTRDGYDEA 191

Query: 203 RKAIL 207
              IL
Sbjct: 192 WDTIL 196


>gi|322372511|ref|ZP_08047047.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus sp.
           C150]
 gi|321277553|gb|EFX54622.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus sp.
           C150]
          Length = 199

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 80/138 (57%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A +GRSNVGKSS IN L+ RKNLARTS  PG+TQ LNF+   D         
Sbjct: 25  PQDDLPEVALAGRSNVGKSSFINTLLGRKNLARTSGKPGKTQLLNFYNIDD--------- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK    WG +I  YL  R  LR V  L+D RH   Q D  ++ F
Sbjct: 76  KLRFVDVPGYGYARVSKKERAKWGKMIEEYLVTRDNLRVVVSLVDLRHEPTQDDIQMYEF 135

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   +V TK DK+
Sbjct: 136 LKYYEIPVIVVATKADKI 153


>gi|163752987|ref|ZP_02160111.1| GTP-binding protein [Kordia algicida OT-1]
 gi|161326719|gb|EDP98044.1| GTP-binding protein [Kordia algicida OT-1]
          Length = 202

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 102/190 (53%), Gaps = 10/190 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    ++   P+   PE AF GRSNVGKSSLIN+L  RK+LA+TS  PG+TQ +N F  
Sbjct: 8   FVMSNSDVAKCPRNKIPEYAFIGRSNVGKSSLINMLTQRKSLAKTSGRPGKTQLINHFKI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYAR  K     +   I  Y  +R+ L C ++L+D RH 
Sbjct: 68  ND---------EWFLVDLPGYGYARVSKSAKKVFQKFITEYFRKRTQLVCGFVLVDIRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKY-LIRNYPTAHPEVIPTS 192
            +++D +   +L +  + + IV TK DKL P+   + +   +  L+ +     P+   TS
Sbjct: 119 PQKVDLEFMQWLGENQIPFCIVFTKADKLRPSQIDKHVNAYREKLLEDVWEEMPQHFVTS 178

Query: 193 SVKRKGIEVL 202
           S K  G E L
Sbjct: 179 SSKAIGREEL 188


>gi|331003806|ref|ZP_08327298.1| GTP-binding protein engB [Lachnospiraceae oral taxon 107 str.
           F0167]
 gi|330411998|gb|EGG91395.1| GTP-binding protein engB [Lachnospiraceae oral taxon 107 str.
           F0167]
          Length = 197

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 85/139 (61%), Gaps = 9/139 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
            P    PEI F+G+SNVGKSSLIN L+NRK+LARTS  PG+TQ +N++   D        
Sbjct: 18  FPDNKEPEIVFAGKSNVGKSSLINALMNRKSLARTSGKPGKTQTINYYKVND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             +  VD+PGYGYA A     + WG +I RYL     ++C++LLID RH   + D+ ++ 
Sbjct: 70  -DLYFVDLPGYGYANANLATKEKWGKMIERYLHTSKQIKCIFLLIDIRHEPGKNDKQMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKL 162
           ++     S  I+ TK+DKL
Sbjct: 129 WIVYNGYSPVIIATKLDKL 147


>gi|329770551|ref|ZP_08261929.1| ribosome biogenesis GTP-binding protein YsxC [Gemella sanguinis
           M325]
 gi|328836300|gb|EGF85969.1| ribosome biogenesis GTP-binding protein YsxC [Gemella sanguinis
           M325]
          Length = 198

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/176 (40%), Positives = 96/176 (54%), Gaps = 11/176 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A  GRSNVGKSS IN ++ RKN AR S+ PG+T+ LNFF   D         
Sbjct: 22  PEHKKPEVAMCGRSNVGKSSFINTILERKNYARVSSKPGKTRTLNFFDIDD--------- 72

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            + LVD+PGYGYA+  K   +    +IV Y +    L  V  LID RH   Q D ++  F
Sbjct: 73  KLVLVDVPGYGYAKLSKSEKEKLYDMIVEYFTNSQNLGFVLHLIDSRHKPSQDDIEMNEF 132

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
           L+   + + +VLTKIDK+S       L K K  +    T +  +IP SSV + G E
Sbjct: 133 LNYYEIPFVVVLTKIDKISKNELSRNLSKIKKELE--LTNNMAIIPFSSVTKLGKE 186


>gi|146329655|ref|YP_001209308.1| GTPase [Dichelobacter nodosus VCS1703A]
 gi|146233125|gb|ABQ14103.1| GTPase [Dichelobacter nodosus VCS1703A]
          Length = 199

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 68/181 (37%), Positives = 101/181 (55%), Gaps = 11/181 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LPK    E+AF+GRSN GKSS +N L N+  LAR S  PGRTQ +N+F   D        
Sbjct: 20  LPKDAVVEVAFAGRSNAGKSSALNALTNQATLARVSKTPGRTQLINYFALPDAGKY---- 75

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYA+ P      W  L+  YL  R  L+ V L++D RH +K +DQ +  
Sbjct: 76  ----LVDLPGYGYAQVPDAVRQHWEHLLGDYLLTRQALKGVVLIMDIRHPLKPLDQQLLD 131

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQ-ETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
               +A+   ++LTK DKLS +  + +  +   +L +   ++  +    SS+K++G++ L
Sbjct: 132 CCQARALPVHVLLTKADKLSKSAQKMQQNQVANFLAQRMESSSVQTF--SSLKKEGLDAL 189

Query: 203 R 203
           R
Sbjct: 190 R 190


>gi|325286915|ref|YP_004262705.1| GTP-binding protein engB [Cellulophaga lytica DSM 7489]
 gi|324322369|gb|ADY29834.1| GTP-binding protein engB [Cellulophaga lytica DSM 7489]
          Length = 206

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 101/188 (53%), Gaps = 14/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PE AF GRSNVGKSSLIN+L+ RK+LA+TS  PG+TQ +N F   +         
Sbjct: 19  PSEPLPEYAFIGRSNVGKSSLINMLMQRKSLAKTSGRPGKTQLINHFKVNE--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYAR  KK   ++   I  Y  ER  L C ++L+D RH  +++D +   +
Sbjct: 70  NWFLVDLPGYGYARVSKKEKKTFQKYITDYFKERIQLVCAFVLVDIRHEPQKVDLEFLEW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEK-TKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           + +  + + ++ TK DKL P   Q+  +     L+       P+   TSS    G    R
Sbjct: 130 MGENQIPFALIFTKADKLKPQVIQKQADNYINALLEGIWEDAPQYFITSSANNLG----R 185

Query: 204 KAILETIN 211
           + +LE I+
Sbjct: 186 EDVLEFID 193


>gi|110598119|ref|ZP_01386397.1| GTP-binding [Chlorobium ferrooxidans DSM 13031]
 gi|110340251|gb|EAT58748.1| GTP-binding [Chlorobium ferrooxidans DSM 13031]
          Length = 202

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 104/182 (57%), Gaps = 15/182 (8%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-VPKDF 76
           V  +  LP+   PEI F+GRSNVGKS+L+N L   K LA+TS+ PG+T+ +N+F + ++F
Sbjct: 22  VSALSGLPEESTPEIVFAGRSNVGKSTLLNSLTGLKALAKTSSTPGKTRLINYFLINQEF 81

Query: 77  SNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQ 136
                       VD+PGYGYA   ++   +WG L+  Y+ ER ++  V LL D RH   +
Sbjct: 82  ----------YFVDLPGYGYAAVGQEQKAAWGHLLSSYIEERQSISLVVLLFDSRHPAME 131

Query: 137 IDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKR 196
            D+ + +FL+     Y IVLTK DKL+    Q+ + KT+ ++ +       ++  SS   
Sbjct: 132 SDRAMINFLEFHERPYGIVLTKFDKLT----QKEMAKTRRIMESCAAKAKFIVNYSSFSG 187

Query: 197 KG 198
           KG
Sbjct: 188 KG 189


>gi|85060212|ref|YP_455914.1| GTPase EngB [Sodalis glossinidius str. 'morsitans']
 gi|119369261|sp|Q2NQR6|ENGB_SODGM RecName: Full=Probable GTP-binding protein EngB
 gi|84780732|dbj|BAE75509.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 211

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 109/193 (56%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     EIAF+GRSN GKSS +N L N+K+LARTS  PGRT+ +N F  
Sbjct: 12  FVTSAPDIRHLPVDSGIEIAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTRLINLFEV 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +           + LVD+PGYGYA  P++    W   +  YL  R +L+ + +L+D RH 
Sbjct: 72  ES---------GIRLVDLPGYGYAEVPEELKRKWQRALGEYLQMRDSLKGLVVLMDIRHP 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKL+  + +E L + +     +     +V   SS
Sbjct: 123 MKDLDQQMVQWAVDVNIPVLVLLTKADKLASGSRKEQLNQVREAALAF-MGDVQVETFSS 181

Query: 194 VKRKGIEVLRKAI 206
           +K++G++ LR+ +
Sbjct: 182 LKKQGVDKLRQKL 194


>gi|295094046|emb|CBK83137.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Coprococcus sp.
           ART55/1]
          Length = 198

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 77/189 (40%), Positives = 109/189 (57%), Gaps = 15/189 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PEIAF+G+SNVGKSSLIN L+NRK+LARTS  PG+TQ +NF+      N+  NL
Sbjct: 18  LPDNDLPEIAFAGKSNVGKSSLINGLLNRKSLARTSAQPGKTQTINFY------NVNKNL 71

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
                VD+PGYGYA+   +    WG +I RYL     L+ V+LLID RH   + D  ++ 
Sbjct: 72  ---YFVDLPGYGYAKVSVEIRAKWGKMIERYLHGSPQLKKVFLLIDIRHVPSENDCMMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP--EVIPTSSVKRKGIEV 201
           ++        I+ TK+DK+  +  Q+ L+    LIR      P   +IP S+  ++G + 
Sbjct: 129 WIVDNGYEPVIICTKLDKIKRSQVQKNLK----LIREKLDLVPGTTMIPFSAQTKQGRDE 184

Query: 202 LRKAILETI 210
           +   I ET+
Sbjct: 185 IWNLIEETL 193


>gi|156082736|ref|XP_001608852.1| GTP-binding protein engB [Babesia bovis T2Bo]
 gi|154796102|gb|EDO05284.1| GTP-binding protein engB, putative [Babesia bovis]
          Length = 290

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 103/189 (54%), Gaps = 10/189 (5%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP A  PE+AF GR+N GKS LIN +  R  +      PG T+ L+F+        K   
Sbjct: 51  LPPAALPEVAFYGRTNAGKSCLINAICGRYGVCPVHELPGTTRKLHFY--------KVGT 102

Query: 84  PAMAL-VDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVF 142
           P+  + VDMPGYGY+ A       W    + YL  R+TL+ + +L+DCR G+KQ D +V 
Sbjct: 103 PSTVIFVDMPGYGYSTAKDDLSMQWNEFSLSYLKHRNTLKLLVVLVDCRIGLKQSDLEVI 162

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           +F DK  V +Q+VL K D + P    + L K +  +  + +++ + I  SS K + +E +
Sbjct: 163 NFCDKYKVKWQVVLAKADMVKPVLVAKMLHKVRLELAIFRSSNGKPIAISSTKNQNLEEI 222

Query: 203 RKAILETIN 211
           R  ILE  N
Sbjct: 223 R-GILEHFN 230


>gi|323127109|gb|ADX24406.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           dysgalactiae subsp. equisimilis ATCC 12394]
          Length = 199

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 99/186 (53%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++ RKNLARTS+ PG+TQ LNFF      N+ + L 
Sbjct: 25  PQDDLPEIALAGRSNVGKSSFINTMLGRKNLARTSSKPGKTQLLNFF------NIDDKL- 77

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   + D  ++ F
Sbjct: 78  --RFVDVPGYGYAKVSKSERAKWGKMIEEYLTSRDNLRAVVSLVDLRHEPSKEDVQMYEF 135

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+      +     K  +    T     I  SSV R GI+    
Sbjct: 136 LKYYDIPVIIVATKADKIPRGKWNKHESMVKKTLGFDKT--DRFIIFSSVDRVGIDEAWD 193

Query: 205 AILETI 210
            ILE +
Sbjct: 194 TILEHL 199


>gi|53803258|ref|YP_115009.1| GTP-binding protein [Methylococcus capsulatus str. Bath]
 gi|81681069|sp|Q604E1|ENGB_METCA RecName: Full=Probable GTP-binding protein EngB
 gi|53757019|gb|AAU91310.1| GTP-binding protein [Methylococcus capsulatus str. Bath]
          Length = 210

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 99/187 (52%), Gaps = 9/187 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           +LR + E+   P     E+AF+GRSN GKSS IN L N   LAR S  PGRT+ +NFF  
Sbjct: 10  YLRSILELKDAPPDQGCEVAFAGRSNAGKSSAINTLANVGGLARVSKTPGRTRMINFFSI 69

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA+ P +    W   + +YL  R +LR V+LL+D RH 
Sbjct: 70  DD---------GRRLVDLPGYGYAKVPGEIHRRWEAALEQYLRYRQSLRGVFLLMDVRHP 120

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
             ++D+ +  +   ++++  + LTK DKLS   A       K  +  Y +    V   SS
Sbjct: 121 FTEMDEVMIEWCAHRSIALHVALTKSDKLSRGAAMNARLMAKTRLAGYGSPDFSVQLFSS 180

Query: 194 VKRKGIE 200
           +K+ G E
Sbjct: 181 LKKSGTE 187


>gi|254228534|ref|ZP_04921959.1| GTPase of unknown function subfamily, putative [Vibrio sp. Ex25]
 gi|151938916|gb|EDN57749.1| GTPase of unknown function subfamily, putative [Vibrio sp. Ex25]
          Length = 223

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 107/190 (56%), Gaps = 10/190 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    EIAF+GRSN GKSS +N L N+K+LA+TS  PGRTQ +N F  
Sbjct: 16  FITSAPDIRHLPEDEGVEIAFAGRSNAGKSSALNRLTNQKSLAKTSKTPGRTQLINLFKV 75

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           ++            +VD+PGYG+A+ P +  + W   +  YL +R  L+ + +L+D RH 
Sbjct: 76  EE---------GCHIVDLPGYGFAQVPVEMKNKWQKSLGEYLQKRECLKGLVVLMDIRHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +  Q++LTK DKL     ++TL K +  +  +      V   SS
Sbjct: 127 MKDLDQQMIFWAIDSHIPVQVLLTKADKLKSGARKQTLLKVRKQVETF-GGDVSVDVFSS 185

Query: 194 VKRKGIEVLR 203
           +K  G++ LR
Sbjct: 186 LKGLGVDQLR 195


>gi|310829088|ref|YP_003961445.1| ribosome biogenesis GTP-binding protein YsxC [Eubacterium limosum
           KIST612]
 gi|308740822|gb|ADO38482.1| ribosome biogenesis GTP-binding protein YsxC [Eubacterium limosum
           KIST612]
          Length = 193

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 96/174 (55%), Gaps = 11/174 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEI   GRSNVGKSS IN L+ RK LARTS+ PG+TQ +NF+   D         
Sbjct: 19  PEDNLPEIVLLGRSNVGKSSFINTLIQRKGLARTSSQPGKTQTMNFYKIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A   VDMPGYGYA+  KK  + WG +I  YL +R  +  V LL+D RH   + D+ ++ +
Sbjct: 70  AFYFVDMPGYGYAKVSKKEREKWGVMIEEYLQKRENMVLVLLLVDSRHEPTEDDRLMYDW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           L    +   I+ TK DK+S    ++ ++     +R  P    +VI  S+  + G
Sbjct: 130 LTYYGLDPVIIATKADKISKVRQKKAVDNIFNTLR--PRKRSDVILFSAATKMG 181


>gi|260063723|ref|YP_003196803.1| putative GTP-binding cell division protein [Robiginitalea biformata
           HTCC2501]
 gi|88783168|gb|EAR14341.1| putative GTP-binding cell division protein [Robiginitalea biformata
           HTCC2501]
          Length = 208

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 97/180 (53%), Gaps = 10/180 (5%)

Query: 20  EIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNL 79
           ++   P    PE AF GRSNVGKSSLIN+L +RK+LA+ S  PG+TQ +N F   D    
Sbjct: 14  DVSRCPAEPLPEYAFIGRSNVGKSSLINMLTDRKHLAKISGRPGKTQLINHFRIND---- 69

Query: 80  KNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQ 139
                   LVD+PGYGYAR  KK+  ++  LI RY  ER  L   +LL+D RH  + ID 
Sbjct: 70  -----NWFLVDLPGYGYARTSKKDKAAFQKLIHRYFRERRQLLSAFLLVDIRHEPQPIDL 124

Query: 140 DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP-TAHPEVIPTSSVKRKG 198
           +   +L  + + + ++ TK DKL P       +     +RN    A P    TSS+K  G
Sbjct: 125 EFMEWLTGEGIPFALIFTKADKLKPGAVSRQTDGYLQAMRNAGWEADPPFFVTSSLKGIG 184


>gi|260583671|ref|ZP_05851419.1| ribosome biogenesis GTP-binding protein YsxC [Granulicatella
           elegans ATCC 700633]
 gi|260158297|gb|EEW93365.1| ribosome biogenesis GTP-binding protein YsxC [Granulicatella
           elegans ATCC 700633]
          Length = 197

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 81/132 (61%), Gaps = 9/132 (6%)

Query: 31  EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVD 90
           EIA SGRSNVGKSS IN L+ RK+LARTS+ PG+TQ LNF+   D             VD
Sbjct: 25  EIALSGRSNVGKSSFINRLIQRKSLARTSSKPGKTQTLNFYHINDL---------FYFVD 75

Query: 91  MPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAV 150
           +PGYGYA+  KK  + WG +I  Y++ R  L  V +L+D RH     D  +  FL+   +
Sbjct: 76  VPGYGYAKVSKKEREKWGKMIEEYITTRENLELVLILVDFRHEPSTEDVQMREFLEYYEI 135

Query: 151 SYQIVLTKIDKL 162
            Y+I++TK DK+
Sbjct: 136 PYRIIMTKCDKI 147


>gi|124809435|ref|XP_001348574.1| GTP binding protein, putative [Plasmodium falciparum 3D7]
 gi|23497470|gb|AAN37013.1| GTP binding protein, putative [Plasmodium falciparum 3D7]
          Length = 1000

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 104/199 (52%), Gaps = 9/199 (4%)

Query: 9   KSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHL 68
           K   +  +   ++  LP    PEIAF GRSN GKS+LIN L  R N A+ S  PG T+ +
Sbjct: 93  KPRMVLYKTAIQVNELPLPKYPEIAFIGRSNCGKSTLINELCGRTNKAKVSKIPGCTKEI 152

Query: 69  NFFVPKDFSNLKNNLPA-MALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLL 127
           +F+        K   P  M LVD+PGYGYA   ++    W    + YL  R  L+ V++L
Sbjct: 153 HFY--------KIGKPCLMCLVDLPGYGYAECKEELRLQWNEFTLFYLKNRKNLKKVFVL 204

Query: 128 IDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE 187
           IDCR G+K  D+++  F D+  + YQIVL+K D L+       ++     I  +      
Sbjct: 205 IDCRVGLKTSDKELLHFFDRYNIKYQIVLSKCDLLNTKDLAIKIQIINQDILPFKNLEKP 264

Query: 188 VIPTSSVKRKGIEVLRKAI 206
           +IP SS+K + +  LR  I
Sbjct: 265 LIPLSSIKNQNLSELRNEI 283


>gi|269964580|ref|ZP_06178819.1| GTP-binding protein [Vibrio alginolyticus 40B]
 gi|269830707|gb|EEZ84927.1| GTP-binding protein [Vibrio alginolyticus 40B]
          Length = 223

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 107/190 (56%), Gaps = 10/190 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    EIAF+GRSN GKSS +N L N+K+LA+TS  PGRTQ +N F  
Sbjct: 16  FITSAPDIRHLPEDEGVEIAFAGRSNAGKSSALNRLTNQKSLAKTSKTPGRTQLINLFKV 75

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           ++            +VD+PGYG+A+ P +  + W   +  YL +R  L+ + +L+D RH 
Sbjct: 76  EE---------GCHIVDLPGYGFAQVPVEMKNKWQKSLGEYLQKRECLKGLVVLMDIRHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +  Q++LTK DKL     ++TL K +  +  +      V   SS
Sbjct: 127 MKDLDQQMIFWAIDSHIPVQVLLTKADKLKSGARKQTLLKVRKQVETF-GGDVSVDVFSS 185

Query: 194 VKRKGIEVLR 203
           +K  G++ LR
Sbjct: 186 LKGLGVDQLR 195


>gi|91224945|ref|ZP_01260204.1| GTP-binding protein [Vibrio alginolyticus 12G01]
 gi|91190191|gb|EAS76461.1| GTP-binding protein [Vibrio alginolyticus 12G01]
          Length = 223

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 107/190 (56%), Gaps = 10/190 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    EIAF+GRSN GKSS +N L N+K+LA+TS  PGRTQ +N F  
Sbjct: 16  FITSAPDIRHLPEDEGVEIAFAGRSNAGKSSALNRLTNQKSLAKTSKTPGRTQLINLFKV 75

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           ++            +VD+PGYG+A+ P +  + W   +  YL +R  L+ + +L+D RH 
Sbjct: 76  EE---------GCHIVDLPGYGFAQVPVEMKNKWQKSLGEYLQKRECLKGLVVLMDIRHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +  Q++LTK DKL     ++TL K +  +  +      V   SS
Sbjct: 127 MKDLDQQMIFWAIDSHIPVQVLLTKADKLKSGARKQTLLKVRKQVETF-GGDVSVDVFSS 185

Query: 194 VKRKGIEVLR 203
           +K  G++ LR
Sbjct: 186 LKGLGVDQLR 195


>gi|238794562|ref|ZP_04638170.1| GTP-binding protein engB [Yersinia intermedia ATCC 29909]
 gi|238726142|gb|EEQ17688.1| GTP-binding protein engB [Yersinia intermedia ATCC 29909]
          Length = 207

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 4   FVISAPDIRHLPRDEGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 63

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + LVD+PGYGYA  P++    W   +  YL +R+ L+ + +L+D RH 
Sbjct: 64  VD---------GIRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHP 114

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ + ++         ++LTK DKL+    +  L   +  I  +     +V   SS
Sbjct: 115 LKDLDQQMITWAVAVGTPVLLLLTKADKLASGARKAQLNMVREAIIPF-MGDIQVEAFSS 173

Query: 194 VKRKGIEVLRKAI 206
           +K+ G+E LR+ +
Sbjct: 174 LKKIGVEKLREKL 186


>gi|262392690|ref|YP_003284544.1| GTP-binding protein EngB [Vibrio sp. Ex25]
 gi|262336284|gb|ACY50079.1| GTP-binding protein EngB [Vibrio sp. Ex25]
          Length = 219

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 111/196 (56%), Gaps = 11/196 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    EIAF+GRSN GKSS +N L N+K+LA+TS  PGRTQ +N F  
Sbjct: 12  FITSAPDIRHLPEDEGVEIAFAGRSNAGKSSALNRLTNQKSLAKTSKTPGRTQLINLFKV 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           ++            +VD+PGYG+A+ P +  + W   +  YL +R  L+ + +L+D RH 
Sbjct: 72  EE---------GCHIVDLPGYGFAQVPVEMKNKWQKSLGEYLQKRECLKGLVVLMDIRHP 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +  Q++LTK DKL     ++TL K +  +  +      V   SS
Sbjct: 123 MKDLDQQMIFWAIDSHIPVQVLLTKADKLKSGARKQTLLKVRKQVETF-GGDVSVDVFSS 181

Query: 194 VKRKGIEVLRKAILET 209
           +K  G++ LR A L+T
Sbjct: 182 LKGLGVDQLR-AKLDT 196


>gi|221059611|ref|XP_002260451.1| probable GTP-binding protein [Plasmodium knowlesi strain H]
 gi|193810524|emb|CAQ41718.1| probable GTP-binding protein, putative [Plasmodium knowlesi strain
           H]
          Length = 965

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 105/195 (53%), Gaps = 9/195 (4%)

Query: 13  IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           I  +   ++  LP    PEIAF GRSN GKS+LIN L  R N A+ S  PG T+ ++F+ 
Sbjct: 112 ILYKTAIQVSELPLPKYPEIAFIGRSNSGKSTLINELCGRTNKAKVSKLPGCTKEIHFY- 170

Query: 73  PKDFSNLKNNLPAM-ALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCR 131
                  K   P +  LVD+PGYG+A + ++    W    + YL  R  L+ V++LIDCR
Sbjct: 171 -------KIAKPCLLCLVDLPGYGFAHSKEELRLQWNEFTLFYLKNRKNLKKVFVLIDCR 223

Query: 132 HGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT 191
            G+K  D+++  F D+  + YQIV +K D L+       ++     I  +      +IP 
Sbjct: 224 VGLKTSDKELLHFFDRYNIKYQIVFSKCDLLNTKDLAVKIQIANEEIACFKNLEAPIIPL 283

Query: 192 SSVKRKGIEVLRKAI 206
           SS+KR+ +  LRK I
Sbjct: 284 SSLKRQNLNELRKEI 298


>gi|15603376|ref|NP_246450.1| GTPase EngB [Pasteurella multocida subsp. multocida str. Pm70]
 gi|13431508|sp|P57947|ENGB_PASMU RecName: Full=Probable GTP-binding protein EngB
 gi|12721898|gb|AAK03595.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 205

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 104/189 (55%), Gaps = 10/189 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P+I  LP+    EIAF+GRSN GKS+ +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 13  FLTSAPDIRALPEDSGIEIAFAGRSNAGKSTALNALTNQKSLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  L  V +L+D RH 
Sbjct: 73  E---------PQCRLVDLPGYGYAAVPEQMKIQWQKALGEYLQKRQCLAGVVILMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKLS +   + ++  +  I  +     +V   S+
Sbjct: 124 LKDLDQQMIEWAVASELPVLLLLTKADKLSQSARSKQVKMVREAILPF-QGDVQVEAFSA 182

Query: 194 VKRKGIEVL 202
           + + GI+ L
Sbjct: 183 LNKTGIDRL 191


>gi|88801296|ref|ZP_01116824.1| GTP-binding protein [Polaribacter irgensii 23-P]
 gi|88781954|gb|EAR13131.1| GTP-binding protein [Polaribacter irgensii 23-P]
          Length = 203

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 97/189 (51%), Gaps = 17/189 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PE AF GRSNVGKSSLIN+L+ RK+LA+ S  PG+TQ +N F   +         
Sbjct: 19  PTERMPEYAFIGRSNVGKSSLINMLMERKDLAKISGKPGKTQLINHFKINE--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA   KK    +   I  Y  ER  L C ++LID RH  ++ID D   F
Sbjct: 70  EWFLVDLPGYGYASVSKKKRVIFQYFIENYFKEREQLVCTFVLIDSRHDPQKIDLDFMQF 129

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L +  + + I+ TK DKL  S    Q T  K K L       H E +PTS +      + 
Sbjct: 130 LGENQIPFCIIFTKADKLGSSKLNKQITSYKKKLL------QHWETLPTSFLTSSNTSLG 183

Query: 203 RKAILETIN 211
           R   L  I+
Sbjct: 184 RTEFLNFID 192


>gi|156100483|ref|XP_001615969.1| hypothetical protein [Plasmodium vivax SaI-1]
 gi|148804843|gb|EDL46242.1| hypothetical protein, conserved [Plasmodium vivax]
          Length = 988

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 107/199 (53%), Gaps = 9/199 (4%)

Query: 9   KSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHL 68
           K   I  +   ++  LP    PEIAF GRSN GKS+LIN L  R N A+ S  PG T+ +
Sbjct: 113 KPRMILYKTAIQVSELPLPKYPEIAFIGRSNCGKSTLINELCGRTNKAKVSKLPGCTKEI 172

Query: 69  NFFVPKDFSNLKNNLPAM-ALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLL 127
           +F+        K   P +  LVD+PGYG+A + ++    W    + YL  R  L+ V++L
Sbjct: 173 HFY--------KIAKPCLLCLVDLPGYGFAHSKEELRLQWNEFTLFYLKNRKNLKKVFVL 224

Query: 128 IDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE 187
           IDCR G+K  D+++  F D+  + YQIVL+K D L+       ++     I  +      
Sbjct: 225 IDCRIGLKTSDKELLHFFDRYNIKYQIVLSKCDLLNTKDLAIKIQIANEEIACFKNLEAP 284

Query: 188 VIPTSSVKRKGIEVLRKAI 206
           +IP SS+KR+ +  LR+ I
Sbjct: 285 IIPLSSLKRQNLNELRREI 303


>gi|294651641|ref|ZP_06728945.1| ribosome biogenesis GTP-binding protein YsxC [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292822490|gb|EFF81389.1| ribosome biogenesis GTP-binding protein YsxC [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 258

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 106/199 (53%), Gaps = 9/199 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++ L  +    EIAF+GRSN GKSS IN L N+K LAR S  PGRTQ +NFF  
Sbjct: 46  FLMSAPKLALCVEDTGYEIAFAGRSNAGKSSAINALTNKKQLARASKKPGRTQMINFF-- 103

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               +L N  P   LVD+PGYGYA  P+     W   +  YL  R +L+ + LL+D RH 
Sbjct: 104 ----SLGN--PDQRLVDLPGYGYAAVPESMKIVWQKELENYLIHRKSLQGLVLLMDIRHP 157

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           ++  D  +  +   + +   I+LTK DKL+   A +TL   K  ++        +   SS
Sbjct: 158 LQHFDLMMLEWAHSRHLFVHILLTKADKLNRGPANKTLLDVKQQLKKMKLDF-SIQLFSS 216

Query: 194 VKRKGIEVLRKAILETINY 212
           + R G+E L   +   +NY
Sbjct: 217 LNRIGLEELASVMAGRLNY 235


>gi|238755603|ref|ZP_04616940.1| GTP-binding protein engB [Yersinia ruckeri ATCC 29473]
 gi|238706203|gb|EEP98583.1| GTP-binding protein engB [Yersinia ruckeri ATCC 29473]
          Length = 216

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 13  FVISAPDIRHLPRDEGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + LVD+PGYGYA  P++    W   +  YL +R+ L+ + +L+D RH 
Sbjct: 73  TD---------GIRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ + ++         ++LTK DKL+    +  L   +  I  +     +V   SS
Sbjct: 124 LKDLDQQMITWAVAVGTPVMLLLTKADKLASGARKAQLNMVREAIIPF-MGDIQVETFSS 182

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 183 LKKIGVDKLREKL 195


>gi|188585731|ref|YP_001917276.1| GTP-binding protein HSR1-related [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|229813286|sp|B2A1E8|ENGB_NATTJ RecName: Full=Probable GTP-binding protein EngB
 gi|179350418|gb|ACB84688.1| GTP-binding protein HSR1-related [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 193

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 98/175 (56%), Gaps = 11/175 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
            P    PEI+F GRSNVGKSSLIN L+NRKNLA TS  PG+T+ +NFF+           
Sbjct: 18  FPSEMYPEISFIGRSNVGKSSLINTLINRKNLAYTSKQPGKTRTINFFLIN--------- 68

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
            ++  VD+PGYG+A+  K     W  L+  YLS+R+TL+   L+ID RHG K  D D+F 
Sbjct: 69  KSLYFVDLPGYGFAKVSKTMQKDWEQLVNAYLSQRNTLKLSILIIDGRHGPKDADIDMFD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           +L        +V TK+DK+     ++ + + +  +        E+I  SS   +G
Sbjct: 129 YLLDFERPVLLVATKMDKVKANKRKQRITEMRSALE--LDQDDELITFSSATGEG 181


>gi|292558275|gb|ADE31276.1| GTP-binding protein domain containing protein [Streptococcus suis
           GZ1]
          Length = 206

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 103/207 (49%), Gaps = 16/207 (7%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           I T +A I L  V +    P    PEIA +GRSNVGKSS IN L+ RKNLARTS  PG+T
Sbjct: 14  INTHNAEILLSAVSK-AQYPGYDIPEIALAGRSNVGKSSFINTLLGRKNLARTSGKPGKT 72

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LNF+   D          +  VD+PGYGYA+  K     WG +I  YL+ R  LR V 
Sbjct: 73  QQLNFYNIDD---------KIRFVDVPGYGYAKVSKTERAKWGKMIEEYLTTRENLRVVV 123

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPT 183
            L+D RH     D  ++ FL    +   IV TK DK+        E++ K K        
Sbjct: 124 SLVDMRHEPSADDVQMYDFLKYYEIPVIIVATKADKIPRGKWNKHESMIKKKLDF----D 179

Query: 184 AHPEVIPTSSVKRKGIEVLRKAILETI 210
            + + +  SS  R G +    AIL  I
Sbjct: 180 KNDQFVIFSSETRHGYDQAWDAILSNI 206


>gi|28896883|ref|NP_796488.1| ribosome biogenesis GTP-binding protein YsxC [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153838823|ref|ZP_01991490.1| GTP-binding protein [Vibrio parahaemolyticus AQ3810]
 gi|260365930|ref|ZP_05778424.1| ribosome biogenesis GTP-binding protein YsxC [Vibrio
           parahaemolyticus K5030]
 gi|260877782|ref|ZP_05890137.1| ribosome biogenesis GTP-binding protein YsxC [Vibrio
           parahaemolyticus AN-5034]
 gi|260895568|ref|ZP_05904064.1| ribosome biogenesis GTP-binding protein YsxC [Vibrio
           parahaemolyticus Peru-466]
 gi|260902593|ref|ZP_05910988.1| ribosome biogenesis GTP-binding protein YsxC [Vibrio
           parahaemolyticus AQ4037]
 gi|31340058|sp|Q87TG0|ENGB_VIBPA RecName: Full=Probable GTP-binding protein EngB
 gi|28805091|dbj|BAC58372.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149747753|gb|EDM58649.1| GTP-binding protein [Vibrio parahaemolyticus AQ3810]
 gi|308088574|gb|EFO38269.1| ribosome biogenesis GTP-binding protein YsxC [Vibrio
           parahaemolyticus Peru-466]
 gi|308089816|gb|EFO39511.1| ribosome biogenesis GTP-binding protein YsxC [Vibrio
           parahaemolyticus AN-5034]
 gi|308109669|gb|EFO47209.1| ribosome biogenesis GTP-binding protein YsxC [Vibrio
           parahaemolyticus AQ4037]
 gi|308113473|gb|EFO51013.1| ribosome biogenesis GTP-binding protein YsxC [Vibrio
           parahaemolyticus K5030]
 gi|328471657|gb|EGF42534.1| GTP-binding protein YsxC [Vibrio parahaemolyticus 10329]
          Length = 219

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 111/196 (56%), Gaps = 11/196 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    EIAF+GRSN GKSS +N L N+K+LA+TS  PGRTQ +N F  
Sbjct: 12  FITSAPDIRHLPEDEGVEIAFAGRSNAGKSSALNRLTNQKSLAKTSKTPGRTQLINLFKV 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           ++            +VD+PGYG+A+ P +  + W   +  YL +R  L+ + +L+D RH 
Sbjct: 72  EE---------GCHIVDLPGYGFAQVPVEMKNKWQKSLGEYLQKRECLKGLVVLMDIRHP 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +  Q++LTK DKL     ++TL K +  +  +      V   SS
Sbjct: 123 MKDLDQQMIFWAIDSRIPVQVLLTKADKLKSGARKQTLLKIRKQVETF-GGDVSVDVFSS 181

Query: 194 VKRKGIEVLRKAILET 209
           +K  G++ LR A L+T
Sbjct: 182 LKGLGVDQLR-AKLDT 196


>gi|37678371|ref|NP_932980.1| GTPase EngB [Vibrio vulnificus YJ016]
 gi|37197110|dbj|BAC92951.1| predicted GTPase [Vibrio vulnificus YJ016]
          Length = 220

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 110/196 (56%), Gaps = 11/196 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     EIAF+GRSN GKSS +N L N+KNLA+TS  PGRTQ +N F  
Sbjct: 16  FITSAPDIRHLPADEGIEIAFAGRSNAGKSSALNRLTNQKNLAKTSKTPGRTQLINLFKV 75

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +  +         +VD+PGYG+A+ P +  + W   +  YL +R  L+ + +L+D RH 
Sbjct: 76  TEGCH---------IVDLPGYGFAQVPLEMKNKWQKSLGEYLQKRECLKGLVVLMDIRHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +  +  +  Q++LTK DKL     +  L K + L   +     +V   SS
Sbjct: 127 MKDLDQQMIFWAIESRIPVQVLLTKADKLKSGARKAELLKVRKLAETF-GGDVQVDVYSS 185

Query: 194 VKRKGIEVLRKAILET 209
           +K  G++ LR A L+T
Sbjct: 186 LKGLGVDQLR-AKLDT 200


>gi|226953864|ref|ZP_03824328.1| GTPase, involved in coordination of cell cycle (EngB)
           [Acinetobacter sp. ATCC 27244]
 gi|226835347|gb|EEH67730.1| GTPase, involved in coordination of cell cycle (EngB)
           [Acinetobacter sp. ATCC 27244]
          Length = 258

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 106/199 (53%), Gaps = 9/199 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++ L  +    EIAF+GRSN GKSS IN L N+K LAR S  PGRTQ +NFF  
Sbjct: 46  FLMSAPKLALCVEDTGYEIAFAGRSNAGKSSAINALTNKKQLARASKKPGRTQMINFF-- 103

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               +L N  P   LVD+PGYGYA  P+     W   +  YL  R +L+ + LL+D RH 
Sbjct: 104 ----SLGN--PDQRLVDLPGYGYAAVPESMKIVWQKELENYLIHRKSLQGLVLLMDIRHP 157

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           ++  D  +  +   + +   I+LTK DKL+   A +TL   K  ++        +   SS
Sbjct: 158 LQHFDLMMLEWAHSRHLFVHILLTKADKLNRGPANKTLLDVKQQLKKMKLDF-SIQLFSS 216

Query: 194 VKRKGIEVLRKAILETINY 212
           + R G+E L   +   +NY
Sbjct: 217 LNRIGLEELASVMAGRLNY 235


>gi|223932114|ref|ZP_03624118.1| small GTP-binding protein domain protein [Streptococcus suis
           89/1591]
 gi|302023733|ref|ZP_07248944.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus suis
           05HAS68]
 gi|330832768|ref|YP_004401593.1| GTP-binding protein [Streptococcus suis ST3]
 gi|223899095|gb|EEF65452.1| small GTP-binding protein domain protein [Streptococcus suis
           89/1591]
 gi|329306991|gb|AEB81407.1| GTP-binding protein [Streptococcus suis ST3]
          Length = 195

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 103/207 (49%), Gaps = 16/207 (7%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           I T +A I L  V +    P    PEIA +GRSNVGKSS IN L+ RKNLARTS  PG+T
Sbjct: 3   INTHNAEILLSAVSK-AQYPGDDIPEIALAGRSNVGKSSFINTLLGRKNLARTSGKPGKT 61

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LNF+   D          +  VD+PGYGYA+  K     WG +I  YL+ R  LR V 
Sbjct: 62  QQLNFYNIDD---------KIRFVDVPGYGYAKVSKTERAKWGKMIEEYLTTRENLRVVV 112

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPT 183
            L+D RH     D  ++ FL    +   IV TK DK+        E++ K K        
Sbjct: 113 SLVDMRHEPSADDVQMYDFLKYYEIPVIIVATKADKIPQGKWNKHESMIKKKLDF----D 168

Query: 184 AHPEVIPTSSVKRKGIEVLRKAILETI 210
            + + +  SS  R G +    AIL  I
Sbjct: 169 KNDQFVIFSSETRHGYDQAWDAILSNI 195


>gi|116627470|ref|YP_820089.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           thermophilus LMD-9]
 gi|122267932|sp|Q03LM9|ENGB_STRTD RecName: Full=Probable GTP-binding protein EngB
 gi|116100747|gb|ABJ65893.1| Predicted GTPase [Streptococcus thermophilus LMD-9]
 gi|312277988|gb|ADQ62645.1| GTPase EngB [Streptococcus thermophilus ND03]
          Length = 199

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 77/185 (41%), Positives = 97/185 (52%), Gaps = 15/185 (8%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A +GRSNVGKSS IN L+ RKNLARTS  PG+TQ LNF+   D         
Sbjct: 25  PQDDLPEVALAGRSNVGKSSFINTLLGRKNLARTSGKPGKTQLLNFYNIDD--------- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYAR  KK    WG +I  YL  R  LR V  L+D RH   Q D  ++ F
Sbjct: 76  KLRFVDVPGYGYARVSKKARAKWGKMIEEYLVTRDNLRVVVSLVDLRHEPTQDDIQMYEF 135

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E++ K K    N+   +   I  SSV R G +  
Sbjct: 136 LKYYEIPVIVVATKADKIPRGKWNKHESIIKKKL---NF-DKNDHFIVFSSVTRDGYDEA 191

Query: 203 RKAIL 207
              IL
Sbjct: 192 WDTIL 196


>gi|119503604|ref|ZP_01625687.1| GTP-binding protein EngB [marine gamma proteobacterium HTCC2080]
 gi|119460666|gb|EAW41758.1| GTP-binding protein EngB [marine gamma proteobacterium HTCC2080]
          Length = 221

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 100/191 (52%), Gaps = 12/191 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++    +G  P     E+AF+GRSN GKSS IN L + + LARTS  PGRTQ +NFF  
Sbjct: 21  FMQSASSLGNAPSDTGSEVAFAGRSNAGKSSAINTLTSNRKLARTSRTPGRTQLINFFSL 80

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D         +  LVD+PGYGYA+ P K    W   +  YL  R +LR + LL+D RH 
Sbjct: 81  SD---------SQRLVDLPGYGYAKVPLKMKQEWNRHMADYLQRRESLRGLILLMDIRHP 131

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY-PTAHPEVIPTS 192
           +   D+ +  +  K  +    +LTK DKL    A+ TL   +  +  +   A  ++   S
Sbjct: 132 LTDADEQMIGWASKAQMPIHALLTKADKLKRGPAKATLLSVQARLLEFGDLASAQLF--S 189

Query: 193 SVKRKGIEVLR 203
           S+K  G+  LR
Sbjct: 190 SLKEDGLPALR 200


>gi|228471282|ref|ZP_04056088.1| ribosome biogenesis GTP-binding protein YsxC [Porphyromonas uenonis
           60-3]
 gi|228306924|gb|EEK16022.1| ribosome biogenesis GTP-binding protein YsxC [Porphyromonas uenonis
           60-3]
          Length = 203

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 68/190 (35%), Positives = 107/190 (56%), Gaps = 10/190 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++  P +   P++  PE AF GRSNVGKSSLIN+L   K LA TS  PG+TQ +N F+ 
Sbjct: 8   FVQSSPSVKSCPQSTLPEYAFIGRSNVGKSSLINMLTGHKGLAMTSQKPGKTQLINHFLI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                      +  LVD+PGYGYAR   +  + +  LI +Y+S+R  L  +++L+D RH 
Sbjct: 68  NQ---------SWHLVDLPGYGYARRSLEQREQFRKLITQYVSKREALVNLFVLVDIRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKY-LIRNYPTAHPEVIPTS 192
            ++ID +  + + +K + + IV TK DK+     QE +E  +  L+ ++    P  + ++
Sbjct: 119 PQRIDLEFINEMGEKGIPFSIVFTKADKIGKQVQQEAVEAYRSRLLEDWEELPPLFVTSA 178

Query: 193 SVKRKGIEVL 202
           S      E+L
Sbjct: 179 STGMGRDELL 188


>gi|85860199|ref|YP_462401.1| ribosome biogenesis GTP-binding protein YsxC [Syntrophus
           aciditrophicus SB]
 gi|119369274|sp|Q2LVW9|ENGB_SYNAS RecName: Full=Probable GTP-binding protein EngB
 gi|85723290|gb|ABC78233.1| GTP-binding protein [Syntrophus aciditrophicus SB]
          Length = 196

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 68/139 (48%), Positives = 81/139 (58%), Gaps = 9/139 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PE+AF GRSNVGKSSLIN L+ RK LARTSN PGRTQ +NFF      N+   L 
Sbjct: 19  PPGSLPEVAFVGRSNVGKSSLINTLLRRKQLARTSNTPGRTQLINFF------NVNQEL- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYG+AR P+     WG +I  YL +R  LR V  ++D R    Q D  +  +
Sbjct: 72  --LFVDLPGYGFARVPEAVKREWGPMIETYLRDRECLRMVVFILDIRRDPSQEDLALKGW 129

Query: 145 LDKKAVSYQIVLTKIDKLS 163
           LD        VLTK DKLS
Sbjct: 130 LDYYGRRTLFVLTKSDKLS 148


>gi|313669022|ref|YP_004049306.1| GTP-binding protein [Neisseria lactamica ST-640]
 gi|313006484|emb|CBN87947.1| putative GTP-binding protein [Neisseria lactamica 020-06]
          Length = 207

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 77/194 (39%), Positives = 103/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 9   FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHTRLAYVSKTPGRTQHINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL  R  L  + L++D RH 
Sbjct: 66  ----ELQN---GNFMVDLPGYGYAQVPEAVRSHWVNLLGDYLRYRKQLIGLVLIMDARHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP-EVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y       V   S
Sbjct: 119 LKELDIRMLDFFHTTGRPVHILLSKSDKLSKNEQIKTLSQVKKLLKPYSERQNIGVQLFS 178

Query: 193 SVKRKGIEVLRKAI 206
           S+KR+GIE + + +
Sbjct: 179 SLKRQGIEEVGRTV 192


>gi|315038090|ref|YP_004031658.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           amylovorus GRL 1112]
 gi|325956543|ref|YP_004291955.1| GTP-binding protein YsxC [Lactobacillus acidophilus 30SC]
 gi|312276223|gb|ADQ58863.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           amylovorus GRL 1112]
 gi|325333108|gb|ADZ07016.1| GTP-binding protein YsxC [Lactobacillus acidophilus 30SC]
 gi|327183369|gb|AEA31816.1| GTP-binding protein YsxC [Lactobacillus amylovorus GRL 1118]
          Length = 196

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 104/188 (55%), Gaps = 12/188 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PEIA +GRSNVGKSSLIN L+ RKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PKDNLPEIALAGRSNVGKSSLINTLLKRKNLARTSSQPGKTQTLNFYLVND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  +K    +G +I  YL  R  L+ + +LID RH   + D  ++ +
Sbjct: 70  EFYLVDVPGYGYAKVSQKRRQEFGEMIQDYLETRPNLKGLIILIDSRHEPTKDDIAMYEY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEK-TKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
                +   +V TK+DK+  +   + +    K L  NY   H  V+  SSV +  +  L 
Sbjct: 130 AQYLNIPILVVCTKMDKIKKSQTNKVMSGLKKNLDLNYD--HVTVLTFSSVTKLHVAELG 187

Query: 204 KAILETIN 211
             I + IN
Sbjct: 188 DWIEDKIN 195


>gi|160878538|ref|YP_001557506.1| GTP-binding protein HSR1-related [Clostridium phytofermentans ISDg]
 gi|189037174|sp|A9KHA0|ENGB_CLOPH RecName: Full=Probable GTP-binding protein EngB
 gi|160427204|gb|ABX40767.1| GTP-binding protein HSR1-related [Clostridium phytofermentans ISDg]
          Length = 201

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 64/184 (34%), Positives = 110/184 (59%), Gaps = 11/184 (5%)

Query: 23  LLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNN 82
           +LP+   PE AF+G+SNVGKSSLIN L+NRK+ ARTS+ PG+TQ +NF+   +       
Sbjct: 17  VLPENTQPEFAFAGKSNVGKSSLINGLMNRKSFARTSSQPGKTQTINFYHLNE------- 69

Query: 83  LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVF 142
              +  VD+PGYGYA+   +    WG +I +YL   + L+ ++LLID RH     D+D++
Sbjct: 70  --KLYFVDLPGYGYAKVSSELKAKWGKMIEKYLRTSTQLKVIFLLIDIRHEPSANDKDMY 127

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
            ++        I+ TK+DK++ +   + ++  +  +     A+ +++P SS+ ++G + +
Sbjct: 128 EWIVHNGFEPVIIATKLDKINRSQRDKHIKMVRTGL--CAGANTKILPFSSLSKEGKDDI 185

Query: 203 RKAI 206
            + I
Sbjct: 186 WRCI 189


>gi|320157740|ref|YP_004190119.1| GTP-binding protein EngB [Vibrio vulnificus MO6-24/O]
 gi|119370482|sp|Q8DDQ8|ENGB_VIBVU RecName: Full=Probable GTP-binding protein EngB
 gi|319933052|gb|ADV87916.1| GTP-binding protein EngB [Vibrio vulnificus MO6-24/O]
          Length = 216

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 110/196 (56%), Gaps = 11/196 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     EIAF+GRSN GKSS +N L N+KNLA+TS  PGRTQ +N F  
Sbjct: 12  FITSAPDIRHLPADEGIEIAFAGRSNAGKSSALNRLTNQKNLAKTSKTPGRTQLINLFKV 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +  +         +VD+PGYG+A+ P +  + W   +  YL +R  L+ + +L+D RH 
Sbjct: 72  TEGCH---------IVDLPGYGFAQVPLEMKNKWQKSLGEYLQKRECLKGLVVLMDIRHP 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +  +  +  Q++LTK DKL     +  L K + L   +     +V   SS
Sbjct: 123 MKDLDQQMIFWAIESRIPVQVLLTKADKLKSGARKAELLKVRKLAETF-GGDVQVDVYSS 181

Query: 194 VKRKGIEVLRKAILET 209
           +K  G++ LR A L+T
Sbjct: 182 LKGLGVDQLR-AKLDT 196


>gi|313893181|ref|ZP_07826758.1| ribosome biogenesis GTP-binding protein YsxC [Veillonella sp. oral
           taxon 158 str. F0412]
 gi|313442534|gb|EFR60949.1| ribosome biogenesis GTP-binding protein YsxC [Veillonella sp. oral
           taxon 158 str. F0412]
          Length = 222

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 105/187 (56%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF---VPKDFSNLKN 81
           P+    EIAF GRSNVGKSSLIN L N + LA  S  PG+T+ +N+F     +D S  + 
Sbjct: 33  PEGDTVEIAFLGRSNVGKSSLINSLCNYRGLALVSGQPGKTKTINYFDIESKEDISETEE 92

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYL--SERSTLRCVYLLIDCRHGVKQIDQ 139
                 LVD+PGYG+A+  K N + W   I  Y+  SER  L C  LLID RH    ID+
Sbjct: 93  RRYNWFLVDLPGYGFAKTNKGNRNLWSSFIADYILHSERLMLLC--LLIDGRHPEMPIDK 150

Query: 140 DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI 199
             + +L +  V  QIV+TK DKL+       L K K +   YPT  P ++  SS+K  G 
Sbjct: 151 VAYDWLVEAGVPLQIVVTKADKLTAKEKSANLAKIKEM---YPTDTPPIL-YSSLKHTGR 206

Query: 200 EVLRKAI 206
           E+L++ I
Sbjct: 207 ELLQQRI 213


>gi|261401329|ref|ZP_05987454.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria lactamica
           ATCC 23970]
 gi|269208713|gb|EEZ75168.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria lactamica
           ATCC 23970]
 gi|309379659|emb|CBX21830.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 207

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 77/194 (39%), Positives = 104/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 9   FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHTRLAYVSKTPGRTQHINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL  R  L  + L++D RH 
Sbjct: 66  ----ELQN---GNFMVDLPGYGYAQVPEAVRSHWVNLLGDYLRYRKQLIGLVLIMDARHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT-AHPEVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y    +  V   S
Sbjct: 119 LKELDIRMLDFFHTTGRPVHILLSKSDKLSKNEQIKTLSQVKKLLKPYSERQNIGVQLFS 178

Query: 193 SVKRKGIEVLRKAI 206
           S+KR+GIE + + +
Sbjct: 179 SLKRQGIEEVGRTV 192


>gi|311031430|ref|ZP_07709520.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus sp. m3-13]
          Length = 194

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 88/146 (60%), Gaps = 9/146 (6%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
           PE A +GRSNVGKSS IN ++NRKNLARTS+ PG+TQ LNF++  +          +  V
Sbjct: 24  PEFALAGRSNVGKSSFINKMINRKNLARTSSKPGKTQTLNFYLINEM---------LHFV 74

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYG+A+ PK   D+WG ++  YL+ R  LR V  ++D RH   + D  ++ +L    
Sbjct: 75  DVPGYGFAKVPKSERDAWGRMMETYLTNREQLRAVLQIVDLRHPPSKDDVTMYEYLKHYE 134

Query: 150 VSYQIVLTKIDKLSPTTAQETLEKTK 175
           +   ++ TK DK+     Q+ L+  K
Sbjct: 135 LPVVVIATKADKIPKGKWQKHLKVIK 160


>gi|68074349|ref|XP_679089.1| GTP-binding protein [Plasmodium berghei strain ANKA]
 gi|56499746|emb|CAH95019.1| probable GTP-binding protein engb, putative [Plasmodium berghei]
          Length = 926

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 101/178 (56%), Gaps = 9/178 (5%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAM-AL 88
           PEIAF GRSN GKS+LIN L  R N A+ S  PG T+ ++F+        K   P +  L
Sbjct: 112 PEIAFIGRSNSGKSTLINELCGRTNKAKVSKMPGCTKQIHFY--------KIGKPCLLCL 163

Query: 89  VDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKK 148
           VD+PGYG+A + ++    W    + YL  R+ L+ V++LIDCR G+K  D+++F F D+ 
Sbjct: 164 VDLPGYGFAHSKEELRLQWNEFTLFYLKNRTNLKKVFVLIDCRIGLKTSDKELFHFFDRY 223

Query: 149 AVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAI 206
            + YQIVL+K D L+       ++     I ++      +I  SS+KR+ +  LR  I
Sbjct: 224 NIKYQIVLSKCDLLNTKDLAIKIQIMNEEILHFKNLEKNIISLSSLKRQNLNELRNEI 281


>gi|253751620|ref|YP_003024761.1| GTP-binding protein [Streptococcus suis SC84]
 gi|253753522|ref|YP_003026663.1| GTP-binding protein [Streptococcus suis P1/7]
 gi|253755653|ref|YP_003028793.1| GTP-binding protein [Streptococcus suis BM407]
 gi|251815909|emb|CAZ51523.1| putative GTP-binding protein [Streptococcus suis SC84]
 gi|251818117|emb|CAZ55911.1| putative GTP-binding protein [Streptococcus suis BM407]
 gi|251819768|emb|CAR45667.1| putative GTP-binding protein [Streptococcus suis P1/7]
 gi|319758058|gb|ADV70000.1| GTP-binding protein [Streptococcus suis JS14]
          Length = 195

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 103/207 (49%), Gaps = 16/207 (7%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           I T +A I L  V +    P    PEIA +GRSNVGKSS IN L+ RKNLARTS  PG+T
Sbjct: 3   INTHNAEILLSAVSK-AQYPGYDIPEIALAGRSNVGKSSFINTLLGRKNLARTSGKPGKT 61

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
           Q LNF+   D          +  VD+PGYGYA+  K     WG +I  YL+ R  LR V 
Sbjct: 62  QQLNFYNIDD---------KIRFVDVPGYGYAKVSKTERAKWGKMIEEYLTTRENLRVVV 112

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPT 183
            L+D RH     D  ++ FL    +   IV TK DK+        E++ K K        
Sbjct: 113 SLVDMRHEPSADDVQMYDFLKYYEIPVIIVATKADKIPRGKWNKHESMIKKKLDF----D 168

Query: 184 AHPEVIPTSSVKRKGIEVLRKAILETI 210
            + + +  SS  R G +    AIL  I
Sbjct: 169 KNDQFVIFSSETRHGYDQAWDAILSNI 195


>gi|27364347|ref|NP_759875.1| GTP-binding protein YsxC [Vibrio vulnificus CMCP6]
 gi|27360466|gb|AAO09402.1| GTP-binding protein EngB [Vibrio vulnificus CMCP6]
          Length = 220

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 106/190 (55%), Gaps = 10/190 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     EIAF+GRSN GKSS +N L N+KNLA+TS  PGRTQ +N F  
Sbjct: 16  FITSAPDIRHLPADEGIEIAFAGRSNAGKSSALNRLTNQKNLAKTSKTPGRTQLINLFKV 75

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +  +         +VD+PGYG+A+ P +  + W   +  YL +R  L+ + +L+D RH 
Sbjct: 76  TEGCH---------IVDLPGYGFAQVPLEMKNKWQKSLGEYLQKRECLKGLVVLMDIRHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +  +  +  Q++LTK DKL     +  L K + L   +     +V   SS
Sbjct: 127 MKDLDQQMIFWAIESRIPVQVLLTKADKLKSGARKAELLKVRKLAETF-GGDVQVDVYSS 185

Query: 194 VKRKGIEVLR 203
           +K  G++ LR
Sbjct: 186 LKGLGVDQLR 195


>gi|290990283|ref|XP_002677766.1| predicted protein [Naegleria gruberi]
 gi|284091375|gb|EFC45022.1| predicted protein [Naegleria gruberi]
          Length = 142

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 87/138 (63%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    P+IAF+GRSNVGKSSL+N +V+   LAR S+ PG T+ +N+F   D         
Sbjct: 14  PNEKMPQIAFAGRSNVGKSSLLNSIVDSDRLARVSSTPGHTKRINYFNMHDM-------- 65

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            + +VD+PGYGYA   K+ +  W  ++ +Y +E + LR V++L+D R+G+ + D +    
Sbjct: 66  -LYVVDLPGYGYAEGNKEKIKGWNTVLRQYCTENTVLRRVFILLDARYGIYEQDCEFMDM 124

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L++  V YQI+LTK DK+
Sbjct: 125 LEESGVPYQIILTKCDKV 142


>gi|253690586|ref|YP_003019776.1| GTP-binding protein HSR1-related [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259645903|sp|C6DJE1|ENGB_PECCP RecName: Full=Probable GTP-binding protein EngB
 gi|251757164|gb|ACT15240.1| GTP-binding protein HSR1-related [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 211

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 107/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  L      E+AF+GRSN GKSS +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 12  FIISAPDIRHLATDSGIEVAFAGRSNAGKSSALNTLTNQKNLARTSKTPGRTQLINLFEV 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + LVD+PGYGYA  P++    W   +  YL +R++L+ + +L+D RH 
Sbjct: 72  TD---------GVRLVDLPGYGYAEVPEQMKIKWQRALGEYLQKRNSLKGLVVLMDIRHP 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 123 LKDLDQQMIQWAVDVELPVLVLLTKADKLASGARKAQLNMVREAVLPF-MGDIQVEAFSS 181

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 182 LKKLGVDKLRQKL 194


>gi|197123177|ref|YP_002135128.1| ribosome biogenesis GTP-binding protein YsxC [Anaeromyxobacter sp.
           K]
 gi|220917966|ref|YP_002493270.1| GTP-binding protein HSR1-related [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|238689884|sp|B4UHX9|ENGB_ANASK RecName: Full=Probable GTP-binding protein EngB
 gi|254783182|sp|B8JEQ8|ENGB_ANAD2 RecName: Full=Probable GTP-binding protein EngB
 gi|196173026|gb|ACG73999.1| GTP-binding protein HSR1-related [Anaeromyxobacter sp. K]
 gi|219955820|gb|ACL66204.1| GTP-binding protein HSR1-related [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 216

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 92/176 (52%), Gaps = 3/176 (1%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIAF GRSNVGKSS++N L  RK LAR S+ PGRT+ L FF             
Sbjct: 21  PRGATPEIAFVGRSNVGKSSMLNALARRKGLARVSSTPGRTRALQFFDLSYRPTPAARPR 80

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+   D+PGYGYA+  +   D W  +I  YL +R  LR V L++D RH   + D+D  +F
Sbjct: 81  AIRFCDLPGYGYAKVARAERDRWTAMIEDYLRDRDVLRAVVLIVDARHPPSESDEDAAAF 140

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
           L        +  TK DKL        L++ +   R    A  + +P S+V+  G +
Sbjct: 141 LVSAGRRLVVAATKTDKLPKARRVLALQQVE---RALGLARGDAVPFSAVEGTGTD 193


>gi|260438106|ref|ZP_05791922.1| ribosome biogenesis GTP-binding protein YsxC [Butyrivibrio
           crossotus DSM 2876]
 gi|292809587|gb|EFF68792.1| ribosome biogenesis GTP-binding protein YsxC [Butyrivibrio
           crossotus DSM 2876]
          Length = 197

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 115/192 (59%), Gaps = 19/192 (9%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PE+AF+G+SNVGKSSLIN ++NRK+ A+TS+ PG+TQ +NF+      N+ N  
Sbjct: 18  LPENTLPEVAFAGKSNVGKSSLINAIMNRKSYAKTSSQPGKTQTINFY------NINN-- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
                VD+PGYGYA+   +    WG +I RYLS    L+ V+LLID RH   + D+ ++ 
Sbjct: 70  -VFYCVDLPGYGYAKTTLETRAKWGKMIERYLSTSKQLQRVFLLIDIRHAPSENDRLMYE 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGI-- 199
           ++  +     I+ TK+DK+  +  Q+ ++    ++R       E  ++P S+  ++G+  
Sbjct: 129 WIVSEGYEPVIIATKLDKIKRSQIQKQVK----ILREGLGMSKEGILVPFSAETKQGLEN 184

Query: 200 --EVLRKAILET 209
             E++  A+L+T
Sbjct: 185 IWEIIDNAVLKT 196


>gi|237807113|ref|YP_002891553.1| ribosome biogenesis GTP-binding protein YsxC [Tolumonas auensis DSM
           9187]
 gi|259645909|sp|C4L968|ENGB_TOLAT RecName: Full=Probable GTP-binding protein EngB
 gi|237499374|gb|ACQ91967.1| GTP-binding protein HSR1-related [Tolumonas auensis DSM 9187]
          Length = 212

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 88/151 (58%), Gaps = 9/151 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP  G  EIAF+GRSN GKSS +N L  ++ LARTS  PGRTQ +N F  
Sbjct: 13  FVTSAPDIRHLPNDGGIEIAFAGRSNAGKSSALNALTQQRQLARTSKTPGRTQLINLFEL 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA+ P +    W   +  YL +R +L+ + LL+D RH 
Sbjct: 73  E---------PGKRLVDLPGYGYAQVPIEMKLKWQAALSEYLQKRESLKALVLLMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSP 164
           +K +D  +  +     ++  ++LTK DKL+P
Sbjct: 124 LKDLDLQMLEWASNSDLNILVLLTKADKLNP 154


>gi|281203975|gb|EFA78171.1| Putative GTP-binding protein [Polysphondylium pallidum PN500]
          Length = 441

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 86/131 (65%), Gaps = 10/131 (7%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
           PE+AF GRSNVGKSS+IN +  R   A+TS+ PG TQ +N++       L + L    +V
Sbjct: 217 PEVAFIGRSNVGKSSIINAITQR-GQAKTSDKPGFTQSINWY------ELGSTL---YIV 266

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYG+A A  + VD W  L + YL+ R +L+ V+LL+D RHG+K+ D ++   LDK+ 
Sbjct: 267 DLPGYGFAFAKSQKVDQWNQLTLEYLTTRKSLKRVFLLLDARHGLKESDHEILEILDKEH 326

Query: 150 VSYQIVLTKID 160
           V  QIVLTK D
Sbjct: 327 VKTQIVLTKGD 337


>gi|294634244|ref|ZP_06712787.1| ribosome biogenesis GTP-binding protein YsxC [Edwardsiella tarda
           ATCC 23685]
 gi|291092331|gb|EFE24892.1| ribosome biogenesis GTP-binding protein YsxC [Edwardsiella tarda
           ATCC 23685]
          Length = 254

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 107/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 49  FVTSAPDIRHLPADIGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 108

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + LVD+PGYGYA  P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 109 DD---------GVRLVDLPGYGYAEVPEEMKRKWQRALGEYLQQRQCLKGLVVLMDIRHP 159

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ + ++  +  +   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 160 LKDLDQQMIAWAVEAGLPVLLLLTKADKLASGARKAQLNLVREAVLPF-MGDIQVEAFSS 218

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR  +
Sbjct: 219 LKKFGVDKLRDKL 231


>gi|220933280|ref|YP_002512179.1| cell division checkpoint GTPase YihA [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|254783218|sp|B8GTD2|ENGB_THISH RecName: Full=Probable GTP-binding protein EngB
 gi|219994590|gb|ACL71192.1| cell division checkpoint GTPase YihA [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 209

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 100/170 (58%), Gaps = 10/170 (5%)

Query: 31  EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVD 90
           E+AF+GRSN GKSS IN+L N++ LARTS  PGRTQ +NFF   +         +  LVD
Sbjct: 27  EVAFAGRSNAGKSSAINVLCNQRALARTSKTPGRTQLINFFALDE---------SRRLVD 77

Query: 91  MPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAV 150
           +PGYGYA+ P+    +W  L+  YL ER+ L+ + +++D RH +   D  +  +  ++ +
Sbjct: 78  LPGYGYAKVPEAMRKAWRKLMEHYLGERACLKGLVVVMDIRHPLTDHDWTMLGWARERGL 137

Query: 151 SYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
           +  ++LTK DK+    A +T  +    + +       V P S++KR+G+E
Sbjct: 138 AVHVLLTKADKIRRGPAMDTARQVARALGDAGI-EATVQPFSALKREGVE 186


>gi|119370483|sp|Q7MQ23|ENGB_VIBVY RecName: Full=Probable GTP-binding protein EngB
          Length = 216

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 110/196 (56%), Gaps = 11/196 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     EIAF+GRSN GKSS +N L N+KNLA+TS  PGRTQ +N F  
Sbjct: 12  FITSAPDIRHLPADEGIEIAFAGRSNAGKSSALNRLTNQKNLAKTSKTPGRTQLINLFKV 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +  +         +VD+PGYG+A+ P +  + W   +  YL +R  L+ + +L+D RH 
Sbjct: 72  TEGCH---------IVDLPGYGFAQVPLEMKNKWQKSLGEYLQKRECLKGLVVLMDIRHP 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +  +  +  Q++LTK DKL     +  L K + L   +     +V   SS
Sbjct: 123 MKDLDQQMIFWAIESRIPVQVLLTKADKLKSGARKAELLKVRKLAETF-GGDVQVDVYSS 181

Query: 194 VKRKGIEVLRKAILET 209
           +K  G++ LR A L+T
Sbjct: 182 LKGLGVDQLR-AKLDT 196


>gi|242241360|ref|YP_002989541.1| ribosome biogenesis GTP-binding protein YsxC [Dickeya dadantii
           Ech703]
 gi|242133417|gb|ACS87719.1| GTP-binding protein HSR1-related [Dickeya dadantii Ech703]
          Length = 220

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 107/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 22  FVTSAPDIRHLPADSGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 81

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +          + LVD+PGYGYA  P++    W   +  YL +R+ L+ + +L+D RH 
Sbjct: 82  TE---------GIRLVDLPGYGYAEVPEEMKRKWQKALGEYLQKRNCLKGLVILMDIRHP 132

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 133 LKDLDQQMLEWSVDVGLPVLVLLTKADKLAQGARKAQLNMVREAVLPF-MGDIQVETFSS 191

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 192 LKKTGVDKLRQKL 204


>gi|238764291|ref|ZP_04625242.1| GTP-binding protein engB [Yersinia kristensenii ATCC 33638]
 gi|238697442|gb|EEP90208.1| GTP-binding protein engB [Yersinia kristensenii ATCC 33638]
          Length = 204

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 4   FVISAPDIRHLPRDEGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 63

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + LVD+PGYGYA  P++    W   +  YL +R+ L+ + +L+D RH 
Sbjct: 64  VD---------GIRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHP 114

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ + ++         ++LTK DKL+    +  L   +  I  +     +V   SS
Sbjct: 115 LKDLDQQMITWAVAVGTPVMLLLTKADKLASGARKAQLNMVREAIIPF-MGDIQVEAFSS 173

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 174 LKKIGVDKLREKL 186


>gi|323484457|ref|ZP_08089823.1| hypothetical protein HMPREF9474_01574 [Clostridium symbiosum
           WAL-14163]
 gi|323692473|ref|ZP_08106707.1| GTP-binding protein [Clostridium symbiosum WAL-14673]
 gi|323402235|gb|EGA94567.1| hypothetical protein HMPREF9474_01574 [Clostridium symbiosum
           WAL-14163]
 gi|323503470|gb|EGB19298.1| GTP-binding protein [Clostridium symbiosum WAL-14673]
          Length = 195

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 90/149 (60%), Gaps = 9/149 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           +P+   PE AF+G+SNVGKSSLIN L+NRK+ AR S  PG+TQ +NF+   D        
Sbjct: 18  MPENTQPEFAFAGKSNVGKSSLINSLMNRKSYARISAQPGKTQTINFYHIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
            A+  VD+PGYGYARA  +    WG +I  YL +   LRCV+LLID RH     D+ ++ 
Sbjct: 70  -ALYYVDLPGYGYARANVEVKAKWGKMIEDYLHQSKMLRCVFLLIDIRHEPSSNDKLMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLE 172
           ++  +     I+ TK DK+  +  Q+ ++
Sbjct: 129 WIVSQGYQPVIIATKADKIKRSQLQKQMK 157


>gi|269959442|ref|ZP_06173825.1| GTP-binding protein [Vibrio harveyi 1DA3]
 gi|269835879|gb|EEZ89955.1| GTP-binding protein [Vibrio harveyi 1DA3]
          Length = 223

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 111/196 (56%), Gaps = 11/196 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    EIAF+GRSN GKSS +N L N+K+LA+TS  PGRTQ +N F  
Sbjct: 16  FITSAPDIRHLPEDEGVEIAFAGRSNAGKSSALNRLTNQKSLAKTSKTPGRTQLINLFKV 75

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           ++            +VD+PGYG+A+ P +  + W   +  YL +R  L+ + +L+D RH 
Sbjct: 76  EE---------GCHIVDLPGYGFAQVPIEMKNKWQKSLGEYLQKRECLKGLVVLMDIRHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +  Q++LTK DKL     ++TL K +  +  +      V   SS
Sbjct: 127 MKDLDQQMIFWAIDSRIPVQVLLTKADKLKSGARKQTLLKIRKQVETF-GGDVSVDVFSS 185

Query: 194 VKRKGIEVLRKAILET 209
           +K  G++ LR A L+T
Sbjct: 186 LKGLGVDQLR-AKLDT 200


>gi|156972896|ref|YP_001443803.1| GTPase EngB [Vibrio harveyi ATCC BAA-1116]
 gi|156524490|gb|ABU69576.1| hypothetical protein VIBHAR_00574 [Vibrio harveyi ATCC BAA-1116]
          Length = 223

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 111/196 (56%), Gaps = 11/196 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    EIAF+GRSN GKSS +N L N+K+LA+TS  PGRTQ +N F  
Sbjct: 16  FITSAPDIRHLPEDEGVEIAFAGRSNAGKSSALNRLTNQKSLAKTSKTPGRTQLINLFKV 75

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           ++            +VD+PGYG+A+ P +  + W   +  YL +R  L+ + +L+D RH 
Sbjct: 76  EE---------GCHIVDLPGYGFAQVPVEMKNKWQKSLGEYLQKRECLKGLVVLMDIRHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +  Q++LTK DKL     ++TL K +  +  +      V   SS
Sbjct: 127 MKDLDQQMIFWAIDSRIPVQVLLTKADKLKSGARKQTLLKIRKQVETF-GGDVSVDVFSS 185

Query: 194 VKRKGIEVLRKAILET 209
           +K  G++ LR A L+T
Sbjct: 186 LKGLGVDQLR-AKLDT 200


>gi|148543886|ref|YP_001271256.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus reuteri
           DSM 20016]
 gi|184153286|ref|YP_001841627.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus reuteri
           JCM 1112]
 gi|227364794|ref|ZP_03848842.1| GTPase [Lactobacillus reuteri MM2-3]
 gi|227544994|ref|ZP_03975043.1| GTPase [Lactobacillus reuteri CF48-3A]
 gi|300909971|ref|ZP_07127431.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus reuteri
           SD2112]
 gi|325682581|ref|ZP_08162098.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus reuteri
           MM4-1A]
 gi|166920113|sp|A5VJ95|ENGB_LACRD RecName: Full=Probable GTP-binding protein EngB
 gi|229807536|sp|B2G6R5|ENGB_LACRJ RecName: Full=Probable GTP-binding protein EngB
 gi|148530920|gb|ABQ82919.1| small GTP-binding protein [Lactobacillus reuteri DSM 20016]
 gi|183224630|dbj|BAG25147.1| GTP-binding protein [Lactobacillus reuteri JCM 1112]
 gi|227070138|gb|EEI08513.1| GTPase [Lactobacillus reuteri MM2-3]
 gi|227185011|gb|EEI65082.1| GTPase [Lactobacillus reuteri CF48-3A]
 gi|300892619|gb|EFK85979.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus reuteri
           SD2112]
 gi|324978420|gb|EGC15370.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus reuteri
           MM4-1A]
          Length = 196

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 108/184 (58%), Gaps = 11/184 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PEIA  GRSNVGKSSL N+L+NR+N A TS+ PG+TQ LNF+  +D         
Sbjct: 19  PKTNIPEIALVGRSNVGKSSLTNVLINRRNFAHTSSQPGKTQTLNFYDVED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  KK  + +G +I +YL++R  LR V  L+D RH     D +++++
Sbjct: 70  KVYFVDVPGYGYAKVSKKERERFGKMIEQYLTQREQLRGVIQLVDARHEPTPDDVNMYNW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TKIDK+  +     L   K  + +  ++ P +I  S+ ++KG + + +
Sbjct: 130 LQYYNIPTLIVGTKIDKVKRSAWNRQLSLIKKTL-DVESSTP-IILFSATEKKGKDDVWQ 187

Query: 205 AILE 208
            I E
Sbjct: 188 WIEE 191


>gi|251791717|ref|YP_003006438.1| ribosome biogenesis GTP-binding protein YsxC [Dickeya zeae Ech1591]
 gi|247540338|gb|ACT08959.1| GTP-binding protein HSR1-related [Dickeya zeae Ech1591]
          Length = 214

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 106/193 (54%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LAR S  PGRTQ +N F  
Sbjct: 12  FVTSAPDIRHLPADSGIEVAFAGRSNAGKSSALNTLTNQKSLARISKTPGRTQLINLFEV 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + LVD+PGYGYA  P++    W   +  YL +R+ L+ + +L+D RH 
Sbjct: 72  TD---------GVRLVDLPGYGYAEVPEEMKRKWQRALGEYLQKRNCLKGLVVLMDIRHP 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 123 LKDLDQQMLEWAVDVGLPVLVLLTKADKLAQGARKSQLNMVREAVLPF-MGDIQVETFSS 181

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 182 LKKTGVDKLRQKL 194


>gi|291280219|ref|YP_003497054.1| GTP-binding protein [Deferribacter desulfuricans SSM1]
 gi|290754921|dbj|BAI81298.1| GTP-binding protein [Deferribacter desulfuricans SSM1]
          Length = 191

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 102/184 (55%), Gaps = 12/184 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PEIAF GRSNVGKSS+IN LVNRK L + S  PG+T+ +NFF      N+ + L 
Sbjct: 16  PDTDLPEIAFVGRSNVGKSSMINTLVNRKKLVKVSQKPGKTRTINFF------NINDEL- 68

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  KK+ + W  +I  YL++RS L+ V L+ID R G    D+ ++ +
Sbjct: 69  --IFVDLPGYGYAKVSKKDRELWKVMIETYLTKRSQLKAVVLIIDIRVGPTNDDKLMYEW 126

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
                V   +  TK DKLS    Q+ L   K   + +     + +  SSV R+G + L  
Sbjct: 127 FMAYNVPTIVAFTKCDKLSNNKIQKQLAIIK---KEFGDGLGDYVLFSSVTRRGKDELWG 183

Query: 205 AILE 208
            I E
Sbjct: 184 IIKE 187


>gi|153833801|ref|ZP_01986468.1| GTP-binding protein [Vibrio harveyi HY01]
 gi|148869859|gb|EDL68827.1| GTP-binding protein [Vibrio harveyi HY01]
          Length = 219

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 111/196 (56%), Gaps = 11/196 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    EIAF+GRSN GKSS +N L N+K+LA+TS  PGRTQ +N F  
Sbjct: 12  FITSAPDIRHLPEDEGVEIAFAGRSNAGKSSALNRLTNQKSLAKTSKTPGRTQLINLFKV 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           ++            +VD+PGYG+A+ P +  + W   +  YL +R  L+ + +L+D RH 
Sbjct: 72  EE---------GCHIVDLPGYGFAQVPVEMKNKWQKSLGEYLQKRECLKGLVVLMDIRHP 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +  Q++LTK DKL     ++TL K +  +  +      V   SS
Sbjct: 123 MKDLDQQMIFWAIDSRIPVQVLLTKADKLKSGARKQTLLKIRKQVETF-GGDVSVDVFSS 181

Query: 194 VKRKGIEVLRKAILET 209
           +K  G++ LR A L+T
Sbjct: 182 LKGLGVDQLR-AKLDT 196


>gi|251782260|ref|YP_002996562.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           dysgalactiae subsp. equisimilis GGS_124]
 gi|242390889|dbj|BAH81348.1| GTP-binding protein [Streptococcus dysgalactiae subsp. equisimilis
           GGS_124]
          Length = 199

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 99/186 (53%), Gaps = 11/186 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++ RKNLARTS+ PG+TQ LNFF      N+ + L 
Sbjct: 25  PQDDLPEIALAGRSNVGKSSFINTMLGRKNLARTSSKPGKTQLLNFF------NIDDKL- 77

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K     WG +I  YL+ R  LR V  L+D RH   + D  ++ F
Sbjct: 78  --RFVDVPGYGYAKVSKSERAKWGKMIEEYLTSRDNLRAVVSLVDLRHEPSKEDVQMYEF 135

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TK DK+ P       E        +      +I  SSV R GI+    
Sbjct: 136 LKYYDIPVIIVATKADKI-PRGKWNKHESMVKKTLGFDKTDCFII-FSSVDRVGIDEAWD 193

Query: 205 AILETI 210
            ILE +
Sbjct: 194 TILEHL 199


>gi|171462910|ref|YP_001797023.1| GTP-binding protein HSR1-related [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|238692837|sp|B1XST2|ENGB_POLNS RecName: Full=Probable GTP-binding protein EngB
 gi|171192448|gb|ACB43409.1| GTP-binding protein HSR1-related [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 221

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 74/196 (37%), Positives = 105/196 (53%), Gaps = 14/196 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V +   LP     E+AF+GRSN GKSS IN+L N+K LA  S  PGRTQH+N+F  
Sbjct: 9   FATTVNDTHYLPATPLREVAFAGRSNAGKSSAINVLCNQKRLAFASKTPGRTQHINYFGL 68

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
             F+  K++L A  LVD+PGYGYA    +    W  L+  YL ER  L  V L++D R G
Sbjct: 69  --FA--KDDLLAY-LVDLPGYGYAAVNHETKYHWNTLLSDYLQEREQLVGVVLIVDSRRG 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE------ 187
           +  +D+ +  +         ++L+K DKL+ +  + TLE  +  ++ Y  A P+      
Sbjct: 124 ITDLDEQMIEWFVPTGKPTHVLLSKCDKLNKSECKHTLEAVRKQLQQYDPALPDGNGESK 183

Query: 188 ---VIPTSSVKRKGIE 200
                  SS KR G+E
Sbjct: 184 QLTAQLFSSTKRIGLE 199


>gi|326335701|ref|ZP_08201887.1| ribosome biogenesis GTP-binding protein YsxC [Capnocytophaga sp.
           oral taxon 338 str. F0234]
 gi|325692130|gb|EGD34083.1| ribosome biogenesis GTP-binding protein YsxC [Capnocytophaga sp.
           oral taxon 338 str. F0234]
          Length = 200

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 109/200 (54%), Gaps = 14/200 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLN-FFV 72
           F+    +I   P  G  E AF GRSNVGKSSLIN+L N K LA+TS+ PG+TQ +N F +
Sbjct: 8   FVMSNTQIAKCPAHGLAEYAFIGRSNVGKSSLINMLTNHKGLAKTSSKPGKTQLINHFLI 67

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
            K++           LVD+PGYGYA+  K++   +   I  Y  +R  L C ++L+D RH
Sbjct: 68  NKNW----------YLVDLPGYGYAQVSKQSKRVFQQFITDYFKKRKELVCAFVLVDIRH 117

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
             ++ID +   +L +  + + I+ TK DKL+    +E +   + ++       P    +S
Sbjct: 118 KPQKIDLEFMQWLGENTIPFAIIFTKADKLTDKLIEEHITAYQGILLEQWEEMPPYFISS 177

Query: 193 SVKRKG-IEVLRKAILETIN 211
           SV + G  E+L    +E IN
Sbjct: 178 SVNKLGRTEILN--YIEDIN 195


>gi|304388325|ref|ZP_07370439.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria
           meningitidis ATCC 13091]
 gi|304337687|gb|EFM03842.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria
           meningitidis ATCC 13091]
          Length = 211

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 103/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 11  FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHTRLAYVSKTPGRTQHINFF-- 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL +R  L  + L++D RH 
Sbjct: 68  ----ELQN---GNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLQQRKQLIGLVLIMDARHP 120

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP-EVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y       V   S
Sbjct: 121 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFS 180

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GI+   + +
Sbjct: 181 SLKKQGIDEANRTV 194


>gi|95931072|ref|ZP_01313799.1| GTP-binding [Desulfuromonas acetoxidans DSM 684]
 gi|95132881|gb|EAT14553.1| GTP-binding [Desulfuromonas acetoxidans DSM 684]
          Length = 202

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 91/150 (60%), Gaps = 9/150 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++     G  P A  PEIAF+GRSNVGKSSL+N++V RK+L RTS+ PGRTQ +NFF  
Sbjct: 8   FVKSATRPGNYPPAERPEIAFAGRSNVGKSSLLNVMVQRKSLVRTSSTPGRTQLINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D +        + LVD+PGYG+A+ P      WG +I  YL  R +L  V +L D R  
Sbjct: 66  -DLNE------EIYLVDLPGYGFAKVPMAVKKQWGPMIQTYLQSRQSLCAVVVLFDIRRV 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
            ++ D  +  +L++  V    V+TK+DK+S
Sbjct: 119 PREEDLQLLDWLEEYEVPTIPVITKVDKVS 148


>gi|282850554|ref|ZP_06259933.1| ribosome biogenesis GTP-binding protein YsxC [Veillonella parvula
           ATCC 17745]
 gi|282580047|gb|EFB85451.1| ribosome biogenesis GTP-binding protein YsxC [Veillonella parvula
           ATCC 17745]
          Length = 232

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 80/187 (42%), Positives = 105/187 (56%), Gaps = 11/187 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF---VPKDFSNLKN 81
           P+    EIAF GRSNVGKSSLIN L N + LA  S  PG+T+ +N+F     +D S  + 
Sbjct: 43  PEGDTVEIAFLGRSNVGKSSLINSLCNYRGLALVSGQPGKTKTINYFDIESKEDISETEE 102

Query: 82  NLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYL--SERSTLRCVYLLIDCRHGVKQIDQ 139
                 LVD+PGYG+A+  K N + W   I  Y+  SER  L C  LLID RH    ID+
Sbjct: 103 RRYNWFLVDLPGYGFAKTNKGNRNLWSSFIADYILHSERLMLLC--LLIDGRHPEMAIDK 160

Query: 140 DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGI 199
             F +L +  V  QIV+TK DKL+      +L   K L   YPTA   ++  SS+K  G 
Sbjct: 161 VAFDWLVEAGVPLQIVVTKADKLTAKEKSASLSIIKEL---YPTATSPIL-YSSLKHTGR 216

Query: 200 EVLRKAI 206
           E+L++ I
Sbjct: 217 ELLQQRI 223


>gi|238917374|ref|YP_002930891.1| GTP-binding protein [Eubacterium eligens ATCC 27750]
 gi|259645895|sp|C4Z1T3|ENGB_EUBE2 RecName: Full=Probable GTP-binding protein EngB
 gi|238872734|gb|ACR72444.1| GTP-binding protein [Eubacterium eligens ATCC 27750]
          Length = 211

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 107/185 (57%), Gaps = 15/185 (8%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PE+AF+G+SNVGKSSLIN L+NRK+ ARTS+ PG+TQ +NF+   D        
Sbjct: 18  LPETPFPEVAFAGKSNVGKSSLINALMNRKSYARTSSQPGKTQTINFYNIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
            +M LVD+PGYGYA         WG +I +YL + S L+ V+LLID RH     D+ ++ 
Sbjct: 70  -SMYLVDLPGYGYANVSPAVKAKWGKMIEKYLRKSSQLKQVFLLIDIRHDPSDNDRMMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEV 201
           ++        IV TK+DK+  S  + Q    +T   +R        +IP SS  ++G++ 
Sbjct: 129 WIVNNGYRPVIVATKLDKIKRSQISKQVKAVRTGLGLRQ----EDILIPFSSQTKQGLKE 184

Query: 202 LRKAI 206
           L + I
Sbjct: 185 LWQLI 189


>gi|194468441|ref|ZP_03074427.1| small GTP-binding protein [Lactobacillus reuteri 100-23]
 gi|194453294|gb|EDX42192.1| small GTP-binding protein [Lactobacillus reuteri 100-23]
          Length = 196

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 108/184 (58%), Gaps = 11/184 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PEIA  GRSNVGKSSL N+L+NR+N A TS+ PG+TQ LNF+  +D         
Sbjct: 19  PKTNIPEIALVGRSNVGKSSLTNVLINRRNFAHTSSQPGKTQTLNFYDVED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  KK  + +G +I +YL++R  LR V  L+D RH     D +++++
Sbjct: 70  KVYFVDVPGYGYAKVSKKERERFGKMIEQYLTQREQLRGVIQLVDARHEPTPDDVNMYNW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   IV TKIDK+  +     L   K  + +  ++ P +I  S+ ++KG + + +
Sbjct: 130 LQYYNIPTLIVGTKIDKVKRSAWNRQLSLIKKAL-DVESSTP-IILFSATEKKGKDDVWQ 187

Query: 205 AILE 208
            I E
Sbjct: 188 WIEE 191


>gi|145588273|ref|YP_001154870.1| GTP-binding protein, HSR1-related [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|189037184|sp|A4SUZ2|ENGB_POLSQ RecName: Full=Probable GTP-binding protein EngB
 gi|145046679|gb|ABP33306.1| cell division checkpoint GTPase YihA [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 221

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 105/196 (53%), Gaps = 14/196 (7%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V +   LP     E+AF+GRSN GKSS +N+L N+K LA  S  PGRTQH+N+F  
Sbjct: 9   FATTVNDTHCLPATPLREVAFAGRSNAGKSSALNVLCNQKRLAFASKTPGRTQHINYF-- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
             F+  K++L A  LVD+PGYGYA    +    W  L+  YL ER  L  + L++D R G
Sbjct: 67  GIFA--KDDLLAY-LVDLPGYGYAAVNHETKYHWNALLSDYLQEREQLVGMVLIVDARRG 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPT-- 191
           + ++D+ +  +         I+L+K DKL+ +  +  LE  +  ++ Y  A P+      
Sbjct: 124 ITELDEQMIQWFVPTGKPIHILLSKCDKLNKSECKHALEDVRKQLQQYDPALPDGTGESQ 183

Query: 192 -------SSVKRKGIE 200
                  SS KR G+E
Sbjct: 184 QLTAQLFSSTKRIGLE 199


>gi|255319822|ref|ZP_05361027.1| GTPase EngB [Acinetobacter radioresistens SK82]
 gi|262380354|ref|ZP_06073508.1| ribosome biogenesis GTP-binding protein YsxC [Acinetobacter
           radioresistens SH164]
 gi|255303141|gb|EET82353.1| GTPase EngB [Acinetobacter radioresistens SK82]
 gi|262297800|gb|EEY85715.1| ribosome biogenesis GTP-binding protein YsxC [Acinetobacter
           radioresistens SH164]
          Length = 278

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 108/199 (54%), Gaps = 9/199 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++ L  +    EIAF+GRSN GKSS IN L N+K LAR S  PGRTQ +NFF  
Sbjct: 47  FLMSAPKLSLCVEDTGYEIAFAGRSNAGKSSAINALTNQKQLARASKKPGRTQMINFF-- 104

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               +L N  P   LVD+PGYGYA  P+     W   +  YL  R +L+ + LL+D RH 
Sbjct: 105 ----SLGN--PDQRLVDLPGYGYAAVPETMKIVWQKELENYLIHRESLQGLVLLMDIRHP 158

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           ++  D  +  +   + +   I+LTK DKL+   A +TL + K  ++        +   SS
Sbjct: 159 LQHFDTMMLEWAHSRKLFVHILLTKADKLNRGPANKTLLEVKQELKKMKLNFS-IQLFSS 217

Query: 194 VKRKGIEVLRKAILETINY 212
           + ++G+E L   +   +N+
Sbjct: 218 LNKQGLEELASVMAGRLNF 236


>gi|261365666|ref|ZP_05978549.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria mucosa ATCC
           25996]
 gi|288565832|gb|EFC87392.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria mucosa ATCC
           25996]
          Length = 217

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 104/196 (53%), Gaps = 11/196 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 9   FFTTVNHLKDLPDT-PAEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            + SN         +VD+PGYGYA+ P+     W  L+  YL +R  L  + L++D RH 
Sbjct: 66  -ELSN------GSFMVDLPGYGYAQVPEAIRTHWVKLLGDYLQQRRQLIGLVLIMDARHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP-EVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL   K  ++ Y T     V   S
Sbjct: 119 LKELDLRMLDFFHITGRPVHILLSKADKLSKNEQIKTLGTVKKSLKPYMTRQRISVQLFS 178

Query: 193 SVKRKGIEVLRKAILE 208
           S+K++GIE + + + E
Sbjct: 179 SLKKQGIEEVNQVVGE 194


>gi|21674964|ref|NP_663029.1| GTPase EngB [Chlorobium tepidum TLS]
 gi|25452938|sp|Q8KAK5|ENGB_CHLTE RecName: Full=Probable GTP-binding protein EngB
 gi|21648196|gb|AAM73371.1| GTP-binding protein [Chlorobium tepidum TLS]
          Length = 192

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 89/152 (58%), Gaps = 12/152 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP  G PEI F GRSNVGKSSL+N L  RK LA+TS+ PG+T+ +N+F+  D        
Sbjct: 18  LPSDGRPEIVFVGRSNVGKSSLLNSLCARKGLAKTSSTPGKTRLINYFIIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             +  VD+PGYGYA+  +   +SWG L+  Y+ +R  +  V LL+D RH     D ++  
Sbjct: 70  -NLYFVDLPGYGYAKVGQGERESWGKLLTGYIQKRGEIALVVLLVDSRHPGMASDLEMME 128

Query: 144 FLDKKAVSYQIVLTKIDKL---SPTTAQETLE 172
           FLD     + IVLTK DKL     + A  T+E
Sbjct: 129 FLDYCGRPFGIVLTKWDKLKQAEKSKASRTIE 160


>gi|225389278|ref|ZP_03759002.1| hypothetical protein CLOSTASPAR_03024 [Clostridium asparagiforme
           DSM 15981]
 gi|225044657|gb|EEG54903.1| hypothetical protein CLOSTASPAR_03024 [Clostridium asparagiforme
           DSM 15981]
          Length = 206

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 112/193 (58%), Gaps = 19/193 (9%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PE AFSG+SNVGKSSLIN L+NRK  ARTS+ PG+TQ +NF+   D        
Sbjct: 18  LPENHLPEFAFSGKSNVGKSSLINALMNRKAYARTSSQPGKTQTINFYNIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
            A+  VD+PGYGYA+   +  + WG +I RYL +   L+ V+LL+D RH     D+ ++ 
Sbjct: 70  -ALYYVDLPGYGYAKVALEAKEKWGKMIERYLRQSPMLKMVFLLVDIRHEPSANDKSMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE--VIPTSSVKRKGIE- 200
           ++        I+ TK+DK++ +  Q+ ++    L+R       +  +IP S+  ++G E 
Sbjct: 129 WIVYNGYHPVIIATKLDKINRSQIQKQVK----LLRQGLGMDKDGILIPFSAETKQGREK 184

Query: 201 ---VLRKAILETI 210
              ++ + + ET+
Sbjct: 185 IWDLIERVMAETV 197


>gi|291520784|emb|CBK79077.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Coprococcus
           catus GD/7]
          Length = 204

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 107/190 (56%), Gaps = 21/190 (11%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+   PE+AFSG+SNVGKSSLIN L+NRK  AR S  PG+TQ +N++   D        
Sbjct: 18  LPENQHPEVAFSGKSNVGKSSLINGLMNRKAYARVSQQPGKTQTINYYNVND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + +VD+PGYG+A   +     WG +I  YL +   LR V+LL+D RH     D+ ++S
Sbjct: 70  -EIYIVDLPGYGFANVSQAVKAKWGKMIENYLRKSRQLRMVFLLVDIRHEPSANDKHMYS 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR---NYPTAHPEVIPTSSVKRKGIE 200
           ++ +      I+ TK+DK+  +  Q+ L+    LIR   N     P ++P S+V ++G  
Sbjct: 129 WIIENGFYPAIIATKLDKIKRSQVQKQLK----LIREGLNVAEGTP-IVPYSAVTKQG-- 181

Query: 201 VLRKAILETI 210
             R  I E I
Sbjct: 182 --RDEIWELI 189


>gi|301300955|ref|ZP_07207120.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           salivarius ACS-116-V-Col5a]
 gi|300851422|gb|EFK79141.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           salivarius ACS-116-V-Col5a]
          Length = 196

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 83/138 (60%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P A  PE+A +GRSNVGKSSLIN L+NR+N ARTS+ PG+TQ LNF+  +D         
Sbjct: 19  PDAKLPEVALAGRSNVGKSSLINTLINRRNYARTSSQPGKTQTLNFYNIEDL-------- 70

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  +K  + W  +I  Y S R  L+    L+D RH   ++D  +  F
Sbjct: 71  -LYFVDVPGYGYAKVSQKEREKWARMIETYFSTRQELKGAISLVDARHEPSELDCQMIEF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   +V TKIDK+
Sbjct: 130 LHYYNIPVLVVGTKIDKI 147


>gi|90961519|ref|YP_535435.1| GTP-binding protein [Lactobacillus salivarius UCC118]
 gi|119369208|sp|Q1WUI3|ENGB_LACS1 RecName: Full=Probable GTP-binding protein EngB
 gi|90820713|gb|ABD99352.1| GTP-binding protein [Lactobacillus salivarius UCC118]
 gi|300214356|gb|ADJ78772.1| Probable GTP-binding protein engB [Lactobacillus salivarius CECT
           5713]
          Length = 196

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 83/138 (60%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P A  PE+A +GRSNVGKSSLIN L+NR+N ARTS+ PG+TQ LNF+  +D         
Sbjct: 19  PDAKLPEVALAGRSNVGKSSLINTLINRRNYARTSSQPGKTQTLNFYNIEDL-------- 70

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  +K  + W  +I  Y S R  L+    L+D RH   ++D  +  F
Sbjct: 71  -LYFVDVPGYGYAKVSQKEREKWARMIETYFSTRQELKGAISLVDARHEPSELDCQMIEF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   +V TKIDK+
Sbjct: 130 LHYYNIPVLVVGTKIDKI 147


>gi|209521070|ref|ZP_03269801.1| GTP-binding protein HSR1-related [Burkholderia sp. H160]
 gi|209498489|gb|EDZ98613.1| GTP-binding protein HSR1-related [Burkholderia sp. H160]
          Length = 220

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 102/197 (51%), Gaps = 9/197 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP    PEIAF+GRSN GKS+ IN+L N+K LA  S  PGRTQH+N+   
Sbjct: 10  FFTTVNHLRDLPANAQPEIAFAGRSNAGKSTAINVLCNQKRLAFASKTPGRTQHINY--- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
             FS  K + P   LVD+PGYGYA  P      W  L+  YL  RS LR + L++D R  
Sbjct: 67  --FSVGKADEPTAYLVDLPGYGYAEVPGAAKAHWEALLSTYLQSRSQLRGMILMMDSRRP 124

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA--HPEVIPT 191
           + ++D+ +  +          +LTK DKL+   +   L   +  +  Y  A    E+   
Sbjct: 125 LTELDRRMIEWFAPTGKPIHTLLTKCDKLTRQESTNALRTAQKGLAEYRAAGYRGELTAQ 184

Query: 192 --SSVKRKGIEVLRKAI 206
             S++KR G++   + I
Sbjct: 185 LFSALKRTGLDEAHELI 201


>gi|42573726|ref|NP_974959.1| GTP binding [Arabidopsis thaliana]
 gi|222423373|dbj|BAH19659.1| AT5G58370 [Arabidopsis thaliana]
 gi|332009661|gb|AED97044.1| putative GTP-binding protein CGPA [Arabidopsis thaliana]
          Length = 465

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 108/190 (56%), Gaps = 11/190 (5%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
            P    PEIAF+GRSNVGKSSL+N L  +  + RTS+ PG TQ +NFF            
Sbjct: 283 FPPPDVPEIAFAGRSNVGKSSLLNALTRQWGVVRTSDKPGLTQTINFF---------GLG 333

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P + LVD+PGYG+A A  +  ++W  L+  Y+S R++L+ V LL+D + G+K  DQ++ +
Sbjct: 334 PKVRLVDLPGYGFAFAKDEVKEAWEDLVKEYVSTRTSLKRVCLLVDTKWGMKPRDQELIN 393

Query: 144 FLDKKAVSYQIVLTKIDKLSP-TTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
            +++    YQIVLTK D + P   A+  ++  + L  N     P ++  SS    GI  L
Sbjct: 394 LMERSNTKYQIVLTKTDVVFPIDVARRAMQIEEKLKANRSIVQP-LMMVSSRSGAGIGSL 452

Query: 203 RKAILETINY 212
           R A+ +   +
Sbjct: 453 RTALAKIARF 462


>gi|312865357|ref|ZP_07725585.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus downei
           F0415]
 gi|311099468|gb|EFQ57684.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus downei
           F0415]
          Length = 199

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 100/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A +GRSNVGKSS IN L+NRK LARTS+ PG+TQ LNF+   D         
Sbjct: 25  PQDDLPEVALAGRSNVGKSSFINTLLNRKKLARTSSKPGKTQLLNFYNIDD--------- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG +I  YL  R  LR V  L+D RH     D  ++ F
Sbjct: 76  KLRFVDVPGYGYAKVSKTERAKWGKMIEEYLVTRDNLRVVVSLVDLRHEPTADDVQMYDF 135

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   IV TK DK+       QE+L K K    N+      ++ +S  K +G ++ 
Sbjct: 136 LKYYGIPVIIVATKADKVPRGKWNKQESLIKKKL---NFDKQDSFIVFSSETK-EGYDLA 191

Query: 203 RKAILETI 210
              ILE +
Sbjct: 192 WDTILEKL 199


>gi|325133582|gb|EGC56243.1| GTP-binding protein [Neisseria meningitidis M13399]
          Length = 209

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 103/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 9   FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL +R  L  + L++D RH 
Sbjct: 66  ----ELQN---GNFMVDLPGYGYAQVPEAVRAHWFNLLGDYLQQRKQLIGLVLIMDARHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP-EVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y       V   S
Sbjct: 119 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFS 178

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GI+   + +
Sbjct: 179 SLKKQGIDEANRTV 192


>gi|218261711|ref|ZP_03476446.1| hypothetical protein PRABACTJOHN_02114 [Parabacteroides johnsonii
           DSM 18315]
 gi|218223845|gb|EEC96495.1| hypothetical protein PRABACTJOHN_02114 [Parabacteroides johnsonii
           DSM 18315]
          Length = 198

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 69/187 (36%), Positives = 105/187 (56%), Gaps = 13/187 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PE AF GRSNVGKSSLIN+L  +K LA TS  PG+T  +N F+            
Sbjct: 19  PAGNLPEYAFIGRSNVGKSSLINMLTGKKGLAMTSQKPGKTMLINHFLING--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYG+A+  K+  ++   +I  Y+ ER  L  +++LIDCRH  ++ID +   +
Sbjct: 70  QWYLVDLPGYGFAQRGKEGRENIQRIIEDYILEREQLTNLFVLIDCRHEPQKIDLEFMEW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L +  + + ++ TKIDK+S    QE L+  +  +       P ++ +SS K++G    R 
Sbjct: 130 LGENGIPFSLIFTKIDKISKGRLQENLKAYQTKLLESWEELPPILLSSSEKKEG----RD 185

Query: 205 AILETIN 211
            IL+ I+
Sbjct: 186 EILDYID 192


>gi|119475280|ref|ZP_01615633.1| GTP-binding protein XF1430 [marine gamma proteobacterium HTCC2143]
 gi|119451483|gb|EAW32716.1| GTP-binding protein XF1430 [marine gamma proteobacterium HTCC2143]
          Length = 202

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 102/182 (56%), Gaps = 11/182 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P     E+AF+GRSN GKSS IN L + K +ARTS  PGRTQ LNFF   D    +    
Sbjct: 24  PSDDGCEVAFAGRSNAGKSSAINTLTDNKRMARTSKTPGRTQLLNFF---DVGERQR--- 77

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYG+A+ P    + W   +  YL ER +L  + LL+DCRH +++ D+ + ++
Sbjct: 78  ---LVDLPGYGFAKVPLAVKEKWQRHLGEYLRERESLAGLVLLMDCRHPLQEFDRMMLAW 134

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
            +   +   I+LTK DKL    A   L K +  ++       ++   S++KR G++ LR+
Sbjct: 135 AEGCEMPVHILLTKADKLKKGPANSVLLKVREELKQQELVSIQLF--SALKRTGLDQLRE 192

Query: 205 AI 206
            +
Sbjct: 193 KL 194


>gi|305664545|ref|YP_003860832.1| putative GTP-binding protein [Maribacter sp. HTCC2170]
 gi|88708562|gb|EAR00798.1| putative GTP-binding protein [Maribacter sp. HTCC2170]
          Length = 203

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 105/199 (52%), Gaps = 11/199 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    ++   P    PE AF GRSNVGKSSLIN+L  RK+LA+TS  PG+TQ +N F  
Sbjct: 8   FVMSNSDVAKCPNEPLPEYAFIGRSNVGKSSLINMLTERKSLAKTSGRPGKTQLINHF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                +  N     LVD+PGYGYAR  KK+  ++   I  Y  +R  L   ++L+D RH 
Sbjct: 66  ----KINGNW---FLVDLPGYGYARVSKKDKRTFQKYITDYFIKRKQLVSAFVLVDIRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEK-TKYLIRNYPTAHPEVIPTS 192
            +++D +   +L +  + + I+ TK DKL P   +  +    K L+       P    TS
Sbjct: 119 PQKVDMEFMEYLGENMIPFSIIFTKADKLKPKQMEANVNSYVKELLNGVWEEAPNYFVTS 178

Query: 193 SVKRKGIEVLRKAILETIN 211
           S K  G + L   I E+IN
Sbjct: 179 SSKNMGRDELLHYI-ESIN 196


>gi|171778306|ref|ZP_02919512.1| hypothetical protein STRINF_00354 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171283006|gb|EDT48430.1| hypothetical protein STRINF_00354 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 203

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 102/188 (54%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A +GRSNVGKSS IN L+ RKNLARTS+ PG+TQ LNF+      N+ + L 
Sbjct: 29  PQDDLPEVALAGRSNVGKSSFINTLLGRKNLARTSSKPGKTQLLNFY------NIDDKL- 81

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K     WG +I  YL  R  LR V  L+D RH     D  ++ F
Sbjct: 82  --RFVDVPGYGYAKVSKAERAKWGKMIEEYLVSRDNLRAVVSLVDFRHDPSADDIQMYEF 139

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K    N+  +   V+  SSV R G++  
Sbjct: 140 LKYYEIPVIVVATKADKIPHGKWNKHESAIKKKL---NFDKSDKFVV-FSSVDRTGLDEA 195

Query: 203 RKAILETI 210
             +ILE +
Sbjct: 196 WDSILEEL 203


>gi|56964398|ref|YP_176129.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus clausii
           KSM-K16]
 gi|81822069|sp|Q5WEP2|ENGB_BACSK RecName: Full=Probable GTP-binding protein EngB
 gi|56910641|dbj|BAD65168.1| GTP-binding protein [Bacillus clausii KSM-K16]
          Length = 197

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 87/147 (59%), Gaps = 9/147 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PE+A +GRSNVGKSS IN ++NRK LARTS  PG+TQ LNF+   +         
Sbjct: 19  PKNQLPELALAGRSNVGKSSFINKMLNRKGLARTSGQPGKTQTLNFYEINE--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K    +WG +I  YLSER  L+ V  L+D RH   + DQ ++++
Sbjct: 70  RLYFVDVPGYGYAKVSKTERAAWGKMIETYLSEREELKAVLQLVDIRHRPSEDDQLMYNW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETL 171
           +    +   +V TK DK+     Q+ L
Sbjct: 130 MKHYGIPVILVATKADKIPKGKWQKQL 156


>gi|238897343|ref|YP_002923020.1| putative GTP-binding protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|259645900|sp|C4K8N5|ENGB_HAMD5 RecName: Full=Probable GTP-binding protein EngB
 gi|229465098|gb|ACQ66872.1| putative GTP-binding protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 205

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 106/193 (54%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P I  LP     E+AF+GRSN GKSS +N L  +KNLA+ S  PGRTQ +N F  
Sbjct: 13  FVMSAPNIHHLPPDQGMEVAFAGRSNAGKSSALNTLTQQKNLAKISKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +          + LVD+PGYGYA  P      W   +  YL++R  LR + +L+D RH 
Sbjct: 73  AE---------GIRLVDLPGYGYAAVPLAIKIKWQKALNEYLNKRDCLRGLVILMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +   K +   ++LTK+DKLS + ++  L+  K  I  +     EV   SS
Sbjct: 124 LKNLDQQMIVWAINKRIPVYLLLTKVDKLSRSASKIQLDMVKEAILPF-MGDIEVDVFSS 182

Query: 194 VKRKGIEVLRKAI 206
           +K+ GI+ L+  +
Sbjct: 183 LKKIGIDKLQNKL 195


>gi|227113277|ref|ZP_03826933.1| GTPase EngB [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
 gi|227327117|ref|ZP_03831141.1| GTPase EngB [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 203

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 107/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  L      E+AF+GRSN GKSS +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 4   FIISAPDIRHLATDSGIEVAFAGRSNAGKSSALNTLTNQKNLARTSKTPGRTQLINLFQV 63

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + LVD+PGYGYA  P++    W   +  YL +R++L+ + +L+D RH 
Sbjct: 64  VD---------GVRLVDLPGYGYAEVPEQMKIKWQRALGEYLQKRNSLKGLVVLMDIRHP 114

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKL+    +  L   +  +  +     +V   SS
Sbjct: 115 LKDLDQQMIQWAVDVQLPVLVLLTKADKLASGARKTQLNMVREAVLPF-MGDIQVEAFSS 173

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 174 LKKLGVDKLRQKL 186


>gi|227890606|ref|ZP_04008411.1| GTPase [Lactobacillus salivarius ATCC 11741]
 gi|227867544|gb|EEJ74965.1| GTPase [Lactobacillus salivarius ATCC 11741]
          Length = 196

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 83/138 (60%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P A  PE+A +GRSNVGKSSLIN L+NR+N ARTS+ PG+TQ LNF+  +D         
Sbjct: 19  PDAKLPEVALAGRSNVGKSSLINTLINRRNYARTSSQPGKTQTLNFYNIEDL-------- 70

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  +K  + W  +I  Y S R  L+    L+D RH   ++D  +  F
Sbjct: 71  -LYFVDVPGYGYAKVSQKEREKWARMIETYFSTRQELKGAISLVDARHEPSELDCQMIEF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   +V TKIDK+
Sbjct: 130 LHYYNIPVLVVGTKIDKI 147


>gi|257065891|ref|YP_003152147.1| ribosome biogenesis GTP-binding protein YsxC [Anaerococcus prevotii
           DSM 20548]
 gi|256797771|gb|ACV28426.1| GTP-binding protein HSR1-related [Anaerococcus prevotii DSM 20548]
          Length = 195

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 104/189 (55%), Gaps = 13/189 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+AF GRSNVGKSS IN  + RK LA+TS+ PG+T+ +NF+   D         
Sbjct: 19  PREDLPELAFVGRSNVGKSSFINSFLCRKKLAKTSSVPGKTRTINFYRIND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  KK    W  LI  YL +R  LR V+LL+D RH    +D+ ++ +
Sbjct: 70  KFRLVDLPGYGYAKVSKKEKAKWDKLINEYLHQREALREVFLLVDIRHEPTALDKQMYDW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVI-PTSSVKRKGIEVLR 203
           + +   +  ++ TK DK+  +  Q+ +   K +++        +I   SS  +   +VL 
Sbjct: 130 IRETGFTGFVIATKFDKIKKSQTQKHI---KQIMKKLEIDDEGLIFAYSSETKHNKDVLE 186

Query: 204 KAILETINY 212
           + +   INY
Sbjct: 187 EQVDVIINY 195


>gi|154482726|ref|ZP_02025174.1| hypothetical protein EUBVEN_00403 [Eubacterium ventriosum ATCC
           27560]
 gi|149736321|gb|EDM52207.1| hypothetical protein EUBVEN_00403 [Eubacterium ventriosum ATCC
           27560]
          Length = 195

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 105/187 (56%), Gaps = 11/187 (5%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP     EIAF+G+SNVGKSSLIN LVNRK LARTS+ PG+TQ +NF+         N  
Sbjct: 18  LPDNQLCEIAFAGKSNVGKSSLINGLVNRKALARTSSQPGKTQTINFY---------NVN 68

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             +  VD+PGYGYA    K  + WG +I RYL E   L+ V+LLID RH     D +++ 
Sbjct: 69  KELYFVDLPGYGYANVSLKVKEQWGKMIERYLHESQVLKAVFLLIDIRHEPSANDVNMYQ 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           ++        I+ TK DK+  +  Q+ ++  K  +   P    +V+  S++ ++G + + 
Sbjct: 129 WILANGYEPIIIATKADKIKRSQLQKHIKMIKTELNVVPGT--KVLTFSALTKQGKDEIL 186

Query: 204 KAILETI 210
             I E +
Sbjct: 187 DLIEEIV 193


>gi|89891777|ref|ZP_01203279.1| GTP-binding cell division protein EngB [Flavobacteria bacterium
           BBFL7]
 gi|89515932|gb|EAS18597.1| GTP-binding cell division protein EngB [Flavobacteria bacterium
           BBFL7]
          Length = 200

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 97/185 (52%), Gaps = 10/185 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P +   E AF GRSNVGKSSLIN+L N+K+LA+TS  PG+TQ +N F+            
Sbjct: 19  PDSKLAEYAFIGRSNVGKSSLINMLTNKKSLAKTSGRPGKTQLINHFLINK--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           +  LVD+PGYGYAR  K +   +   I  Y  +R  L C ++L+D RH  + ID +   +
Sbjct: 70  SWHLVDLPGYGYARVSKSSKAKFQKFITNYFQQRRQLVCAFVLVDVRHEPQPIDTEFMEW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLE-KTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           L +  + + IV TK DKL P   +  +E   K L+       P    TSS    G E L 
Sbjct: 130 LGENGIPFGIVFTKADKLKPNALERNVEVYKKQLLDGVWEEVPPYFITSSSNGTGQEELL 189

Query: 204 KAILE 208
             I E
Sbjct: 190 NYIGE 194


>gi|71894660|ref|YP_278768.1| GTPase EngB [Mycoplasma synoviae 53]
 gi|119369218|sp|Q4A5B4|ENGB_MYCS5 RecName: Full=Probable GTP-binding protein EngB
 gi|71851448|gb|AAZ44057.1| putative GTP-binding protein [Mycoplasma synoviae 53]
          Length = 187

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 86/146 (58%), Gaps = 10/146 (6%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
            EIAF GRSNVGKSSL+N L + K LA+ S  PGRTQ +NFF          N      V
Sbjct: 20  SEIAFWGRSNVGKSSLLNALTS-KGLAKVSKTPGRTQLINFF---------ENELNQVYV 69

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYGYA+  K   D    +I  YL  RS L+ +YLLID R G  +ID ++ SFL +  
Sbjct: 70  DLPGYGYAKLSKDLKDKMMAMIEEYLLNRSNLKMLYLLIDSRLGFTKIDLEILSFLKENN 129

Query: 150 VSYQIVLTKIDKLSPTTAQETLEKTK 175
           ++Y IV TKIDKL+     E  +K K
Sbjct: 130 LNYFIVFTKIDKLNTKEKNELNKKIK 155


>gi|313890490|ref|ZP_07824118.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pseudoporcinus SPIN 20026]
 gi|313121007|gb|EFR44118.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           pseudoporcinus SPIN 20026]
          Length = 199

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 99/188 (52%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A +GRSNVGKSS IN ++ RKNLARTS  PG+TQ LNFF   D         
Sbjct: 25  PQDDIPEVALAGRSNVGKSSFINTILGRKNLARTSAKPGKTQLLNFFNIDD--------- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG +I  YL  R  LR V  L+D RH     D  ++ F
Sbjct: 76  KIRFVDVPGYGYAKVSKTERARWGKMIEEYLVNRENLRVVVSLVDLRHEPSGEDVQMYEF 135

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E + K K    N+ ++  + I  SSV R GI+  
Sbjct: 136 LKYYEIPVIVVATKADKIPRGKWNKHEAMVKKKL---NFDSS-DQFIIFSSVNRLGIDQA 191

Query: 203 RKAILETI 210
             +IL  I
Sbjct: 192 WDSILAMI 199


>gi|163791245|ref|ZP_02185661.1| GTP-binding protein [Carnobacterium sp. AT7]
 gi|159873515|gb|EDP67603.1| GTP-binding protein [Carnobacterium sp. AT7]
          Length = 195

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 83/138 (60%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA +GRSNVGKSS IN ++NRK LARTS  PG+TQ LN+++ +D         
Sbjct: 19  PSTGLPEIALAGRSNVGKSSFINTMINRKGLARTSGKPGKTQTLNYYIIED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           +   VD+PGYGYA+  K     WG ++  Y ++R TL+    ++D RH   + D  ++ F
Sbjct: 70  SFYFVDVPGYGYAKVSKTERAKWGQMLEVYFTQRETLKVALSVVDLRHPPTEDDVQMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L   ++   +V TK DK+
Sbjct: 130 LKYHSIPVIVVATKADKI 147


>gi|83315808|ref|XP_730953.1| GTP-binding protein EngB [Plasmodium yoelii yoelii str. 17XNL]
 gi|23490838|gb|EAA22518.1| probable GTP-binding protein engb, putative [Plasmodium yoelii
           yoelii]
          Length = 951

 Score =  120 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 70/188 (37%), Positives = 105/188 (55%), Gaps = 9/188 (4%)

Query: 20  EIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNL 79
           ++  LP    PEIAF GRSN GKS+LIN L  R N A+ S  PG T+ ++F+        
Sbjct: 103 KVNELPLPKYPEIAFIGRSNSGKSTLINELCGRSNKAKVSKMPGCTKQIHFY-------- 154

Query: 80  KNNLPAM-ALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQID 138
           K   P +  LVD+PGYG+A + ++    W    + YL  R+ L+ V++LIDCR G+K  D
Sbjct: 155 KIGKPCLLCLVDLPGYGFAHSKEELRLQWNEFTLFYLKNRTNLKKVFVLIDCRIGLKTSD 214

Query: 139 QDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           +++F F D+  + YQIVL+K D L+       ++     I ++      +I  SS+KR+ 
Sbjct: 215 KELFHFFDRYNIKYQIVLSKCDLLNTKDLAIKIQIMNEEIVHFKNLEKNIISLSSLKRQN 274

Query: 199 IEVLRKAI 206
           +  LR  I
Sbjct: 275 LNELRNEI 282


>gi|291542676|emb|CBL15786.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Ruminococcus
           bromii L2-63]
          Length = 200

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 106/204 (51%), Gaps = 14/204 (6%)

Query: 7   FTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ 66
           F + A+ F  G   +  LP++  PEI FSG SNVGKSSLIN LV RK LAR S  PG+T 
Sbjct: 3   FNEVAFEFAAG--RVDQLPESDMPEIVFSGHSNVGKSSLINKLVQRKALARVSAQPGKTA 60

Query: 67  HLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYL 126
            +NF+  K+F           +VD+PGYGYA+  K   D W  L+  Y ++      V  
Sbjct: 61  TINFYKLKEFR----------MVDLPGYGYAKVSKAEKDRWAKLVEGYFAQDRQRPLVIQ 110

Query: 127 LIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP 186
           ++D RH     D  +  FL +   ++  VLTK DKL  T  ++ +E  K +       H 
Sbjct: 111 ILDLRHPPTDDDLHMIDFLYRGGFNFAAVLTKSDKLKKTAFEKQIEYYKDIFST--IEHV 168

Query: 187 EVIPTSSVKRKGIEVLRKAILETI 210
            +IP S+    G + +RK I  +I
Sbjct: 169 PLIPFSAQTGFGNDEIRKLIETSI 192


>gi|257790850|ref|YP_003181456.1| GTP-binding protein HSR1-related [Eggerthella lenta DSM 2243]
 gi|317488439|ref|ZP_07946992.1| ribosome biogenesis GTP-binding protein YsxC [Eggerthella sp.
           1_3_56FAA]
 gi|325831912|ref|ZP_08165009.1| ribosome biogenesis GTP-binding protein YsxC [Eggerthella sp. HGA1]
 gi|257474747|gb|ACV55067.1| GTP-binding protein HSR1-related [Eggerthella lenta DSM 2243]
 gi|316912483|gb|EFV34039.1| ribosome biogenesis GTP-binding protein YsxC [Eggerthella sp.
           1_3_56FAA]
 gi|325486233|gb|EGC88685.1| ribosome biogenesis GTP-binding protein YsxC [Eggerthella sp. HGA1]
          Length = 193

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 100/182 (54%), Gaps = 14/182 (7%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
           PEIAF+GRSNVGKSSL+N L NRK LA+ S  PG+T  +NFF          +   +  V
Sbjct: 24  PEIAFAGRSNVGKSSLLNKLFNRKGLAKVSQTPGKTATINFF----------SCDGVRFV 73

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYGYA+  K +   W  LI  Y ++   L  V  L+D RH    +D ++  FL +  
Sbjct: 74  DLPGYGYAKVSKSDKSRWSELIEGYFNQDRDLALVVSLVDIRHEASDLDVNMIGFLQEAE 133

Query: 150 VSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYP-TAHPEVIPTSSVKRKGIEVLRKAILE 208
           + + +VLTK DKLS    Q+ +++   L +     A   ++  SS K  GI+ LR  I  
Sbjct: 134 LPFAVVLTKADKLS---RQQQMKQKAALKKQLKLGADVPLVVCSSEKGTGIDELRSLIKN 190

Query: 209 TI 210
           ++
Sbjct: 191 SV 192


>gi|320546907|ref|ZP_08041209.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus equinus
           ATCC 9812]
 gi|320448425|gb|EFW89166.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus equinus
           ATCC 9812]
          Length = 197

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 99/188 (52%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+ RKNLARTS+ PG+TQ LNF+   D         
Sbjct: 23  PQDDLPEIALAGRSNVGKSSFINTLLGRKNLARTSSKPGKTQLLNFYNIDD--------- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG +I  YL  R  LR V  L+D RH     D  ++ F
Sbjct: 74  KLRFVDVPGYGYAKVSKSERAKWGKMIEEYLVSRDNLRAVVSLVDFRHDPSADDIQMYEF 133

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K    N+      +I  SSV R G++  
Sbjct: 134 LKYYEIPVIVVATKADKIPRGKWNKHESAIKKKL---NFDKTDKFII-FSSVDRTGLDES 189

Query: 203 RKAILETI 210
             +ILE +
Sbjct: 190 WDSILEEL 197


>gi|18310371|ref|NP_562305.1| GTPase EngB [Clostridium perfringens str. 13]
 gi|110800363|ref|YP_696084.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium
           perfringens ATCC 13124]
 gi|168207810|ref|ZP_02633815.1| GTP-binding protein [Clostridium perfringens E str. JGS1987]
 gi|168215329|ref|ZP_02640954.1| GTP-binding protein [Clostridium perfringens CPE str. F4969]
 gi|168217820|ref|ZP_02643445.1| GTP-binding protein [Clostridium perfringens NCTC 8239]
 gi|169342290|ref|ZP_02863368.1| GTP-binding protein [Clostridium perfringens C str. JGS1495]
 gi|24418379|sp|Q8XKK5|ENGB_CLOPE RecName: Full=Probable GTP-binding protein EngB
 gi|119369185|sp|Q0TQK6|ENGB_CLOP1 RecName: Full=Probable GTP-binding protein EngB
 gi|18145051|dbj|BAB81095.1| probable GTP binding protein [Clostridium perfringens str. 13]
 gi|110675010|gb|ABG83997.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium
           perfringens ATCC 13124]
 gi|169299617|gb|EDS81676.1| GTP-binding protein [Clostridium perfringens C str. JGS1495]
 gi|170660856|gb|EDT13539.1| GTP-binding protein [Clostridium perfringens E str. JGS1987]
 gi|170713286|gb|EDT25468.1| GTP-binding protein [Clostridium perfringens CPE str. F4969]
 gi|182380168|gb|EDT77647.1| GTP-binding protein [Clostridium perfringens NCTC 8239]
          Length = 197

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 83/140 (59%), Gaps = 11/140 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV-PKDFSNLKNNL 83
           P    PEIAF GRSNVGKSS+IN L NR+ LA+ S  PG+T+ +NFF+  KDF       
Sbjct: 19  PDDNLPEIAFVGRSNVGKSSIINSLTNRRGLAKVSQTPGKTRLINFFLLNKDF------- 71

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYA+  KK   SWG  I RYL  R  L+ V LL+DCRH     D  ++ 
Sbjct: 72  ---YLVDLPGYGYAKVSKKEKASWGATIERYLLNRGPLKKVVLLVDCRHKPTADDVQMYE 128

Query: 144 FLDKKAVSYQIVLTKIDKLS 163
           ++        ++ TK DK+S
Sbjct: 129 WIKHYGYEVVVIATKSDKIS 148


>gi|237747394|ref|ZP_04577874.1| GTP-binding protein EngB [Oxalobacter formigenes HOxBLS]
 gi|229378745|gb|EEO28836.1| GTP-binding protein EngB [Oxalobacter formigenes HOxBLS]
          Length = 237

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 102/206 (49%), Gaps = 12/206 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-- 71
           F R    +  LP+   PEIAF GRSN GKSS IN L N+KNLA  S  PGRTQH+NFF  
Sbjct: 20  FFRTANHLRDLPRLNVPEIAFVGRSNAGKSSAINTLCNQKNLAYASRTPGRTQHINFFSI 79

Query: 72  -----VPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYL 126
                       +  N   + LVD+PGYGYA+      + W  L+  YL  R  L  + L
Sbjct: 80  GGAHVAQHRHDPVDENKVELFLVDLPGYGYAQISGTAKEHWQKLLSDYLITRPQLSGLIL 139

Query: 127 LIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNY--PTA 184
           ++D RH  + +D  +  +          +LTK DKL+   + E L++   ++R+Y     
Sbjct: 140 VMDSRHPFQPLDVSLLEWFAVTGKPIHCLLTKADKLNRRESSEALKQVDTILRSYIDENG 199

Query: 185 HPEVIPT---SSVKRKGIEVLRKAIL 207
           HP        SS KR G++     IL
Sbjct: 200 HPFPFSAQLFSSTKRTGLKEATAFIL 225


>gi|121634279|ref|YP_974524.1| GTPase EngB [Neisseria meningitidis FAM18]
 gi|161869414|ref|YP_001598581.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria
           meningitidis 053442]
 gi|218767611|ref|YP_002342123.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria
           meningitidis Z2491]
 gi|12644640|sp|Q9JVW1|ENGB_NEIMA RecName: Full=Probable GTP-binding protein EngB
 gi|166225965|sp|A1KS92|ENGB_NEIMF RecName: Full=Probable GTP-binding protein EngB
 gi|189037181|sp|A9M1V2|ENGB_NEIM0 RecName: Full=Probable GTP-binding protein EngB
 gi|120865985|emb|CAM09722.1| putative GTP-binding protein [Neisseria meningitidis FAM18]
 gi|121051619|emb|CAM07919.1| putative GTP-binding protein [Neisseria meningitidis Z2491]
 gi|161594967|gb|ABX72627.1| GTP-binding protein [Neisseria meningitidis 053442]
 gi|319409871|emb|CBY90184.1| putative GTP-binding protein EngB [Neisseria meningitidis WUE 2594]
 gi|325127554|gb|EGC50477.1| GTP-binding protein [Neisseria meningitidis N1568]
 gi|325129546|gb|EGC52370.1| GTP-binding protein [Neisseria meningitidis OX99.30304]
 gi|325131453|gb|EGC54160.1| GTP-binding protein [Neisseria meningitidis M6190]
 gi|325135590|gb|EGC58207.1| GTP-binding protein [Neisseria meningitidis M0579]
 gi|325137560|gb|EGC60141.1| GTP-binding protein [Neisseria meningitidis ES14902]
 gi|325141674|gb|EGC64134.1| GTP-binding protein [Neisseria meningitidis 961-5945]
 gi|325197693|gb|ADY93149.1| GTP-binding protein [Neisseria meningitidis G2136]
          Length = 209

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 103/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 9   FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL +R  L  + L++D RH 
Sbjct: 66  ----ELQN---GNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLQQRKQLIGLVLIMDARHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP-EVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y       V   S
Sbjct: 119 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFS 178

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GI+   + +
Sbjct: 179 SLKKQGIDEANRTV 192


>gi|254670022|emb|CBA04791.1| GTP-binding protein [Neisseria meningitidis alpha153]
 gi|261393144|emb|CAX50756.1| putative GTP-binding protein EngB [Neisseria meningitidis 8013]
 gi|308389904|gb|ADO32224.1| GTPase EngB [Neisseria meningitidis alpha710]
 gi|325143809|gb|EGC66125.1| GTP-binding protein [Neisseria meningitidis M01-240013]
 gi|325201549|gb|ADY97003.1| GTP-binding protein [Neisseria meningitidis M01-240149]
 gi|325206723|gb|ADZ02176.1| GTP-binding protein [Neisseria meningitidis M04-240196]
 gi|325207530|gb|ADZ02982.1| GTP-binding protein [Neisseria meningitidis NZ-05/33]
          Length = 209

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 104/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 9   FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL +R  L  + L++D RH 
Sbjct: 66  ----ELQN---GNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLQQRKQLIGLVLIMDARHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT-AHPEVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y    +  V   S
Sbjct: 119 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFS 178

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GI+   + +
Sbjct: 179 SLKKQGIDEANRTV 192


>gi|182627119|ref|ZP_02954837.1| hypothetical protein CJD_0168 [Clostridium perfringens D str.
           JGS1721]
 gi|177907508|gb|EDT70166.1| hypothetical protein CJD_0168 [Clostridium perfringens D str.
           JGS1721]
          Length = 197

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 83/140 (59%), Gaps = 11/140 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV-PKDFSNLKNNL 83
           P    PEIAF GRSNVGKSS+IN L NR+ LA+ S  PG+T+ +NFF+  KDF       
Sbjct: 19  PDNNLPEIAFVGRSNVGKSSIINSLTNRRGLAKVSQTPGKTRLINFFLLNKDF------- 71

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYA+  KK   SWG  I RYL  R  L+ V LL+DCRH     D  ++ 
Sbjct: 72  ---YLVDLPGYGYAKVSKKEKASWGATIERYLLNRGPLKKVVLLVDCRHKPTADDVQMYE 128

Query: 144 FLDKKAVSYQIVLTKIDKLS 163
           ++        ++ TK DK+S
Sbjct: 129 WIKHYGYEVVVIATKSDKIS 148


>gi|110802133|ref|YP_698700.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium
           perfringens SM101]
 gi|119369186|sp|Q0ST57|ENGB_CLOPS RecName: Full=Probable GTP-binding protein EngB
 gi|110682634|gb|ABG86004.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium
           perfringens SM101]
          Length = 197

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 83/140 (59%), Gaps = 11/140 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV-PKDFSNLKNNL 83
           P    PEIAF GRSNVGKSS+IN L NR+ LA+ S  PG+T+ +NFF+  KDF       
Sbjct: 19  PDDNLPEIAFVGRSNVGKSSIINSLTNRRGLAKVSQTPGKTRLINFFLLNKDF------- 71

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYA+  KK   SWG  I RYL  R  L+ V LL+DCRH     D  ++ 
Sbjct: 72  ---YLVDLPGYGYAKVSKKEKASWGATIERYLLNRGPLKKVVLLVDCRHKPTADDVQMYE 128

Query: 144 FLDKKAVSYQIVLTKIDKLS 163
           ++        ++ TK DK+S
Sbjct: 129 WIKHYGYEVVVIATKSDKIS 148


>gi|332523732|ref|ZP_08399984.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           porcinus str. Jelinkova 176]
 gi|332314996|gb|EGJ27981.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           porcinus str. Jelinkova 176]
          Length = 199

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 99/188 (52%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++ RKNLARTS  PG+TQ LNFF   D         
Sbjct: 25  PQDNIPEIALAGRSNVGKSSFINTILGRKNLARTSAKPGKTQLLNFFNIDD--------- 75

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG +I  YL  R  LR V  L+D RH     D  ++ F
Sbjct: 76  KIRFVDVPGYGYAKVSKTERARWGKMIEEYLVNRENLRVVVSLVDLRHEPSGEDVQMYEF 135

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E + K K    N+ + + + I  SSV R GI+  
Sbjct: 136 LKYYEIPVIVVATKADKIPRGKWNKHEAMVKKKL---NFDS-NDQFIIFSSVDRLGIDQA 191

Query: 203 RKAILETI 210
             +IL  +
Sbjct: 192 WDSILAMV 199


>gi|296159592|ref|ZP_06842416.1| ribosome biogenesis GTP-binding protein YsxC [Burkholderia sp.
           Ch1-1]
 gi|295890300|gb|EFG70094.1| ribosome biogenesis GTP-binding protein YsxC [Burkholderia sp.
           Ch1-1]
          Length = 217

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 100/197 (50%), Gaps = 9/197 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP    PEI F+GRSN GKS+ INIL N+K LA  S  PGRTQH+N+   
Sbjct: 10  FFTTVNHLRDLPATSQPEICFAGRSNAGKSTAINILCNQKRLAFASKTPGRTQHINY--- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
             FS  K   P   LVD+PGYGYA  P      W  L+  YL  RS LR + L++D R  
Sbjct: 67  --FSVGKAEEPTAHLVDLPGYGYAEVPGAAKAHWEALLSTYLQSRSQLRGMILMMDSRRP 124

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA--HPEVIPT 191
           +  +D+ +  +          +LTK DKL+   +   L  T+  +  Y  A    E+   
Sbjct: 125 LTDLDRRMIEWFAPTGKPIHTLLTKCDKLTRQESVNALRATQKGLAEYRAAGYRGELTAQ 184

Query: 192 --SSVKRKGIEVLRKAI 206
             S++KR GI+   + I
Sbjct: 185 LFSALKRIGIDEAHELI 201


>gi|317050145|ref|YP_004117793.1| ribosome biogenesis GTP-binding protein YsxC [Pantoea sp. At-9b]
 gi|316951762|gb|ADU71237.1| ribosome biogenesis GTP-binding protein YsxC [Pantoea sp. At-9b]
          Length = 213

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 107/196 (54%), Gaps = 16/196 (8%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 11  FVLSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLF-- 68

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                    +    LVD+PGYGYA  P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 69  -------EVVEGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLQKRQALKGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP---EVIP 190
           +K +DQ +  +  +  +   ++LTK DKL+    +  L     ++R    A     +V  
Sbjct: 122 LKDLDQQMIEWAVQSEIPVLVLLTKADKLASGARKAQLN----MVREASLAFQGDVQVEM 177

Query: 191 TSSVKRKGIEVLRKAI 206
            SS+K+ G++ LR+ +
Sbjct: 178 FSSLKKLGVDKLRQKL 193


>gi|255067338|ref|ZP_05319193.1| ribosome biogeneis GTP-binding protein YsxC [Neisseria sicca ATCC
           29256]
 gi|255048489|gb|EET43953.1| ribosome biogeneis GTP-binding protein YsxC [Neisseria sicca ATCC
           29256]
          Length = 217

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 103/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 9   FFTTVNHLKDLPDT-PAEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            + SN         +VD+PGYGYA+ P+     W  L+  YL +R  L  + L++D RH 
Sbjct: 66  -ELSN------GSFMVDLPGYGYAQVPEAIRTHWVKLLGDYLQQRRQLIGLVLIMDARHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP-EVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL   K  ++ Y T     V   S
Sbjct: 119 LKELDLRMLDFFHITGRPVHILLSKADKLSKNEQIKTLGSVKKSLKPYMTRQRISVQLFS 178

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GIE + + +
Sbjct: 179 SLKKQGIEEVNQVV 192


>gi|225009961|ref|ZP_03700433.1| GTP-binding protein HSR1-related [Flavobacteria bacterium MS024-3C]
 gi|225005440|gb|EEG43390.1| GTP-binding protein HSR1-related [Flavobacteria bacterium MS024-3C]
          Length = 204

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 102/190 (53%), Gaps = 10/190 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+     +   PK   PE AF GRSNVGKSSLIN+L ++K+LA+TS  PG+TQ +N F  
Sbjct: 8   FVMSNAHVEKCPKDPIPEYAFIGRSNVGKSSLINMLTSKKSLAKTSGRPGKTQLINHF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                +  N     LVD+PGYGYAR  K++  ++   I  Y  +R+ L C ++L+D RH 
Sbjct: 66  ----KINQN---WFLVDLPGYGYARVSKRDKKTFQKYITEYFLKRTQLVCAFVLVDIRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQ-ETLEKTKYLIRNYPTAHPEVIPTS 192
            + +D D   ++ +  + + I+ TK DKL P   +  T    + L        PE   TS
Sbjct: 119 PQPVDLDFMRWMGENEIPFCIIFTKADKLKPAIIEANTKAYNEKLTEEIFELAPEHFITS 178

Query: 193 SVKRKGIEVL 202
           S K  G E L
Sbjct: 179 SSKHLGKEEL 188


>gi|116333988|ref|YP_795515.1| GTPase EngB [Lactobacillus brevis ATCC 367]
 gi|122269328|sp|Q03QN8|ENGB_LACBA RecName: Full=Probable GTP-binding protein EngB
 gi|116099335|gb|ABJ64484.1| Predicted GTPase [Lactobacillus brevis ATCC 367]
          Length = 197

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 84/139 (60%), Gaps = 9/139 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA  GRSNVGKSSL N+L+NR + ARTS+ PG+TQ LNF+  +D         
Sbjct: 19  PTTGYPEIALVGRSNVGKSSLTNVLINRNSYARTSSQPGKTQTLNFYNVED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K   + WG +I  YL++R  LR V  L+D RH   + D  ++ +
Sbjct: 70  QLYFVDVPGYGYAKVSKTEREKWGQMIETYLTQRDQLRGVISLVDARHAPTEDDIQMYRW 129

Query: 145 LDKKAVSYQIVLTKIDKLS 163
           L    +   IV TK DK++
Sbjct: 130 LAYYELPTLIVATKSDKIA 148


>gi|281203575|gb|EFA77772.1| hypothetical protein PPL_09270 [Polysphondylium pallidum PN500]
          Length = 410

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 111/208 (53%), Gaps = 29/208 (13%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAP--------GRTQHLNFFVPKD 75
            P +  P+IAF GRSNVGKSSL+N L+  + +A  S  P        G T+ +NF+   D
Sbjct: 161 FPASPLPQIAFIGRSNVGKSSLLNTLLGDQ-MAHVSKTPVTINNYNYGCTKSINFYALWD 219

Query: 76  FSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYL-----------SERSTLRCV 124
                     + +VD+PGYGY++  K     WG  I  YL            E++ L+ +
Sbjct: 220 ---------KIMMVDLPGYGYSKVSKDKASVWGRSISEYLLTSHHCKLNLLFEKTRLKKL 270

Query: 125 YLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA 184
           +LL+D R G+++ D +V   LD+  V++Q++LTKIDK + T  +    + K  I N  + 
Sbjct: 271 FLLVDSRVGLQKNDIEVMKLLDEHRVAFQVILTKIDKATTTGLKRFYNQVKEEIMNNVSC 330

Query: 185 HPEVIPTSSVKRKGIEVLRKAILETINY 212
            P +I  SS + KGI+ +R  ILE  N+
Sbjct: 331 VPNIIQCSSKEMKGIQQIRSVILEVTNF 358


>gi|297793371|ref|XP_002864570.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297310405|gb|EFH40829.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 467

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 108/190 (56%), Gaps = 11/190 (5%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
            P    PEIAF+GRSNVGKSSL+N L  +  + RTS+ PG TQ +NFF            
Sbjct: 285 FPPPDVPEIAFAGRSNVGKSSLLNALTRQWGVVRTSDKPGLTQTINFF---------GLG 335

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P + LVD+PGYG+A A  +  ++W  L+  Y+S R++L+ V LL+D + G+K  DQ++ +
Sbjct: 336 PKVRLVDLPGYGFAFAKDEVKEAWEDLVKEYVSTRTSLKRVCLLVDTKWGMKPRDQELIN 395

Query: 144 FLDKKAVSYQIVLTKIDKLSP-TTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
            +++    YQIVLTK D + P   A+  ++  + L  N     P ++  SS    GI  L
Sbjct: 396 LMERSNTKYQIVLTKTDVVFPMDVARRAMQIEEKLKANRSIVQP-LMMVSSRSGAGIGSL 454

Query: 203 RKAILETINY 212
           R A+ +   +
Sbjct: 455 RTALAKIARF 464


>gi|295100722|emb|CBK98267.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Faecalibacterium
           prausnitzii L2-6]
          Length = 204

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 103/200 (51%), Gaps = 14/200 (7%)

Query: 7   FTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ 66
           + K+ +I   G+     LP++  PE++FSGRSNVGKSSLIN L NRKNLAR S+ PG+T 
Sbjct: 3   YNKADFIASYGIS--SQLPESDRPELSFSGRSNVGKSSLINKLCNRKNLARVSSTPGKTA 60

Query: 67  HLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYL 126
            +NF+   D             VD+PGYGYA+    + + W  LI  Y   +     +  
Sbjct: 61  TINFYAVDD----------CYFVDLPGYGYAKVSNADRERWDDLINSYFEAQRHHTLLVQ 110

Query: 127 LIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP 186
           LIDCRH     D  +  +L    + + + LTK DKL  +   +T E+ + L    P    
Sbjct: 111 LIDCRHAPSADDIQMLHYLHYHNIPFVVALTKADKLKKSQLAQTREEFETLC--LPYGCQ 168

Query: 187 EVIPTSSVKRKGIEVLRKAI 206
           +V+ TS     GI  L+  +
Sbjct: 169 KVVLTSGESGCGIPELQAVL 188


>gi|296273481|ref|YP_003656112.1| ribosome biogenesis GTP-binding protein YsxC [Arcobacter
           nitrofigilis DSM 7299]
 gi|296097655|gb|ADG93605.1| ribosome biogenesis GTP-binding protein YsxC [Arcobacter
           nitrofigilis DSM 7299]
          Length = 202

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/199 (39%), Positives = 109/199 (54%), Gaps = 17/199 (8%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++    I   P     EIAF GRSNVGKSSL+N L NRK LA++S+ PG+TQ +N+F  
Sbjct: 8   FMQSAQSISDSPGPDVAEIAFLGRSNVGKSSLLNTLTNRKGLAKSSSTPGKTQLINYFNI 67

Query: 74  KDFSNLKNNLPA---MALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDC 130
           K  ++ +N +P       VD+PG+GYA+  K     W   +  YL +R  L+    LID 
Sbjct: 68  KFKTDEENGMPPDLFARFVDLPGFGYAKVSKSLKAEWNKNLTNYLEQRPNLQMFIHLIDA 127

Query: 131 RHGVKQIDQDVFSFLDKKAVSYQIV---LTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE 187
           RH   +ID++V  FL+K     Q++    TK DKL     Q  L K K   R Y    PE
Sbjct: 128 RHPELEIDKNVDEFLEKIKRGDQLIVHAFTKTDKLK----QNDLAKLK---REY----PE 176

Query: 188 VIPTSSVKRKGIEVLRKAI 206
            I  S++K++GI  L+  I
Sbjct: 177 GIFISNLKKRGISDLQNKI 195


>gi|260599982|ref|YP_003212553.1| GTP-binding protein YsxC [Cronobacter turicensis z3032]
 gi|260219159|emb|CBA34514.1| Probable GTP-binding protein engB [Cronobacter turicensis z3032]
          Length = 220

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 102/190 (53%), Gaps = 10/190 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 20  FVTSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 79

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYGYA  P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 80  AD---------GKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRLCLKGLVVLMDIRHP 130

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKL+    +  L   +     +     +V   SS
Sbjct: 131 LKDLDQQMIEWAVDSDIPVLVLLTKADKLASGARKAQLNMVREAALAF-NGDVQVEAFSS 189

Query: 194 VKRKGIEVLR 203
           +K+ G++ LR
Sbjct: 190 LKKSGVDKLR 199


>gi|328957598|ref|YP_004374984.1| ribosome biogenesis GTP-binding protein YsxC [Carnobacterium sp.
           17-4]
 gi|328673922|gb|AEB29968.1| ribosome biogenesis GTP-binding protein YsxC [Carnobacterium sp.
           17-4]
          Length = 195

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 82/138 (59%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA +GRSNVGKSS IN ++NRK LARTS  PG+TQ LN+++ +D         
Sbjct: 19  PNTGLPEIALAGRSNVGKSSFINTMINRKGLARTSGKPGKTQTLNYYIIED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  K     WG ++  Y ++R TL+    ++D RH   + D  ++ F
Sbjct: 70  TFYFVDVPGYGYAKVSKTERAKWGQMLETYFTQRDTLKAALSVVDLRHPPTEDDVQMYEF 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L   ++   ++ TK DK+
Sbjct: 130 LKYHSIPVIVIATKADKI 147


>gi|229825759|ref|ZP_04451828.1| hypothetical protein GCWU000182_01122 [Abiotrophia defectiva ATCC
           49176]
 gi|229790322|gb|EEP26436.1| hypothetical protein GCWU000182_01122 [Abiotrophia defectiva ATCC
           49176]
          Length = 198

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 108/186 (58%), Gaps = 17/186 (9%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           +P+   PE AF+G+SNVGKSSLIN L+NRK LAR S  PG+TQ +N++   D        
Sbjct: 18  IPEMPHPEFAFAGKSNVGKSSLINALMNRKALARVSAQPGKTQTINYYNVND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             + LVD+PGYGY +   +    WG ++ +YL +   L+ V+LLID RH   + D  ++ 
Sbjct: 70  -EIYLVDLPGYGYTKVAVEVKAKWGKMVEKYLRQSKMLKYVFLLIDSRHKPSENDIMMYE 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLE---KTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
           ++  + V+  IV TKIDKL  +  +  +E   KT  L     T+  +++P SS  + G++
Sbjct: 129 WIVSQGVNPIIVATKIDKLKRSQIKGQMELIIKTLNL-----TSKEQLLPFSSETKAGVK 183

Query: 201 VLRKAI 206
            L + I
Sbjct: 184 ELWEII 189


>gi|146313732|ref|YP_001178806.1| cell division checkpoint GTPase YihA [Enterobacter sp. 638]
 gi|166920112|sp|A4WGC5|ENGB_ENT38 RecName: Full=Probable GTP-binding protein EngB
 gi|145320608|gb|ABP62755.1| cell division checkpoint GTPase YihA [Enterobacter sp. 638]
          Length = 208

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 107/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+++LARTS  PGRTQ +N F  
Sbjct: 11  FVTSAPDIRHLPPDTGIEVAFAGRSNAGKSSALNTLTNQRSLARTSKTPGRTQLINLFEV 70

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            LVD+PGYGYA  P++    W   +  YL +R  L+ + +L+D RH 
Sbjct: 71  AE---------GKRLVDLPGYGYAEVPEEVKLKWQKALGEYLEKRQCLKGLVVLMDIRHP 121

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +   ++LTK DKL+    +  L+  +     +     ++   SS
Sbjct: 122 LKDLDQQMIHWAVASEIPVLVLLTKSDKLASGARKAQLKMVREAALAF-NGDVQIETFSS 180

Query: 194 VKRKGIEVLRKAI 206
           +K++G++VLR+ +
Sbjct: 181 LKKQGVDVLRQKL 193


>gi|306831537|ref|ZP_07464695.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
 gi|304426322|gb|EFM29436.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
          Length = 213

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 100/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+ RKNLARTS+ PG+TQ LNF+   D         
Sbjct: 39  PQDDLPEIALAGRSNVGKSSFINTLLGRKNLARTSSKPGKTQLLNFYNIDD--------- 89

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG +I  YL  R  LR V  L+D RH     D  ++ F
Sbjct: 90  KLRFVDVPGYGYAKVSKSERAKWGKMIEEYLVSRDNLRAVVSLVDFRHDPSADDVQMYDF 149

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K    N+  +   +I  SSV R G++  
Sbjct: 150 LKYYEIPVIVVATKADKIPRGKWNKHESAIKKKL---NFDKSDKFII-FSSVDRTGLDES 205

Query: 203 RKAILETI 210
             +IL+ +
Sbjct: 206 WDSILDEL 213


>gi|295399411|ref|ZP_06809393.1| ribosome biogenesis GTP-binding protein YsxC [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978877|gb|EFG54473.1| ribosome biogenesis GTP-binding protein YsxC [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 193

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 84/133 (63%), Gaps = 9/133 (6%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
           PE A +GRSNVGKSS IN ++NRKNLARTS+ PG+TQ LNF++  +         ++  V
Sbjct: 24  PEFALAGRSNVGKSSFINKMINRKNLARTSSKPGKTQTLNFYLINE---------SLYFV 74

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYG+A+  KK  ++WG ++  Y + R  LR V L++D RH   + D  ++ FL    
Sbjct: 75  DVPGYGFAKVSKKEREAWGKMMETYFTTREQLRAVVLIVDLRHPPTKDDVMMYEFLKHYE 134

Query: 150 VSYQIVLTKIDKL 162
           +   IV TK DK+
Sbjct: 135 IPAIIVATKADKV 147


>gi|288905455|ref|YP_003430677.1| GTP-binding protein [Streptococcus gallolyticus UCN34]
 gi|325978445|ref|YP_004288161.1| ribosome biogenesis GTP-binding protein [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|288732181|emb|CBI13746.1| putative GTP-binding protein [Streptococcus gallolyticus UCN34]
 gi|325178373|emb|CBZ48417.1| engB, yihA, ysxC; ribosome biogenesis GTP-binding protein
           [Streptococcus gallolyticus subsp. gallolyticus ATCC
           BAA-2069]
          Length = 197

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 100/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+ RKNLARTS+ PG+TQ LNF+   D         
Sbjct: 23  PQDDLPEIALAGRSNVGKSSFINTLLGRKNLARTSSKPGKTQLLNFYNIDD--------- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG +I  YL  R  LR V  L+D RH     D  ++ F
Sbjct: 74  KLRFVDVPGYGYAKVSKSERAKWGKMIEEYLVSRDNLRAVVSLVDFRHDPSADDVQMYDF 133

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K    N+  +   +I  SSV R G++  
Sbjct: 134 LKYYEIPVIVVATKADKIPRGKWNKHESAIKKKL---NFDKSDKFII-FSSVDRTGLDES 189

Query: 203 RKAILETI 210
             +IL+ +
Sbjct: 190 WDSILDEL 197


>gi|288553615|ref|YP_003425550.1| GTP-binding protein YsxC [Bacillus pseudofirmus OF4]
 gi|288544775|gb|ADC48658.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus pseudofirmus
           OF4]
          Length = 195

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 87/147 (59%), Gaps = 9/147 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PEIA +GRSNVGKSS IN ++NRK+LARTS  PG+TQ LNF+   +         
Sbjct: 19  PNTPLPEIALAGRSNVGKSSFINKMINRKSLARTSQRPGKTQTLNFYAINE--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYG+A+  KK  ++WG +I  Y+ +R  LR V  LID RH   + D+ ++ +
Sbjct: 70  QLHFVDVPGYGFAKVSKKEREAWGKMIETYIQQREQLRAVVQLIDVRHKPTEDDKLMYEW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETL 171
           L    +   ++ TK DK+     Q+ L
Sbjct: 130 LKHFDIPVIVIATKCDKIPKGKWQKHL 156


>gi|296840815|ref|ZP_06863497.2| ribosome biogenesis GTP-binding protein YsxC [Neisseria
           polysaccharea ATCC 43768]
 gi|296839902|gb|EFH23840.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria
           polysaccharea ATCC 43768]
          Length = 210

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 104/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 11  FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL +R  L  + L++D RH 
Sbjct: 68  ----ELQN---GNFMVDLPGYGYAQVPEAVRAHWVKLLGDYLQQRKQLIGLILIMDARHP 120

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT-AHPEVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y    +  V   S
Sbjct: 121 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFS 180

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GI+   + +
Sbjct: 181 SLKKQGIDETNRTV 194


>gi|114776792|ref|ZP_01451835.1| GTP-binding protein [Mariprofundus ferrooxydans PV-1]
 gi|114552878|gb|EAU55309.1| GTP-binding protein [Mariprofundus ferrooxydans PV-1]
          Length = 202

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 107/201 (53%), Gaps = 22/201 (10%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++ V + G  P    P+IA +G SNVGKSSL+N L  R  L +TS  PG T+ LN F  
Sbjct: 17  FVQSVADPGAFPAVDLPQIAVAGHSNVGKSSLMNALFGRNGLVKTSKNPGCTRLLNLF-- 74

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + +VD+PGYGYARAPKK    W  +I  YL+  + ++ V LL+D RHG
Sbjct: 75  -DVDG------QLLVVDLPGYGYARAPKKEQHRWISMIEGYLAN-ADIKLVLLLLDIRHG 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTT----AQETLEKTKYLIRNYPTAHPEVI 189
            K  D  +  +L++  + +  V TK DKLS  +     QE  +    L+R         +
Sbjct: 127 PKDSDLQLIEWLNEAGIRWLPVATKADKLSGNSRSIRLQEMTDAMGGLLRP--------M 178

Query: 190 PTSSVKRKGIEVLRKAILETI 210
           PTSS K  GI+ LR  I + +
Sbjct: 179 PTSSFKATGIDQLRAVIQDEL 199


>gi|163802213|ref|ZP_02196108.1| GTP-binding protein [Vibrio sp. AND4]
 gi|159174018|gb|EDP58828.1| GTP-binding protein [Vibrio sp. AND4]
          Length = 223

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 107/190 (56%), Gaps = 10/190 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    EIAF+GRSN GKSS +N L N+K+LA+TS  PGRTQ +N F  
Sbjct: 16  FITSAPDIRHLPEDEGVEIAFAGRSNAGKSSALNRLTNQKSLAKTSKTPGRTQLINLFKV 75

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           ++  +         +VD+PGYG+A+ P +  + W   +  YL +R  L+ + +L+D RH 
Sbjct: 76  QEGCH---------IVDLPGYGFAQVPIEMKNKWQKSLGEYLQKRECLKGLVVLMDIRHP 126

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +     +  Q++LTK DKL     ++TL K +     +      V   SS
Sbjct: 127 MKDLDQQMIFWAIDSRIPVQVLLTKADKLKSGARKQTLLKVRKQAETF-GGDVSVDVFSS 185

Query: 194 VKRKGIEVLR 203
           +K  G++ LR
Sbjct: 186 LKGLGVDQLR 195


>gi|82703200|ref|YP_412766.1| GTPase EngB [Nitrosospira multiformis ATCC 25196]
 gi|119369223|sp|Q2Y797|ENGB_NITMU RecName: Full=Probable GTP-binding protein EngB
 gi|82411265|gb|ABB75374.1| cell division checkpoint GTPase YihA [Nitrosospira multiformis ATCC
           25196]
          Length = 235

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 103/188 (54%), Gaps = 12/188 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V E+  LP     EIAF+GRSN GKSS IN L NR  LA  S  PGRTQHLNFF  
Sbjct: 9   FYTTVNELRDLPPPVGVEIAFAGRSNAGKSSAINTLANRNRLAFVSKTPGRTQHLNFF-- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L N+     LVD+PGYGYA+ P +    W  L+  YL  R +L  + L++D RH 
Sbjct: 67  ----RLGND---RFLVDLPGYGYAKVPAEVRQHWERLLGTYLQTRQSLHGMVLIMDARHP 119

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKT-KYLIRNYPTAHPEVIPTS 192
           +  +D+ + ++      +  ++LTK DKL+    Q+ L+    +L  +YP    ++   S
Sbjct: 120 LTPLDRQMLAWFAPTKKAVHVLLTKSDKLTRQQGQKVLKTVLGFLRESYPQCSVQLF--S 177

Query: 193 SVKRKGIE 200
           S  R+G++
Sbjct: 178 STSREGVK 185


>gi|114322004|ref|YP_743687.1| cell division checkpoint GTPase YihA [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|119368788|sp|Q0A4P0|ENGB_ALHEH RecName: Full=Probable GTP-binding protein EngB
 gi|114228398|gb|ABI58197.1| cell division checkpoint GTPase YihA [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 206

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 101/188 (53%), Gaps = 12/188 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++  +P     E+AF+GRSNVGKSS IN L N+K+LARTS  PGRTQ +N F  
Sbjct: 10  FLTSAPDLRRMPPDQGREVAFAGRSNVGKSSAINTLTNQKSLARTSKTPGRTQLINVFPI 69

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D +         ALVD+PGYGYA+ P      W  ++  YL+ R  LR V L++D RH 
Sbjct: 70  TDEA---------ALVDLPGYGYAKVPAAVRRRWDQVLPEYLAGRRALRGVVLVMDLRHP 120

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR-NYPTAHPEVIPTS 192
           +   D+ +  +     V   ++LTK DK     A+   +     +R  +P    ++   S
Sbjct: 121 LTDFDRQMLDWCGHIGVPLHVLLTKADKFKAGAARNRGQNVGRQLRAEWPGVTWQIF--S 178

Query: 193 SVKRKGIE 200
           + KR G++
Sbjct: 179 ASKRMGVD 186


>gi|262373530|ref|ZP_06066808.1| ribosome biogenesis GTP-binding protein YsxC [Acinetobacter junii
           SH205]
 gi|262311283|gb|EEY92369.1| ribosome biogenesis GTP-binding protein YsxC [Acinetobacter junii
           SH205]
          Length = 258

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 106/199 (53%), Gaps = 9/199 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++ L  +    EIAF+GRSN GKSS IN L N+K LAR S  PGRTQ +NFF  
Sbjct: 46  FLMSAPKLALCVEDTGYEIAFAGRSNAGKSSAINALTNKKQLARASKRPGRTQMINFF-- 103

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               +L N  P   LVD+PGYGYA  P+     W   +  YL  R +L+ + LL+D RH 
Sbjct: 104 ----SLGN--PDQRLVDLPGYGYAAVPEAMKIVWQKELENYLIHRKSLQGLVLLMDIRHP 157

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           ++  D  +  +   + +   I+LTK DKL+   A +TL   K  ++        +   SS
Sbjct: 158 LQHFDLMMLEWAHSRHLFVHILLTKADKLNRGPANKTLLDVKQQLKKMKLDFS-IQLFSS 216

Query: 194 VKRKGIEVLRKAILETINY 212
           + R G+E L   +   +NY
Sbjct: 217 LNRIGLEELASVMGGRLNY 235


>gi|224003151|ref|XP_002291247.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220973023|gb|EED91354.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 175

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 87/153 (56%), Gaps = 11/153 (7%)

Query: 13  IFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV 72
           +F+ G   +   P+A   E+AF GRSNVGKSSL+N+L NRK+LA TS  PG+TQ  N+F 
Sbjct: 25  VFVTGAVGMDGCPEADRGEVAFIGRSNVGKSSLVNMLTNRKSLAFTSKTPGKTQQFNYFA 84

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
                   N+ P +A     G+G+A+ P+K    W   + +Y  +R TLR V+ LID RH
Sbjct: 85  V-------NDKPELARQIRYGFGFAKVPQKQRQQWSDFMEQYFEQRETLRIVFHLIDARH 137

Query: 133 GVKQIDQDVF----SFLDKKAVSYQIVLTKIDK 161
           G    D ++     + L  K   Y I+LTK DK
Sbjct: 138 GPTDEDSNIMKKVSTILGSKKAQYVIILTKADK 170


>gi|167464640|ref|ZP_02329729.1| GTPase EngB [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322383228|ref|ZP_08057039.1| YsxC-like protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321152497|gb|EFX45283.1| YsxC-like protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 204

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 101/188 (53%), Gaps = 11/188 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PEIA +GRSNVGKSSLIN L+NRKNLARTS+ PG+TQ LN+++            
Sbjct: 19  PTDALPEIALAGRSNVGKSSLINRLINRKNLARTSSQPGKTQTLNYYLINQ--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG  I  YL +R  L+ V  LID RH   + DQ ++++
Sbjct: 70  DLYFVDLPGYGYAKVSKAKRAEWGKFIENYLLKREPLKLVLQLIDLRHPPTKDDQAMYAW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   +V TK DK+     Q+  +  K  +    + H  +I  SS   +G E L  
Sbjct: 130 LKHHKLPVCVVTTKADKIPKGKWQKHCKVIKETLEFEKSDH--MIVFSSETGQGKEELWS 187

Query: 205 AILETINY 212
            I   I +
Sbjct: 188 FIENKIGW 195


>gi|254804379|ref|YP_003082600.1| GTP-binding protein [Neisseria meningitidis alpha14]
 gi|254667921|emb|CBA04098.1| GTP-binding protein [Neisseria meningitidis alpha14]
          Length = 221

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 103/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 9   FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL +R  L  + L++D RH 
Sbjct: 66  ----ELQN---GNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLQQRKQLIGLVLIMDARHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP-EVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y       V   S
Sbjct: 119 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFS 178

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GI+   + +
Sbjct: 179 SLKKQGIDEANRTV 192


>gi|220932326|ref|YP_002509234.1| GTP-binding protein HSR1-related [Halothermothrix orenii H 168]
 gi|254783200|sp|B8CY70|ENGB_HALOH RecName: Full=Probable GTP-binding protein EngB
 gi|219993636|gb|ACL70239.1| GTP-binding protein HSR1-related [Halothermothrix orenii H 168]
          Length = 199

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 91/160 (56%), Gaps = 11/160 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
            P    PE AFSGRSNVGKSSLIN LVNR+ LARTS+ PGRTQ +NFF   D        
Sbjct: 18  FPTHNWPEFAFSGRSNVGKSSLINTLVNRRKLARTSSRPGRTQSINFFNIDD-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYG+A  P+K  + WG LI  YL+ R  L  +  ++D RH   + D  +  
Sbjct: 70  -RFYLVDLPGYGFANVPRKVKEEWGRLIEGYLNNRPNLAGIVQIVDARHKPTRDDLMMVD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTT--AQETLEKTKYLIRNY 181
           ++    +   I  TK+DK+S  +   QE L K   ++ ++
Sbjct: 129 WIKASGIPCLIAATKVDKISRGSRKKQEELIKKTLVLEDF 168


>gi|255553339|ref|XP_002517711.1| GTP binding protein, putative [Ricinus communis]
 gi|223543109|gb|EEF44643.1| GTP binding protein, putative [Ricinus communis]
          Length = 489

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 95/158 (60%), Gaps = 10/158 (6%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
           PEIAF+GRSNVGKSSL+N L  +  +ARTS+ PG TQ +NFF         +  P + LV
Sbjct: 299 PEIAFAGRSNVGKSSLLNALTRQWGVARTSDKPGLTQTINFF---------SLGPKLCLV 349

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYG+A A ++  D+W  L+  Y+S R  L+ V LLID + G+K  D ++ + +++  
Sbjct: 350 DLPGYGFAYAKEEVKDAWEDLVKEYVSTRVGLKRVCLLIDTKWGMKPRDHELINLMERSQ 409

Query: 150 VSYQIVLTKIDKLSP-TTAQETLEKTKYLIRNYPTAHP 186
             YQIVLTK D + P   A+  ++  + L  N     P
Sbjct: 410 TKYQIVLTKTDVVFPIDVARRAMQIEESLKANKSIVQP 447


>gi|262377319|ref|ZP_06070543.1| GTPase EngB [Acinetobacter lwoffii SH145]
 gi|262307772|gb|EEY88911.1| GTPase EngB [Acinetobacter lwoffii SH145]
          Length = 315

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 109/199 (54%), Gaps = 9/199 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P++ L  +    EIAF+GRSN GKSS IN L N+K LAR S  PGRTQ +NFF  
Sbjct: 47  FLMSAPKLSLCVEDTGYEIAFAGRSNAGKSSAINALTNQKQLARASKKPGRTQMINFF-- 104

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
               +L N  P   LVD+PGYGYA  P+K    W   +  YL  R +L+ + LL+D RH 
Sbjct: 105 ----SLGN--PDQRLVDLPGYGYAAVPEKMKLVWQKELENYLIHRQSLQGLVLLMDIRHP 158

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           ++  D  +  +   + +   ++LTK DKL+   A + L++ K  ++        +   SS
Sbjct: 159 LQHFDVMMLEWAYSRQLFVHVLLTKSDKLNRGPASKALQEVKAALKKMKLDFS-IQLFSS 217

Query: 194 VKRKGIEVLRKAILETINY 212
           + ++G+E L   +   +N+
Sbjct: 218 MNKQGLEELASVMGGRLNF 236


>gi|332978063|gb|EGK14801.1| ribosome biogenesis GTP-binding protein YsxC [Desmospora sp. 8437]
          Length = 200

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 91/155 (58%), Gaps = 9/155 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PEIA +GRSNVGKSSLIN L++RKNLARTS+ PG+TQ +NF+             
Sbjct: 19  PADALPEIALAGRSNVGKSSLINRLIHRKNLARTSSKPGKTQTINFYRING--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+   DMPGYG+A+ PK    +WG +I  YLS R  LR V  +ID RH   + D  ++ +
Sbjct: 70  ALFFADMPGYGFAKVPKSVKAAWGRMIEGYLSNRDELRGVIQVIDVRHPPTRDDVAMYEW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIR 179
           L    +   IV TK DK+     Q+ L++ +  +R
Sbjct: 130 LKHYRMPTMIVATKADKIPRGRWQKHLKQVREGLR 164


>gi|238797622|ref|ZP_04641118.1| GTP-binding protein engB [Yersinia mollaretii ATCC 43969]
 gi|238718486|gb|EEQ10306.1| GTP-binding protein engB [Yersinia mollaretii ATCC 43969]
          Length = 207

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 107/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    E+AF+GRSN GKSS +N L N+K LARTS  PGRTQ +N F  
Sbjct: 4   FVISAPDIRHLPRDEGIEVAFAGRSNAGKSSALNTLTNQKGLARTSKTPGRTQLINLFEV 63

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + LVD+PGYGYA  P++    W   +  YL +R+ L+ + +L+D RH 
Sbjct: 64  VD---------GVRLVDLPGYGYAEVPEEMKIKWQRALGEYLQKRNCLKGLVVLMDIRHP 114

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ + ++         ++LTK DKL+    +  L   +  I  +     +V   SS
Sbjct: 115 LKDLDQQMITWAVAVGTPVLLLLTKADKLASGARKAQLNMVREAIIPF-MGDIQVEAFSS 173

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 174 LKKIGVDKLREKL 186


>gi|162420510|ref|YP_001604665.1| ribosome biogenesis GTP-binding protein YsxC [Yersinia pestis
           Angola]
 gi|238687242|sp|A9QYI0|ENGB_YERPG RecName: Full=Probable GTP-binding protein EngB
 gi|162353325|gb|ABX87273.1| putative GTP-binding protein EngB [Yersinia pestis Angola]
          Length = 216

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 107/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    E+AF+GRSN GKSS +N L N+K LARTS  PGRTQ +N F  
Sbjct: 13  FVISAPDIRHLPRDEGIEVAFAGRSNAGKSSALNTLTNQKGLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + LVD+PGYGYA  P++    W   +  YL +R+ L+ + +L+D RH 
Sbjct: 73  VD---------GVRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ + ++         ++LTK DKL+    +  L   +  I  +     +V   SS
Sbjct: 124 LKDLDQQMITWAVAVGTPVLLLLTKADKLASGACKAQLNLVREAIIPF-MGDIQVEAFSS 182

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 183 LKKIGVDKLREKL 195


>gi|293393656|ref|ZP_06637966.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291423991|gb|EFE97210.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 267

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 105/193 (54%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 64  FVTSAPDIRHLPADAGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 123

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +D          + LVD+PGYGYA  P++    W   +  YL  R+ L+ + +L+D RH 
Sbjct: 124 ED---------GIRLVDLPGYGYAEVPEEMKRKWQRALGEYLQMRNCLKGLVVLMDIRHP 174

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ +  +         ++LTK DKL+    +  +   +  +  +     +V P SS
Sbjct: 175 LKDLDQQMIQWAVDVGTPVLVLLTKADKLASGARKAQVNMVREAVLAF-MGDIQVEPFSS 233

Query: 194 VKRKGIEVLRKAI 206
            K+ G++ L + +
Sbjct: 234 PKKIGVDKLSQKL 246


>gi|167769426|ref|ZP_02441479.1| hypothetical protein ANACOL_00756 [Anaerotruncus colihominis DSM
           17241]
 gi|167668394|gb|EDS12524.1| hypothetical protein ANACOL_00756 [Anaerotruncus colihominis DSM
           17241]
          Length = 202

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/186 (38%), Positives = 98/186 (52%), Gaps = 14/186 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP +  PEIAF+GRSNVGKSS+IN L NRK LAR S  PG+T  +NFF            
Sbjct: 18  LPPSELPEIAFAGRSNVGKSSMINKLFNRKQLARVSAVPGKTATINFF----------RA 67

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             +   D+PGYGYA+  K     W  LI  Y  +   LR V+ LID RH     D  + +
Sbjct: 68  DGLRFADLPGYGYAKVSKGEKRRWSELISGYFEQDRDLRLVFQLIDMRHAPTAGDLTMIN 127

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEV-IPTSSVKRKGIEVL 202
           ++  + + + +VLTK DKLS T   +   +   L    P A   V IP SS   +G++ +
Sbjct: 128 YMIDREIPFVVVLTKADKLSKT---QRAVRLAALETELPCADQIVTIPFSSETGEGVDAV 184

Query: 203 RKAILE 208
           R  + +
Sbjct: 185 RDVVAQ 190


>gi|12644641|sp|Q9JY03|ENGB_NEIMB RecName: Full=Probable GTP-binding protein EngB
 gi|316984404|gb|EFV63377.1| putative GTPase [Neisseria meningitidis H44/76]
 gi|325200868|gb|ADY96323.1| GTP-binding protein [Neisseria meningitidis H44/76]
          Length = 209

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 104/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   +  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 9   FFTTINHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL +R  L  + L++D RH 
Sbjct: 66  ----ELQN---GNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLQQRKQLIGLVLIMDARHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT-AHPEVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y    +  V   S
Sbjct: 119 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFS 178

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GI+   + +
Sbjct: 179 SLKKQGIDEANRTV 192


>gi|52426052|ref|YP_089189.1| GTPase EngB [Mannheimia succiniciproducens MBEL55E]
 gi|81609396|sp|Q65R06|ENGB_MANSM RecName: Full=Probable GTP-binding protein EngB
 gi|52308104|gb|AAU38604.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 205

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 86/152 (56%), Gaps = 9/152 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+     I  LPK    EIAF+GRSN GKS+ +N L N+KNLARTS  PGRTQ +N F  
Sbjct: 13  FMTSAANIHQLPKDEGMEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL  R  L+ V +L+D RH 
Sbjct: 73  E---------PQYKLVDLPGYGYAAVPEQMKLQWQKSLGEYLQHRECLKGVVILMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPT 165
           +K +DQ +  +     +   ++LTK DKLS +
Sbjct: 124 LKDLDQQMIEWAVSSDLPVLLLLTKADKLSQS 155


>gi|238785636|ref|ZP_04629614.1| GTP-binding protein engB [Yersinia bercovieri ATCC 43970]
 gi|238713471|gb|EEQ05505.1| GTP-binding protein engB [Yersinia bercovieri ATCC 43970]
          Length = 208

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 4   FVISAPDIRHLPRDEGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEV 63

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + LVD+PGYGYA  P++    W   +  YL +R+ L+ + +L+D RH 
Sbjct: 64  VD---------GVRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHP 114

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ + ++         ++LTK DKL+    +  L   +  I  +     +V   SS
Sbjct: 115 LKDLDQQMITWAVAVGTPVLLLLTKADKLASGARKAQLNMVREAIIPF-MGDIQVEAFSS 173

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 174 LKKIGVDKLREKL 186


>gi|306833688|ref|ZP_07466815.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus bovis
           ATCC 700338]
 gi|304424458|gb|EFM27597.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus bovis
           ATCC 700338]
          Length = 213

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 100/188 (53%), Gaps = 15/188 (7%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN L+ RKNLARTS+ PG+TQ LNF+   D         
Sbjct: 39  PQDDLPEIALAGRSNVGKSSFINTLLGRKNLARTSSKPGKTQLLNFYNIDD--------- 89

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  K     WG +I  YL  R  LR V  L+D RH     D  ++ F
Sbjct: 90  KLRFVDVPGYGYAKVSKSERAKWGKMIEEYLVSRDNLRAVVSLVDLRHEPSADDVQMYDF 149

Query: 145 LDKKAVSYQIVLTKIDKL--SPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L    +   +V TK DK+        E+  K K    N+  +   +I  SSV R G++  
Sbjct: 150 LKYYEIPVIVVATKADKIPRGKWNKHESAIKKKL---NFNKSDKFII-FSSVDRTGLDES 205

Query: 203 RKAILETI 210
             +IL+ +
Sbjct: 206 WDSILDEL 213


>gi|260914707|ref|ZP_05921172.1| ribosome biogenesis GTP-binding protein YsxC [Pasteurella dagmatis
           ATCC 43325]
 gi|260631211|gb|EEX49397.1| ribosome biogenesis GTP-binding protein YsxC [Pasteurella dagmatis
           ATCC 43325]
          Length = 205

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 88/153 (57%), Gaps = 9/153 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P I +LP+    EIAF+GRSN GKS+ +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 13  FLTSAPNIRVLPEDSGIEIAFAGRSNAGKSTALNALTNQKSLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  L  V +L+D RH 
Sbjct: 73  E---------PKCKLVDLPGYGYAAVPEQMKIQWQKSLGEYLQKRECLAGVVVLMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTT 166
           +K +DQ +  +     +   I+LTK DKLS + 
Sbjct: 124 LKDLDQQMVEWAISADLPVLILLTKADKLSQSA 156


>gi|163787480|ref|ZP_02181927.1| GTP-binding protein [Flavobacteriales bacterium ALC-1]
 gi|159877368|gb|EDP71425.1| GTP-binding protein [Flavobacteriales bacterium ALC-1]
          Length = 204

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 101/188 (53%), Gaps = 11/188 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    E+   PK   PE AF GRSNVGKSSLIN+L +RK+LA+TS  PG+TQ +N F+ 
Sbjct: 8   FVVSNSEVAKCPKDSLPEYAFIGRSNVGKSSLINMLTDRKSLAKTSGRPGKTQLINHFII 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +         +  LVD+PGYGYAR  K +   +   I  Y  +R  L   ++L+D RH 
Sbjct: 68  NE---------SWYLVDLPGYGYARVSKSSKKKFQKFITNYFEKRQQLISAFVLVDIRHK 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEK-TKYLIRNYPTAHPEVIPTS 192
            + ID +   +L +  + + I+ TK DKL P      +    + L++ +    P+   TS
Sbjct: 119 PQPIDLEFMQYLGESGIPFGIIFTKADKLKPMAIDRHVNNYCEELLKTWEEV-PQYFVTS 177

Query: 193 SVKRKGIE 200
           S K  G E
Sbjct: 178 SSKHIGKE 185


>gi|15677644|ref|NP_274803.1| GTPase EngB [Neisseria meningitidis MC58]
 gi|7227060|gb|AAF42143.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|325139627|gb|EGC62166.1| GTP-binding protein [Neisseria meningitidis CU385]
          Length = 211

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 104/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   +  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 11  FFTTINHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL +R  L  + L++D RH 
Sbjct: 68  ----ELQN---GNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLQQRKQLIGLVLIMDARHP 120

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT-AHPEVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y    +  V   S
Sbjct: 121 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFS 180

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GI+   + +
Sbjct: 181 SLKKQGIDEANRTV 194


>gi|254515981|ref|ZP_05128041.1| GTP-binding protein EngB [gamma proteobacterium NOR5-3]
 gi|219675703|gb|EED32069.1| GTP-binding protein EngB [gamma proteobacterium NOR5-3]
          Length = 231

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 94/174 (54%), Gaps = 11/174 (6%)

Query: 2   VSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNA 61
           +S  ++ K+   FL    ++   P     E+AF+GRSN GKSS IN L     LARTS  
Sbjct: 17  ISKPVYRKAE--FLTSAAKVSQCPDDSGWEVAFAGRSNAGKSSAINSLTQNHKLARTSKT 74

Query: 62  PGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTL 121
           PGRTQ +NFF   +            +VD+PGYGYA+ P+K    W   +  YL ER +L
Sbjct: 75  PGRTQLINFFTVGE---------QQRIVDLPGYGYAKVPQKLKQDWTRQMEAYLQERQSL 125

Query: 122 RCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK 175
           R + LL DCRH ++  D  +  +  +  +   ++LTK DKLS    ++TL K +
Sbjct: 126 RGLILLSDCRHPLQPFDLQMLGWAAEAEMPVHMLLTKCDKLSNGAGKQTLLKVR 179


>gi|255076201|ref|XP_002501775.1| predicted protein [Micromonas sp. RCC299]
 gi|226517039|gb|ACO63033.1| predicted protein [Micromonas sp. RCC299]
          Length = 430

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 105/174 (60%), Gaps = 17/174 (9%)

Query: 9   KSAWIFLRGVPEIGLLPKAGP--PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ 66
           K A  F+        LP+A    PE+AF+GRSNVGKSSLIN  V     AR+S+ PG+TQ
Sbjct: 203 KKATKFVAAATTENDLPEADDDIPEVAFAGRSNVGKSSLINA-VTCSGAARSSDVPGKTQ 261

Query: 67  HLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYL 126
            LNF+   D S        + ++DMPGYG+A A ++ V++W  L+ +YL+ R  L+ VY+
Sbjct: 262 SLNFY---DVSR------RIRIIDMPGYGFAFAAQEKVEAWNRLMDKYLTGRKNLKRVYV 312

Query: 127 LIDCRHGVKQIDQDVFSFLDKKA-VSYQIVLTKIDKLSPTTAQETLEKTKYLIR 179
           ++D RHG+K  D+++ +FL +   V+Y +VL K D + P      L +  +LIR
Sbjct: 313 VVDARHGLKAPDREMLAFLSRYGNVAYSVVLNKTDLVRPA----DLARRCFLIR 362


>gi|257784166|ref|YP_003179383.1| small GTP-binding protein [Atopobium parvulum DSM 20469]
 gi|257472673|gb|ACV50792.1| small GTP-binding protein [Atopobium parvulum DSM 20469]
          Length = 194

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 99/186 (53%), Gaps = 13/186 (6%)

Query: 21  IGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK 80
           I  LP    PE+AF GRSNVGKSSL+N L+ RK LAR S+ PG+T ++NFF         
Sbjct: 17  ISQLPSPETPEVAFVGRSNVGKSSLLNKLIGRKQLARVSSVPGKTANINFF--------- 67

Query: 81  NNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQD 140
            ++  +  VD+PGYG+AR  ++    W  LI  Y  +  +   V  L+D RH  +++D  
Sbjct: 68  -DVDGVKFVDLPGYGFARVSRQEKQRWADLIGGYFEQERSFNLVISLVDIRHEAQKLDLQ 126

Query: 141 VFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
           + +FL +  + + +  TK DK++     +       L + +     + I TSS    GI+
Sbjct: 127 MINFLQEAELPFVVAFTKADKIARGKQNQA---AAALRKAFHITPEQTIITSSETGLGID 183

Query: 201 VLRKAI 206
            LR+ I
Sbjct: 184 ELRRRI 189


>gi|172058153|ref|YP_001814613.1| ribosome biogenesis GTP-binding protein YsxC [Exiguobacterium
           sibiricum 255-15]
 gi|229807534|sp|B1YJV8|ENGB_EXIS2 RecName: Full=Probable GTP-binding protein EngB
 gi|171990674|gb|ACB61596.1| small GTP-binding protein [Exiguobacterium sibiricum 255-15]
          Length = 193

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 98/177 (55%), Gaps = 11/177 (6%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
           PE+A +GRSNVGKSS IN LV RK LARTS+ PG+TQ LNFF   D          +  V
Sbjct: 24  PEVALAGRSNVGKSSFINKLVQRKALARTSSKPGKTQTLNFFNIND---------EVMFV 74

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYGYA+  K   ++WG ++ +Y + R  L+ V LL+D RH     D  ++ FL    
Sbjct: 75  DVPGYGYAKVSKTEREAWGKMMEKYFTTREILKGVVLLVDIRHEPSADDVIMYDFLKYYD 134

Query: 150 VSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAI 206
           +S  +V TK+DK+      + +   K  ++         IP SS   +G++   +AI
Sbjct: 135 LSVIVVATKLDKIKRGQRDKQIAAIKRKLQF--DGQDTFIPFSSETGEGVDAAWEAI 189


>gi|170016866|ref|YP_001727785.1| GTPase [Leuconostoc citreum KM20]
 gi|238688953|sp|B1MXT9|ENGB_LEUCK RecName: Full=Probable GTP-binding protein EngB
 gi|169803723|gb|ACA82341.1| Predicted GTPase [Leuconostoc citreum KM20]
          Length = 194

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/141 (44%), Positives = 87/141 (61%), Gaps = 9/141 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA  GRSNVGKSSL N L+ RKN ARTS+ PG+TQ LNF+      +++N L 
Sbjct: 19  PTDGKPEIALVGRSNVGKSSLTNTLIQRKNFARTSSQPGKTQTLNFY------DVENQL- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  KK  +++G +I  Y++ R  LR V  L+D RH   + D  ++ +
Sbjct: 72  --YFVDVPGYGYAKVSKKQREAFGNMIEEYITSRKQLRGVISLVDARHDPSEDDVAMYEW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPT 165
           L    +   +V TK DK+S +
Sbjct: 130 LHYYNIPILVVATKSDKISKS 150


>gi|270291412|ref|ZP_06197634.1| ribosome biogenesis GTP-binding protein YsxC [Pediococcus
           acidilactici 7_4]
 gi|304385125|ref|ZP_07367471.1| ribosome biogenesis GTP-binding protein YsxC [Pediococcus
           acidilactici DSM 20284]
 gi|270280258|gb|EFA26094.1| ribosome biogenesis GTP-binding protein YsxC [Pediococcus
           acidilactici 7_4]
 gi|304329319|gb|EFL96539.1| ribosome biogenesis GTP-binding protein YsxC [Pediococcus
           acidilactici DSM 20284]
          Length = 195

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 85/139 (61%), Gaps = 9/139 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G PEIA  GRSNVGKSSL N L+NRK+ ARTS+ PG+TQ LNF+  +D         
Sbjct: 19  PEQGYPEIALVGRSNVGKSSLTNTLINRKSYARTSSQPGKTQTLNFYRVED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  +K  + WG +I +YL+ R  L+ V  L+D RH     D  ++ +
Sbjct: 70  QLFFVDVPGYGYAKVSQKEREKWGRMIEKYLTSRKELKGVISLVDARHDPTDDDISMYQY 129

Query: 145 LDKKAVSYQIVLTKIDKLS 163
           L    +   +V TK DK++
Sbjct: 130 LRYYDIPVLVVATKSDKIA 148


>gi|323140765|ref|ZP_08075684.1| ribosome biogenesis GTP-binding protein YsxC [Phascolarctobacterium
           sp. YIT 12067]
 gi|322414783|gb|EFY05583.1| ribosome biogenesis GTP-binding protein YsxC [Phascolarctobacterium
           sp. YIT 12067]
          Length = 216

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 97/188 (51%), Gaps = 9/188 (4%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFV--PKDFSNLKNN 82
           P+    E AF GRSNVGKSSLIN L  R  LAR S+ PG+TQ +NF+    K     ++ 
Sbjct: 24  PQPALIEAAFIGRSNVGKSSLINSLCRRNGLARVSSTPGKTQTINFYELEAKRVVEGEDE 83

Query: 83  LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVF 142
             +  LVD+PGYG+A+    N D W G I +YLS    L  V  LID RH     D + F
Sbjct: 84  RASFYLVDLPGYGFAKTNHNNKDQWSGFISKYLSGSENLGVVCQLIDIRHKPMDSDMECF 143

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           ++L    +  Q+VLTK DKLS   A   + +     R       E+I  SS +      +
Sbjct: 144 NWLRSCGLKVQVVLTKSDKLSKNAA---MSQKALFKREMGLKEHEIITYSSSQH----TM 196

Query: 203 RKAILETI 210
           R  ++E I
Sbjct: 197 RGELIERI 204


>gi|312110030|ref|YP_003988346.1| ribosome biogenesis GTP-binding protein YsxC [Geobacillus sp.
           Y4.1MC1]
 gi|311215131|gb|ADP73735.1| ribosome biogenesis GTP-binding protein YsxC [Geobacillus sp.
           Y4.1MC1]
          Length = 193

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 84/133 (63%), Gaps = 9/133 (6%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
           PE A +GRSNVGKSS IN ++NRKNLARTS+ PG+TQ LNF++  +         ++  V
Sbjct: 24  PEFALAGRSNVGKSSFINKMINRKNLARTSSKPGKTQTLNFYLINE---------SLYFV 74

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYG+A+  KK  ++WG ++  Y + R  LR V L++D RH   + D  ++ FL    
Sbjct: 75  DVPGYGFAKVSKKEREAWGKMMGTYFTTREQLRAVVLIVDLRHPPTKDDVMMYEFLKHYE 134

Query: 150 VSYQIVLTKIDKL 162
           +   IV TK DK+
Sbjct: 135 IPAIIVATKADKV 147


>gi|289207228|ref|YP_003459294.1| ribosome biogenesis GTP-binding protein YsxC [Thioalkalivibrio sp.
           K90mix]
 gi|288942859|gb|ADC70558.1| ribosome biogenesis GTP-binding protein YsxC [Thioalkalivibrio sp.
           K90mix]
          Length = 203

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 104/199 (52%), Gaps = 10/199 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFF-V 72
           F++GV ++  LP+    EIAF+GRSN GKSS +N L  RK LAR    PGRTQ +N F +
Sbjct: 10  FIKGVAQVEQLPEDDGIEIAFAGRSNAGKSSALNALCGRKALARVGRTPGRTQEINLFAL 69

Query: 73  PKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRH 132
           P D         A  LVD+PGYGYA+        W  L+  YL  R  L  + L++D R 
Sbjct: 70  PPD--------EAWRLVDLPGYGYAKVSAGQRQHWDRLLGDYLQSRECLAGLVLIMDIRR 121

Query: 133 GVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTS 192
            + ++D+ +  ++  +      +LTK DKLS   A + L  T+  +         +   S
Sbjct: 122 PLTELDRQLLEWVPLERCQLHCLLTKADKLSRQAADKQLHATQRELEGLGI-EATLQTFS 180

Query: 193 SVKRKGIEVLRKAILETIN 211
           S+K +G++ LR  + E + 
Sbjct: 181 SLKNQGVDDLRGLLTEWLQ 199


>gi|268319666|ref|YP_003293322.1| Probable GTP-binding protein EngB [Lactobacillus johnsonii FI9785]
 gi|262398041|emb|CAX67055.1| Probable GTP-binding protein EngB [Lactobacillus johnsonii FI9785]
          Length = 194

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 101/176 (57%), Gaps = 10/176 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PE A +GRSNVGKSSLIN +VNR+ LARTS  PG+TQ LNF+       + N L 
Sbjct: 19  PKDDLPEFALAGRSNVGKSSLINTIVNRRKLARTSQQPGKTQTLNFY------KVNNEL- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  KK   ++G +I  YL  R+ L+ + LL+D RH     D ++F++
Sbjct: 72  --YLVDVPGYGYAKVSKKQRAAFGEMIQDYLETRADLKGLILLVDARHNPTADDINMFNY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
                +   +V TK+DKL    A +  +K    + +    +   +P SSV +  ++
Sbjct: 130 ALYLDIPILVVATKMDKLKKMEASQIKQKISKSL-DLSQENVSFLPFSSVSKLNVD 184


>gi|238790751|ref|ZP_04634511.1| GTP-binding protein engB [Yersinia frederiksenii ATCC 33641]
 gi|238721149|gb|EEQ12829.1| GTP-binding protein engB [Yersinia frederiksenii ATCC 33641]
          Length = 207

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 108/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    E+AF+GRSN GKSS +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 4   FVISAPDIRHLPRDEGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLF-- 61

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                    +  + LVD+PGYGYA  P++    W   +  YL +R+ L+ + +L+D RH 
Sbjct: 62  -------EVVEGVRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHP 114

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ + ++         ++LTK DKL+    +  L   +  I  +     +V   SS
Sbjct: 115 LKDLDQQMITWAVAVGTPVLLLLTKADKLASGARKAQLNMVREAIIPF-MGDIQVEAFSS 173

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 174 LKKIGVDKLREKL 186


>gi|319892718|ref|YP_004149593.1| GTP-binding protein EngB [Staphylococcus pseudintermedius HKU10-03]
 gi|317162414|gb|ADV05957.1| GTP-binding protein EngB [Staphylococcus pseudintermedius HKU10-03]
          Length = 198

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 105/182 (57%), Gaps = 11/182 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A SGRSNVGKS+ IN +V RKN+ARTS  PG+TQ LNFF      N+ N L 
Sbjct: 21  PELDLPEVALSGRSNVGKSTFINSMVGRKNMARTSQQPGKTQTLNFF------NIDNQL- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  KK  +++G +I  Y++ R  L+ V  L+D RH   + D  ++ F
Sbjct: 74  --IFVDVPGYGYAKVSKKQREAFGKMIETYITTREALKLVIQLVDLRHPPTEDDVLMYDF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   I+ TK DK+     Q+ ++  K  +     +  ++I  SS+++K  + +  
Sbjct: 132 LKYYDIPTLIIATKEDKIPKGKVQKHIKIIKEKLE--LESGDQIISYSSIEKKKQDQIWA 189

Query: 205 AI 206
           AI
Sbjct: 190 AI 191


>gi|238025963|ref|YP_002910194.1| ribosome biogenesis GTP-binding protein YsxC [Burkholderia glumae
           BGR1]
 gi|237875157|gb|ACR27490.1| Probable GTP-binding protein eng [Burkholderia glumae BGR1]
          Length = 219

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/181 (39%), Positives = 95/181 (52%), Gaps = 9/181 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PEIAF+GRSN GKS+ INIL N+K LA  S  PGRTQH+N+     FS      
Sbjct: 20  LPPTVIPEIAFAGRSNAGKSTAINILCNQKRLAFASKTPGRTQHINY-----FSVGPEAE 74

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P   LVD+PGYGYA  P      W  L+  YL  R  LR + L++D R  + ++DQ +  
Sbjct: 75  PVANLVDLPGYGYAEVPGAAKAHWEALLSAYLKTRPQLRGMILMMDSRRPLTELDQRMIE 134

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE----VIPTSSVKRKGI 199
           +          +LTK DKL+   +   L  TK  +  Y  A  E    V   S++KR G+
Sbjct: 135 WFAPTGKPIHTLLTKCDKLTRQESVNALRNTKKALAAYRDAGYEGELTVQLFSALKRTGL 194

Query: 200 E 200
           +
Sbjct: 195 D 195


>gi|153005532|ref|YP_001379857.1| ribosome biogenesis GTP-binding protein YsxC [Anaeromyxobacter sp.
           Fw109-5]
 gi|166225939|sp|A7HDS7|ENGB_ANADF RecName: Full=Probable GTP-binding protein EngB
 gi|152029105|gb|ABS26873.1| GTP-binding protein HSR1-related [Anaeromyxobacter sp. Fw109-5]
          Length = 216

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 90/178 (50%), Gaps = 3/178 (1%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+AF GRSNVGKSS++N L  +K LAR S  PGRT+ L FF             
Sbjct: 21  PRGQTPELAFVGRSNVGKSSMLNALTRKKGLARVSATPGRTRALQFFDVAYRPTPAARPR 80

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +   D+PGYGYA+  ++  D W  +I  YL +R  LR V L++D RH     D D  +F
Sbjct: 81  HVRFCDLPGYGYAKVSREERDRWAAMIEDYLRDRDVLRAVVLIVDARHAPSDSDVDAAAF 140

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
           L        +  TK+DKL  T     L   +  +     A  E +P S+V+  G + L
Sbjct: 141 LRATGRRVLVAATKMDKLPKTRRGAALRAVEGAL---ALAKGEAVPFSAVEGTGTDAL 195


>gi|319790441|ref|YP_004152074.1| ribosome biogenesis GTP-binding protein YsxC [Thermovibrio
           ammonificans HB-1]
 gi|317114943|gb|ADU97433.1| ribosome biogenesis GTP-binding protein YsxC [Thermovibrio
           ammonificans HB-1]
          Length = 194

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 103/188 (54%), Gaps = 12/188 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP+    E+AF GRSNVGKSSL+N + N   LA+ S+ PG+T+ +NF++  D        
Sbjct: 18  LPQTPYNEVAFVGRSNVGKSSLLNAVANNFKLAKVSSQPGKTRSINFYLVND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYG+A+ P K    W  LI  YL  R  L+ V+LL+D + G  + D  +  
Sbjct: 70  -RFFLVDLPGYGFAKVPLKEQQRWRELIESYLKGRDRLKGVFLLVDSKVGPTEKDLQMKE 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +LD   + Y +V TK+D+L  +  +   E+ K   +       +VIP S+  R+G EVL 
Sbjct: 129 WLDFFGIPYTVVATKVDRLKASQRRNLEERIK---KALGGGDFKVIPFSAKTREGREVLL 185

Query: 204 KAILETIN 211
           + I   I 
Sbjct: 186 REIFNYIE 193


>gi|91786673|ref|YP_547625.1| ribosome biogenesis GTP-binding protein YsxC [Polaromonas sp.
           JS666]
 gi|119369230|sp|Q12FG5|ENGB_POLSJ RecName: Full=Probable GTP-binding protein EngB
 gi|91695898|gb|ABE42727.1| GTP-binding protein, HSR1-related protein [Polaromonas sp. JS666]
          Length = 245

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 101/190 (53%), Gaps = 13/190 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   PE+  LP+   PEIAF GRSN GKS+ IN L  +  LA  S  PGRTQ +N    
Sbjct: 32  FLTTAPELKHLPRLDVPEIAFVGRSNAGKSTCINTLTQQHRLAFASKTPGRTQSINL--- 88

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
             FS  K  +    L D+PGYGYA  PK+    W  ++  YL  R  L+ V LL D R G
Sbjct: 89  --FSLGKQGVTDAVLADLPGYGYAAVPKEAKYRWQQVMGNYLQTRDNLKAVVLLCDPRLG 146

Query: 134 VKQIDQ---DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIP 190
           + ++D+   DV     ++ + + ++LTK DKL+ T A + L      I        +V  
Sbjct: 147 LTELDEILLDVLRPRVEEGLKFLVLLTKSDKLNKTEAAKALS-----IVRLQAGGGDVKL 201

Query: 191 TSSVKRKGIE 200
            SS+KRKG+E
Sbjct: 202 FSSLKRKGVE 211


>gi|33151575|ref|NP_872928.1| GTPase EngB [Haemophilus ducreyi 35000HP]
 gi|71151867|sp|Q7VNY0|ENGB_HAEDU RecName: Full=Probable GTP-binding protein EngB
 gi|33147795|gb|AAP95317.1| conserved possible cell division GTP-binding protein [Haemophilus
           ducreyi 35000HP]
          Length = 210

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/157 (40%), Positives = 89/157 (56%), Gaps = 9/157 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P+I  LP+    EIAF+GRSN GKS+ +N L N+K+LARTS  PGRTQ +N F  
Sbjct: 15  FLTSAPDIRHLPEDNGIEIAFAGRSNAGKSTALNALTNQKSLARTSKTPGRTQLINLFEV 74

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           +         P   LVD+PGYGYA  P++    W   +  YL +R  L  + +L+D RH 
Sbjct: 75  E---------PQCKLVDLPGYGYAAVPEQMKLQWQKALGEYLQKRDCLAGIVILMDIRHP 125

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQET 170
           +K +DQ +  +     +   ++LTK DKLS     +T
Sbjct: 126 LKDLDQQMIEWAVSAQLPVLLLLTKADKLSQVARNKT 162


>gi|325298117|ref|YP_004258034.1| GTP-binding protein engB [Bacteroides salanitronis DSM 18170]
 gi|324317670|gb|ADY35561.1| GTP-binding protein engB [Bacteroides salanitronis DSM 18170]
          Length = 200

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/189 (37%), Positives = 107/189 (56%), Gaps = 13/189 (6%)

Query: 23  LLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNN 82
           + P+   PE AF GRSNVGKSSLIN+L N   LA TS+ PG+T  +N F       L NN
Sbjct: 17  MCPEGNLPEYAFIGRSNVGKSSLINMLTNHSKLAMTSSTPGKTLLINHF-------LINN 69

Query: 83  LPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVF 142
             +  LVD+PGYGYA+  KK ++    +I  Y+ ER  + C+++LID R   ++ID +  
Sbjct: 70  --SWYLVDLPGYGYAQRGKKVMEQIKNIIQHYVLERMQMTCLFVLIDSRLEPQKIDLEFI 127

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
            +L + +V + +V TK DK +    Q+ +E+    ++      P    TS+ K+ G    
Sbjct: 128 EWLGENSVPFALVFTKADKQNIVKTQQNVERFLNTLKEQWEELPAYFITSAEKKTG---- 183

Query: 203 RKAILETIN 211
           RK +L+ I+
Sbjct: 184 RKEVLDYID 192


>gi|160944173|ref|ZP_02091403.1| hypothetical protein FAEPRAM212_01680 [Faecalibacterium prausnitzii
           M21/2]
 gi|158444849|gb|EDP21853.1| hypothetical protein FAEPRAM212_01680 [Faecalibacterium prausnitzii
           M21/2]
 gi|295105079|emb|CBL02623.1| ribosome biogenesis GTP-binding protein YsxC/EngB [Faecalibacterium
           prausnitzii SL3/3]
          Length = 200

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 103/201 (51%), Gaps = 14/201 (6%)

Query: 6   IFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRT 65
           IF K+ +I   G+     LP++  PE++FSGRSNVGKSSLIN L +RKNLAR S+ PG+T
Sbjct: 2   IFNKADFIASYGIS--SQLPESDRPELSFSGRSNVGKSSLINKLCSRKNLARVSSTPGKT 59

Query: 66  QHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVY 125
             +NF+   D             VD+PGYGYA+    + + W  LI  Y         + 
Sbjct: 60  ATINFYSVDD----------CYFVDLPGYGYAKVSNADRERWDDLINSYFEAPRHHTLLV 109

Query: 126 LLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH 185
            L+DCRH     D  +  +L    + Y + LTK DKL  +   +T E  + + R  P   
Sbjct: 110 QLLDCRHAPSADDLQMLRYLHYHRIPYVVALTKADKLKKSQLAKTQEDFENICR--PYGC 167

Query: 186 PEVIPTSSVKRKGIEVLRKAI 206
            +V+ TS     GI  L+  +
Sbjct: 168 QKVVLTSGENGYGIPELQAVL 188


>gi|163815262|ref|ZP_02206639.1| hypothetical protein COPEUT_01422 [Coprococcus eutactus ATCC 27759]
 gi|158449457|gb|EDP26452.1| hypothetical protein COPEUT_01422 [Coprococcus eutactus ATCC 27759]
          Length = 206

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 102/175 (58%), Gaps = 11/175 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP    PEIAF+G+SNVGKSSLIN L+NRK+LARTS  PG+TQ +NF+         N  
Sbjct: 18  LPDNELPEIAFAGKSNVGKSSLINGLLNRKSLARTSAQPGKTQTINFY---------NIN 68

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             +  VD+PGYGYA+   +    WG +I  YL   + L+ V+LLID RH   + D  ++ 
Sbjct: 69  KELYFVDLPGYGYAKVSVEIRAKWGKMIENYLHTSAQLKKVFLLIDIRHVPSENDCLMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKG 198
           ++        I+ TK+DK+  +  Q+ L++ K  +   P     +IP S++ ++G
Sbjct: 129 WIVNNGYEPVIICTKLDKIKRSQVQKNLKQIKEKLGLVPGTR--MIPFSALTKQG 181


>gi|300774436|ref|ZP_07084299.1| ribosome biogenesis GTP-binding protein YsxC [Chryseobacterium
           gleum ATCC 35910]
 gi|300506251|gb|EFK37386.1| ribosome biogenesis GTP-binding protein YsxC [Chryseobacterium
           gleum ATCC 35910]
          Length = 217

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/185 (35%), Positives = 100/185 (54%), Gaps = 9/185 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++   +    P+   PE AF GRSNVGKSSLIN ++N K+LA+TS  PG+TQ +N F+ 
Sbjct: 18  FVKSSGKWQECPEPNIPEYAFIGRSNVGKSSLINAMMNHKDLAKTSQTPGKTQLINHFLV 77

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            L D+PGYGYA+  K     +  LI  Y+  R  L  +++L+D RH 
Sbjct: 78  NE---------NWYLTDLPGYGYAKVSKVQRKDFEKLITNYILNRRNLVNLFVLVDVRHT 128

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID +   +  +  + + IV TK DKL P    + +E  K  +       PE+  TS+
Sbjct: 129 PQKIDLEFIQWCGESGIPFSIVFTKADKLKPNAVIKNVEDYKAELHKTWEDLPELYITSA 188

Query: 194 VKRKG 198
            K++G
Sbjct: 189 EKKEG 193


>gi|254427895|ref|ZP_05041602.1| GTPase, putative [Alcanivorax sp. DG881]
 gi|196194064|gb|EDX89023.1| GTPase, putative [Alcanivorax sp. DG881]
          Length = 203

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/183 (37%), Positives = 100/183 (54%), Gaps = 16/183 (8%)

Query: 1   MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSN 60
           M+   +F +SA    +  P+ GL       E+AF+GRSN GKSS IN L +++ LARTS 
Sbjct: 9   MLHQALFLQSAQRLDQCPPDEGL-------EVAFAGRSNAGKSSAINRLTSQRTLARTSK 61

Query: 61  APGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST 120
            PGRTQ LNFF   +   L         VD+PGYGYA+  K   + W   +  YLSER  
Sbjct: 62  TPGRTQLLNFFQLDEERRL---------VDLPGYGYAKVAKSTRNEWQQHLDHYLSERQA 112

Query: 121 LRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180
           L  + L++D RH +K  D  +  +  +  +   I++TK DKL    A+ TL + K  +++
Sbjct: 113 LVGLVLMMDIRHPLKDFDLLMLEWSAQANMPIHILMTKADKLKFGAAKSTLLQVKKQLKD 172

Query: 181 YPT 183
           +P 
Sbjct: 173 HPA 175


>gi|257453676|ref|ZP_05618963.1| ribosome biogenesis GTP-binding protein YsxC [Enhydrobacter
           aerosaccus SK60]
 gi|257448910|gb|EEV23866.1| ribosome biogenesis GTP-binding protein YsxC [Enhydrobacter
           aerosaccus SK60]
          Length = 232

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 89/162 (54%), Gaps = 8/162 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P   L P     E+AF+GRSN GKSS IN L  ++ LAR+S  PGRTQ +NFF  
Sbjct: 28  FMLSAPTFKLCPADTGREVAFAGRSNAGKSSCINALTQQRQLARSSKTPGRTQMINFF-- 85

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +  NL   L     VD+PGYGYA  P+     W   + +YL  R +L  + LL D RH 
Sbjct: 86  -NMGNLDQRL-----VDLPGYGYAAVPEAMKKEWQSELEKYLISRKSLAGLVLLTDIRHP 139

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK 175
           +K  D+ +  +     +   ++LTK DKL    A+ TL++T+
Sbjct: 140 LKFFDEQMLHWAKDGELEVHVLLTKADKLKYGAAKNTLQQTR 181


>gi|163781961|ref|ZP_02176961.1| hypothetical protein HG1285_03723 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159883181|gb|EDP76685.1| hypothetical protein HG1285_03723 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 184

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 92/156 (58%), Gaps = 11/156 (7%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
            P    PE+ F GRSNVGKSSLIN++  R N+AR S  PGRT+ +N+F+  D        
Sbjct: 13  FPPPDKPEVVFVGRSNVGKSSLINMVTGR-NIARVSKEPGRTRTINYFLLND-------- 63

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSER-STLRCVYLLIDCRHGVKQIDQDVF 142
            ++ LVD+PGYG+AR PK+  D W  ++  Y   R   +R V+LLID   GV+++D+ + 
Sbjct: 64  -SVYLVDVPGYGFARVPKEEQDKWKRMMENYFKGRKENIRVVFLLIDAVAGVQKLDRQMI 122

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLI 178
            +L    + + +VLTK DK        TL++ K L+
Sbjct: 123 EWLQFVGLPFVVVLTKTDKAKQKELSRTLKQVKELV 158


>gi|21232826|ref|NP_638743.1| ribosome biogenesis GTP-binding protein YsxC [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66767103|ref|YP_241865.1| ribosome biogenesis GTP-binding protein YsxC [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|24418370|sp|Q8P5E4|ENGB_XANCP RecName: Full=Probable GTP-binding protein EngB
 gi|81306913|sp|Q4UYM8|ENGB_XANC8 RecName: Full=Probable GTP-binding protein EngB
 gi|21114651|gb|AAM42667.1| GTP-binding protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66572435|gb|AAY47845.1| GTP-binding protein [Xanthomonas campestris pv. campestris str.
           8004]
          Length = 207

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 94/180 (52%), Gaps = 9/180 (5%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP  G  E+AF+GRSN GKSS +N L  + +LAR S  PGRTQ L FF  +         
Sbjct: 20  LPDDGGYEVAFAGRSNAGKSSALNALTRQNSLARVSKTPGRTQQLVFFQIQ--------- 70

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P   LVD+PGYGYA+ P+     W   I RY   R  LR + +++D RH +K  D  +  
Sbjct: 71  PERYLVDLPGYGYAKVPQDLQAHWQAFIDRYFRTREALRGLVVVMDIRHPLKDYDLQMLG 130

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +  ++ +    +LTK DKL      +TL+K K  + +       V   S   R+G++ LR
Sbjct: 131 YAAERGLPAHGLLTKADKLGRGQQMQTLQKVKKEVSSRFGDSVTVQTYSGESRQGVDELR 190


>gi|260887083|ref|ZP_05898346.1| ribosome biogenesis GTP-binding protein YsxC [Selenomonas sputigena
           ATCC 35185]
 gi|330839140|ref|YP_004413720.1| ribosome biogenesis GTP-binding protein YsxC [Selenomonas sputigena
           ATCC 35185]
 gi|260863145|gb|EEX77645.1| ribosome biogenesis GTP-binding protein YsxC [Selenomonas sputigena
           ATCC 35185]
 gi|329746904|gb|AEC00261.1| ribosome biogenesis GTP-binding protein YsxC [Selenomonas sputigena
           ATCC 35185]
          Length = 207

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 98/182 (53%), Gaps = 3/182 (1%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+    EI F GRSNVGKSSLIN L   KNLAR S  PG+TQ +NF+        ++   
Sbjct: 23  PEVRRREIVFIGRSNVGKSSLINSLARTKNLARVSGQPGKTQTINFYELGAKIEGEDERC 82

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYAR  KKN   W   I  YL +   L+ V  L+D RH     D ++F +
Sbjct: 83  DFYLVDLPGYGYARTAKKNRKIWSRFIEAYLLQSEDLQFVCQLMDIRHEPMASDIEMFQW 142

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L  K +   ++ TK DKLS    ++++   +   R    A  +++P SSVK +G   L  
Sbjct: 143 LVAKGLPVLVIATKADKLSRNEQKKSIAAMR---RALGVAELDILPYSSVKNEGRSELLD 199

Query: 205 AI 206
           AI
Sbjct: 200 AI 201


>gi|194097727|ref|YP_002000768.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria gonorrhoeae
           NCCP11945]
 gi|239998232|ref|ZP_04718156.1| GTPase EngB [Neisseria gonorrhoeae 35/02]
 gi|240013416|ref|ZP_04720329.1| GTPase EngB [Neisseria gonorrhoeae DGI18]
 gi|240015857|ref|ZP_04722397.1| GTPase EngB [Neisseria gonorrhoeae FA6140]
 gi|240079998|ref|ZP_04724541.1| GTPase EngB [Neisseria gonorrhoeae FA19]
 gi|240112205|ref|ZP_04726695.1| GTPase EngB [Neisseria gonorrhoeae MS11]
 gi|240114949|ref|ZP_04729011.1| GTPase EngB [Neisseria gonorrhoeae PID18]
 gi|240117235|ref|ZP_04731297.1| GTPase EngB [Neisseria gonorrhoeae PID1]
 gi|240120486|ref|ZP_04733448.1| GTPase EngB [Neisseria gonorrhoeae PID24-1]
 gi|240122787|ref|ZP_04735743.1| GTPase EngB [Neisseria gonorrhoeae PID332]
 gi|240124981|ref|ZP_04737867.1| GTPase EngB [Neisseria gonorrhoeae SK-92-679]
 gi|240127495|ref|ZP_04740156.1| GTPase EngB [Neisseria gonorrhoeae SK-93-1035]
 gi|254493010|ref|ZP_05106181.1| GTP-binding protein [Neisseria gonorrhoeae 1291]
 gi|260441235|ref|ZP_05795051.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria gonorrhoeae
           DGI2]
 gi|268598264|ref|ZP_06132431.1| GTPase EngB [Neisseria gonorrhoeae MS11]
 gi|268600615|ref|ZP_06134782.1| GTPase EngB [Neisseria gonorrhoeae PID18]
 gi|268602926|ref|ZP_06137093.1| GTPase EngB [Neisseria gonorrhoeae PID1]
 gi|268681399|ref|ZP_06148261.1| GTPase EngB [Neisseria gonorrhoeae PID332]
 gi|268683566|ref|ZP_06150428.1| GTPase EngB [Neisseria gonorrhoeae SK-92-679]
 gi|268685868|ref|ZP_06152730.1| GTPase EngB [Neisseria gonorrhoeae SK-93-1035]
 gi|119369221|sp|Q5FAC6|ENGB_NEIG1 RecName: Full=Probable GTP-binding protein EngB
 gi|238693222|sp|B4RQ29|ENGB_NEIG2 RecName: Full=Probable GTP-binding protein EngB
 gi|193933017|gb|ACF28841.1| GTP-binding protein [Neisseria gonorrhoeae NCCP11945]
 gi|226512050|gb|EEH61395.1| GTP-binding protein [Neisseria gonorrhoeae 1291]
 gi|268582395|gb|EEZ47071.1| GTPase EngB [Neisseria gonorrhoeae MS11]
 gi|268584746|gb|EEZ49422.1| GTPase EngB [Neisseria gonorrhoeae PID18]
 gi|268587057|gb|EEZ51733.1| GTPase EngB [Neisseria gonorrhoeae PID1]
 gi|268621683|gb|EEZ54083.1| GTPase EngB [Neisseria gonorrhoeae PID332]
 gi|268623850|gb|EEZ56250.1| GTPase EngB [Neisseria gonorrhoeae SK-92-679]
 gi|268626152|gb|EEZ58552.1| GTPase EngB [Neisseria gonorrhoeae SK-93-1035]
 gi|317163518|gb|ADV07059.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 209

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 102/194 (52%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 9   FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL  R  L  + L++D RH 
Sbjct: 66  ----ELQN---GNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLRHRKQLIGLVLIMDARHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP-EVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y       V   S
Sbjct: 119 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFS 178

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GI+   + +
Sbjct: 179 SLKKQGIDEANRTV 192


>gi|238750768|ref|ZP_04612266.1| GTP-binding protein engB [Yersinia rohdei ATCC 43380]
 gi|238710912|gb|EEQ03132.1| GTP-binding protein engB [Yersinia rohdei ATCC 43380]
          Length = 207

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 107/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    E+AF+GRSN GKSS +N L N+K LARTS  PGRTQ +N F  
Sbjct: 4   FVISAPDIRHLPRDEGIEVAFAGRSNAGKSSALNTLTNQKGLARTSKTPGRTQLINLF-- 61

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                    +  + LVD+PGYGYA  P++    W   +  YL +R+ L+ + +L+D RH 
Sbjct: 62  -------EVVEGVRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHP 114

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ + ++         ++LTK DKL+    +  L   +  I  +     +V   SS
Sbjct: 115 LKDLDQQMITWAVAVGTPVLLLLTKADKLASGARKAQLNMVREAIIPF-MGDIQVEAFSS 173

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 174 LKKIGVDKLREKL 186


>gi|227893378|ref|ZP_04011183.1| GTPase [Lactobacillus ultunensis DSM 16047]
 gi|227864793|gb|EEJ72214.1| GTPase [Lactobacillus ultunensis DSM 16047]
          Length = 196

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 105/188 (55%), Gaps = 12/188 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PEIA +GRSNVGKSSLIN L+ RKNLARTS+ PG+TQ LNF++  D         
Sbjct: 19  PKDNLPEIALAGRSNVGKSSLINTLLKRKNLARTSSQPGKTQTLNFYMVND--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  +K    +G +I  YL  R  L+ + +LID RH   + D  ++++
Sbjct: 70  DFYLVDVPGYGYAKVSQKKRQEFGEMIQDYLETRPNLKGLIILIDSRHEPTKDDIAMYNY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKY-LIRNYPTAHPEVIPTSSVKRKGIEVLR 203
                +   +V TK+DK+  +   + +   K  L  NY   H  V+  SSV +  +  L 
Sbjct: 130 AQYLNIPILVVCTKMDKIKKSQVNKVMSGLKSKLDLNYD--HVTVLTFSSVTKLHVAELG 187

Query: 204 KAILETIN 211
             I + I+
Sbjct: 188 DWIEDKIS 195


>gi|319651744|ref|ZP_08005870.1| GTP-binding protein [Bacillus sp. 2_A_57_CT2]
 gi|317396563|gb|EFV77275.1| GTP-binding protein [Bacillus sp. 2_A_57_CT2]
          Length = 193

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 91/151 (60%), Gaps = 9/151 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P++  PE A +GRSNVGKSS IN ++NR+ LAR S+ PG+TQ LNF++  +         
Sbjct: 19  PESELPEFALAGRSNVGKSSFINKMLNRRGLARISSKPGKTQTLNFYLINEI-------- 70

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  KK  ++WG +I  YL+ R  L+ V L++D RH     D  ++ F
Sbjct: 71  -LHFVDVPGYGYAKVSKKEREAWGKMIETYLTSREQLKAVVLIVDLRHPPSSDDVMMYDF 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTK 175
           L    +   ++ TK DK+  +  Q+ ++ TK
Sbjct: 130 LKHYDIPCVVIATKADKIPKSKWQKHMKITK 160


>gi|260771615|ref|ZP_05880535.1| GTP-binding protein EngB [Vibrio metschnikovii CIP 69.14]
 gi|260613392|gb|EEX38591.1| GTP-binding protein EngB [Vibrio metschnikovii CIP 69.14]
          Length = 218

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 94/162 (58%), Gaps = 9/162 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     EIAF+GRSN GKSS +N L N+K+LA+TS  PGRTQ +N F  
Sbjct: 12  FITSAPDIRHLPADDGIEIAFAGRSNAGKSSALNRLTNQKSLAKTSKTPGRTQLINLFKV 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            +VD+PGYG+A+ P +    W   +  YL +RS+L+ + +L+D RH 
Sbjct: 72  TD---------GCHIVDLPGYGFAQVPLEMKKKWQKSLGEYLQQRSSLKGLVVLMDIRHP 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTK 175
           +K +DQ +  +  + A+  Q++LTK DKL     +  L K +
Sbjct: 123 MKDLDQQLVLWAVECAIPVQVLLTKADKLKSGARKAQLNKIR 164


>gi|22127680|ref|NP_671103.1| ribosome biogenesis GTP-binding protein YsxC [Yersinia pestis KIM
           10]
 gi|45439885|ref|NP_991424.1| ribosome biogenesis GTP-binding protein YsxC [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51594377|ref|YP_068568.1| ribosome biogenesis GTP-binding protein YsxC [Yersinia
           pseudotuberculosis IP 32953]
 gi|108809514|ref|YP_653430.1| ribosome biogenesis GTP-binding protein YsxC [Yersinia pestis
           Antiqua]
 gi|108810412|ref|YP_646179.1| ribosome biogenesis GTP-binding protein YsxC [Yersinia pestis
           Nepal516]
 gi|145601125|ref|YP_001165201.1| ribosome biogenesis GTP-binding protein YsxC [Yersinia pestis
           Pestoides F]
 gi|150260917|ref|ZP_01917645.1| GTP-binding protein [Yersinia pestis CA88-4125]
 gi|153948718|ref|YP_001399023.1| ribosome biogenesis GTP-binding protein YsxC [Yersinia
           pseudotuberculosis IP 31758]
 gi|165926064|ref|ZP_02221896.1| putative GTP-binding protein EngB [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165940208|ref|ZP_02228738.1| putative GTP-binding protein EngB [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011511|ref|ZP_02232409.1| putative GTP-binding protein EngB [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166213756|ref|ZP_02239791.1| putative GTP-binding protein EngB [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167402124|ref|ZP_02307601.1| putative GTP-binding protein EngB [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167418997|ref|ZP_02310750.1| putative GTP-binding protein EngB [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167427046|ref|ZP_02318799.1| putative GTP-binding protein EngB [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170026401|ref|YP_001722906.1| ribosome biogenesis GTP-binding protein YsxC [Yersinia
           pseudotuberculosis YPIII]
 gi|186893364|ref|YP_001870476.1| ribosome biogenesis GTP-binding protein YsxC [Yersinia
           pseudotuberculosis PB1/+]
 gi|218927240|ref|YP_002345115.1| ribosome biogenesis GTP-binding protein YsxC [Yersinia pestis CO92]
 gi|229836128|ref|ZP_04456296.1| GTP-binding protein [Yersinia pestis Pestoides A]
 gi|229839867|ref|ZP_04460026.1| GTP-binding protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229841949|ref|ZP_04462104.1| GTP-binding protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229900594|ref|ZP_04515718.1| GTP-binding protein [Yersinia pestis Nepal516]
 gi|270488046|ref|ZP_06205120.1| ribosome biogenesis GTP-binding protein YsxC [Yersinia pestis KIM
           D27]
 gi|294502128|ref|YP_003566190.1| GTP-binding protein [Yersinia pestis Z176003]
 gi|24418384|sp|Q8ZJS0|ENGB_YERPE RecName: Full=Probable GTP-binding protein EngB
 gi|81640846|sp|Q66GG3|ENGB_YERPS RecName: Full=Probable GTP-binding protein EngB
 gi|119369282|sp|Q1C237|ENGB_YERPA RecName: Full=Probable GTP-binding protein EngB
 gi|119369283|sp|Q1CN51|ENGB_YERPN RecName: Full=Probable GTP-binding protein EngB
 gi|166232163|sp|A4TSG6|ENGB_YERPP RecName: Full=Probable GTP-binding protein EngB
 gi|166920115|sp|A7FCP5|ENGB_YERP3 RecName: Full=Probable GTP-binding protein EngB
 gi|238688493|sp|B1JR12|ENGB_YERPY RecName: Full=Probable GTP-binding protein EngB
 gi|238691333|sp|B2JYK5|ENGB_YERPB RecName: Full=Probable GTP-binding protein EngB
 gi|21960796|gb|AAM87354.1|AE013983_7 hypothetical protein y3809 [Yersinia pestis KIM 10]
 gi|45434740|gb|AAS60301.1| Predicted GTPases [Yersinia pestis biovar Microtus str. 91001]
 gi|51587659|emb|CAH19259.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108774060|gb|ABG16579.1| cell division checkpoint GTPase YihA [Yersinia pestis Nepal516]
 gi|108781427|gb|ABG15485.1| cell division checkpoint GTPase YihA [Yersinia pestis Antiqua]
 gi|115345851|emb|CAL18709.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145212821|gb|ABP42228.1| cell division checkpoint GTPase YihA [Yersinia pestis Pestoides F]
 gi|149290325|gb|EDM40402.1| GTP-binding protein [Yersinia pestis CA88-4125]
 gi|152960213|gb|ABS47674.1| putative GTP-binding protein EngB [Yersinia pseudotuberculosis IP
           31758]
 gi|165911840|gb|EDR30487.1| putative GTP-binding protein EngB [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921924|gb|EDR39101.1| putative GTP-binding protein EngB [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989657|gb|EDR41958.1| putative GTP-binding protein EngB [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166205158|gb|EDR49638.1| putative GTP-binding protein EngB [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166962991|gb|EDR59012.1| putative GTP-binding protein EngB [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167048499|gb|EDR59907.1| putative GTP-binding protein EngB [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167053973|gb|EDR63804.1| putative GTP-binding protein EngB [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169752935|gb|ACA70453.1| GTP-binding protein HSR1-related [Yersinia pseudotuberculosis
           YPIII]
 gi|186696390|gb|ACC87019.1| GTP-binding protein HSR1-related [Yersinia pseudotuberculosis
           PB1/+]
 gi|229681933|gb|EEO78025.1| GTP-binding protein [Yersinia pestis Nepal516]
 gi|229690259|gb|EEO82313.1| GTP-binding protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229696233|gb|EEO86280.1| GTP-binding protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229706576|gb|EEO92582.1| GTP-binding protein [Yersinia pestis Pestoides A]
 gi|262360206|gb|ACY56927.1| GTP-binding protein [Yersinia pestis D106004]
 gi|262364153|gb|ACY60710.1| GTP-binding protein [Yersinia pestis D182038]
 gi|270336550|gb|EFA47327.1| ribosome biogenesis GTP-binding protein YsxC [Yersinia pestis KIM
           D27]
 gi|294352587|gb|ADE62928.1| GTP-binding protein [Yersinia pestis Z176003]
 gi|320017069|gb|ADW00641.1| GTP-binding protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 216

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 107/193 (55%), Gaps = 10/193 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    E+AF+GRSN GKSS +N L N+K LARTS  PGRTQ +N F  
Sbjct: 13  FVISAPDIRHLPRDEGIEVAFAGRSNAGKSSALNTLTNQKGLARTSKTPGRTQLINLFEV 72

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D          + LVD+PGYGYA  P++    W   +  YL +R+ L+ + +L+D RH 
Sbjct: 73  VD---------GVRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHP 123

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +DQ + ++         ++LTK DKL+    +  L   +  I  +     +V   SS
Sbjct: 124 LKDLDQQMITWAVAVGTPVLLLLTKADKLASGARKAQLNLVREAIIPF-MGDIQVEAFSS 182

Query: 194 VKRKGIEVLRKAI 206
           +K+ G++ LR+ +
Sbjct: 183 LKKIGVDKLREKL 195


>gi|13124166|sp|O05132|ENGB_NEIGO RecName: Full=Probable GTP-binding protein EngB
          Length = 209

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 102/194 (52%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 9   FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL  R  L  + L++D RH 
Sbjct: 66  ----ELQN---GNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLRHRKELIGLVLIMDARHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP-EVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y       V   S
Sbjct: 119 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFS 178

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GI+   + +
Sbjct: 179 SLKKQGIDEANRTV 192


>gi|59800561|ref|YP_207273.1| GTPase EngB [Neisseria gonorrhoeae FA 1090]
 gi|268594088|ref|ZP_06128255.1| GTPase EngB [Neisseria gonorrhoeae 35/02]
 gi|268596140|ref|ZP_06130307.1| GTPase EngB [Neisseria gonorrhoeae FA19]
 gi|291044574|ref|ZP_06570283.1| GTPase EngB [Neisseria gonorrhoeae DGI2]
 gi|293397699|ref|ZP_06641905.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria gonorrhoeae
           F62]
 gi|59717456|gb|AAW88861.1| putative GTPase [Neisseria gonorrhoeae FA 1090]
 gi|268547477|gb|EEZ42895.1| GTPase EngB [Neisseria gonorrhoeae 35/02]
 gi|268549928|gb|EEZ44947.1| GTPase EngB [Neisseria gonorrhoeae FA19]
 gi|291011468|gb|EFE03464.1| GTPase EngB [Neisseria gonorrhoeae DGI2]
 gi|291611645|gb|EFF40714.1| ribosome biogenesis GTP-binding protein YsxC [Neisseria gonorrhoeae
           F62]
          Length = 211

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 103/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 11  FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL  R  L  + L++D RH 
Sbjct: 68  ----ELQN---GNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLRHRKQLIGLVLIMDARHP 120

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT-AHPEVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y    +  V   S
Sbjct: 121 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFS 180

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GI+   + +
Sbjct: 181 SLKKQGIDEANRTV 194


>gi|294461092|gb|ADE76113.1| unknown [Picea sitchensis]
          Length = 335

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 101/204 (49%), Gaps = 14/204 (6%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++    +   P  G PE A  GRSNVGKSSL+N LV RK LA TS  PG+TQ +N F  
Sbjct: 137 FIKSSSRVEECPMNGYPEFALVGRSNVGKSSLVNSLVRRKQLAMTSKKPGKTQLINHF-- 194

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L NN  +  LVD+PGYGYA AP+     W      Y   R  L CV LLID    
Sbjct: 195 -----LINN--SWYLVDLPGYGYAIAPRAVRTEWNAFTKDYFLNRKALVCVLLLIDASIP 247

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTA-----QETLEKTKYLIRNYPTAHPEV 188
            K+ID +  ++L +  +    V TK DK           +E +   + LIR +    P  
Sbjct: 248 AKEIDIECATWLGQNQIPMAFVFTKCDKRKKRKNGNKRPEENIYDFQNLIREFYQETPPW 307

Query: 189 IPTSSVKRKGIEVLRKAILETINY 212
           I TSSV  +G + L   I +  NY
Sbjct: 308 IMTSSVTNQGRDELLLHIAQLKNY 331


>gi|300173594|ref|YP_003772760.1| GTP-binding protein engB [Leuconostoc gasicomitatum LMG 18811]
 gi|299887973|emb|CBL91941.1| GTP-binding protein engB [Leuconostoc gasicomitatum LMG 18811]
          Length = 194

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/141 (44%), Positives = 83/141 (58%), Gaps = 9/141 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P  G PEIA  GRSNVGKSSL N L+ RKN ARTS+ PG+TQ LNF+  +D         
Sbjct: 19  PTDGKPEIALVGRSNVGKSSLTNTLIQRKNFARTSSQPGKTQTLNFYNVED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  KK  + +G +I  Y++ R  LR V  L+D RH     D  ++ +
Sbjct: 70  KLYFVDVPGYGYAKVSKKQREEFGHMIEEYITSRKQLRGVVSLVDARHEPSDDDVSMYEW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPT 165
           L    +   IV TK DK+S +
Sbjct: 130 LHYYNIPILIVATKSDKISKS 150


>gi|325847177|ref|ZP_08169976.1| ribosome biogenesis GTP-binding protein YsxC [Anaerococcus
           hydrogenalis ACS-025-V-Sch4]
 gi|325480957|gb|EGC84003.1| ribosome biogenesis GTP-binding protein YsxC [Anaerococcus
           hydrogenalis ACS-025-V-Sch4]
          Length = 195

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 86/142 (60%), Gaps = 9/142 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
            PK    EIAF+GRSNVGKSS IN  + +KNLA+TS+ PG+T+ +NF+   D        
Sbjct: 18  FPKDNFDEIAFAGRSNVGKSSFINSFLGKKNLAKTSSKPGKTKTINFYKIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYA+  KK  + W  LI  YL +R  L+ V+LL+D RH   + D++++ 
Sbjct: 70  -RFRLVDLPGYGYAKVSKKEKEKWNNLIHEYLYKRENLKEVFLLVDIRHAPTKQDKEMYE 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPT 165
           ++     +  ++ TK DK+  T
Sbjct: 129 WIVDSGFTGFVIATKYDKIPKT 150


>gi|145350092|ref|XP_001419457.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144579688|gb|ABO97750.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 416

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/151 (43%), Positives = 95/151 (62%), Gaps = 15/151 (9%)

Query: 30  PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALV 89
           PEIAF+GRSNVGKSSLIN L    ++AR+S+ PG+TQ LNF+   +          + LV
Sbjct: 107 PEIAFAGRSNVGKSSLINALT-LSSVARSSDVPGKTQSLNFYSMDE---------RIRLV 156

Query: 90  DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKA 149
           D+PGYG+A A +  V+SW  L+ +YL+ R  L+ VYL+ID RHG+K  D+++ +FL K  
Sbjct: 157 DLPGYGFAFAKQHRVESWNELMDKYLTSRPNLKRVYLVIDARHGMKASDREMLAFLSKYG 216

Query: 150 -VSYQIVLTKIDKLSPTTAQETLEKTKYLIR 179
                ++L K D ++P      L +  YLI+
Sbjct: 217 ETQCGVILNKCDYVNPN----ELARRAYLIQ 243


>gi|323464247|gb|ADX76400.1| GTP-binding protein EngB [Staphylococcus pseudintermedius ED99]
          Length = 198

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 105/182 (57%), Gaps = 11/182 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PE+A SGRSNVGKS+ IN ++ RKN+ARTS  PG+TQ LNFF      N+ N L 
Sbjct: 21  PELDLPEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGKTQTLNFF------NIDNQL- 73

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYGYA+  KK  +++G +I  Y++ R  L+ V  L+D RH   + D  ++ F
Sbjct: 74  --IFVDVPGYGYAKVSKKQREAFGKMIETYITTREALKLVIQLVDLRHPPTEDDVLMYDF 131

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   I+ TK DK+     Q+ ++  K  +     +  ++I  SS+++K  + +  
Sbjct: 132 LKYYDIPTLIIATKEDKIPKGKVQKHIKIIKEKLE--LESGDQIISYSSIEKKKQDQIWA 189

Query: 205 AI 206
           AI
Sbjct: 190 AI 191


>gi|1914833|gb|AAB52537.1| hypothetical GTPase [Neisseria gonorrhoeae]
          Length = 211

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 103/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 11  FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL  R  L  + L++D RH 
Sbjct: 68  ----ELQN---GNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLRHRKELIGLVLIMDARHP 120

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT-AHPEVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y    +  V   S
Sbjct: 121 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFS 180

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GI+   + +
Sbjct: 181 SLKKQGIDEANRTV 194


>gi|325204762|gb|ADZ00216.1| GTP-binding protein [Neisseria meningitidis M01-240355]
          Length = 221

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 103/194 (53%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP   P EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 9   FFTTVNHLKDLPDT-PLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L+N      +VD+PGYGYA+ P+     W  L+  YL  R  L  + L++D RH 
Sbjct: 66  ----ELQN---GNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLRHRKQLIGLVLIMDARHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPT-AHPEVIPTS 192
           +K++D  +  F         I+L+K DKLS     +TL + K L++ Y    +  V   S
Sbjct: 119 LKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFS 178

Query: 193 SVKRKGIEVLRKAI 206
           S+K++GI+   + +
Sbjct: 179 SLKKQGIDEANRTV 192


>gi|15615611|ref|NP_243915.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus halodurans
           C-125]
 gi|13124217|sp|Q9K8F7|ENGB_BACHD RecName: Full=Probable GTP-binding protein EngB
 gi|10175671|dbj|BAB06768.1| GTP-binding protein [Bacillus halodurans C-125]
          Length = 194

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 85/138 (61%), Gaps = 9/138 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P +  PE+A +GRSNVGKSS IN ++NRK LARTS  PG+TQ LNF+   D         
Sbjct: 19  PNSPLPEVALAGRSNVGKSSFINKMINRKKLARTSQRPGKTQTLNFYNINDI-------- 70

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYG+A+  KK+ ++WG +I  YL +R  L+ V  +ID RH   + DQ ++ +
Sbjct: 71  -LHFVDVPGYGFAKVSKKDREAWGRMIETYLQQRGQLKAVLQIIDIRHDPTKDDQLMYDW 129

Query: 145 LDKKAVSYQIVLTKIDKL 162
           L    +   I+ TK DK+
Sbjct: 130 LKHFEIPVIIIATKCDKI 147


>gi|198284769|ref|YP_002221090.1| ribosome biogenesis GTP-binding protein YsxC [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665631|ref|YP_002427454.1| ribosome biogenesis GTP-binding protein YsxC [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198249290|gb|ACH84883.1| GTP-binding protein HSR1-related [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218517844|gb|ACK78430.1| ribosome biogenesis GTP-binding protein YsxC [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 228

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 91/160 (56%), Gaps = 9/160 (5%)

Query: 18  VPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFS 77
           V + G LP     E+A +GRSNVGKSS +N+L  R+ LAR S  PGRTQ +N F   D  
Sbjct: 23  VTQAGQLPADDGAEVAIAGRSNVGKSSTLNMLTERRALARVSRTPGRTQAINIF---DLD 79

Query: 78  NLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQI 137
                 P   LVD+PGYGYA+ P+    SWG L+ +YL  R +LR + L++D RH     
Sbjct: 80  ------PGQRLVDLPGYGYAKVPEALRRSWGPLLEQYLRRRGSLRGLILVMDIRHPYTAH 133

Query: 138 DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYL 177
           D D+ +F +  +    ++L K DKLS   A + + + + +
Sbjct: 134 DADLIAFAEGCSRPVHVLLNKADKLSRGAAIQEMARLRRI 173


>gi|294669759|ref|ZP_06734825.1| hypothetical protein NEIELOOT_01659 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308325|gb|EFE49568.1| hypothetical protein NEIELOOT_01659 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 210

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 100/194 (51%), Gaps = 11/194 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP  G  EIAF GRSN GKSS IN L N   LA  S  PGRTQH+NFF  
Sbjct: 9   FFTTVNHLKDLPDTGA-EIAFVGRSNAGKSSAINTLCNHVRLAYVSKTPGRTQHINFF-- 65

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            + +N         +VD+PGYGYA  P+     W  L+  YL  R  L  + L++DCRH 
Sbjct: 66  -ELAN------GHFMVDLPGYGYAAVPEAVRQHWVTLLGDYLQTRRQLIGLVLIMDCRHP 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHP-EVIPTS 192
           +K +D  +  F  K      I+L+K DKLS     +TL   K  ++ +       V   S
Sbjct: 119 LKPLDIQMLDFFAKTGRPVHILLSKADKLSKNEQIKTLSSVKKALKPFSERQDVSVQLFS 178

Query: 193 SVKRKGIEVLRKAI 206
           S+K++G+E +   +
Sbjct: 179 SLKKQGMEEVENVV 192


>gi|288817817|ref|YP_003432164.1| putative GTP-binding protein [Hydrogenobacter thermophilus TK-6]
 gi|288787216|dbj|BAI68963.1| putative GTP-binding protein [Hydrogenobacter thermophilus TK-6]
 gi|308751415|gb|ADO44898.1| ribosome biogenesis GTP-binding protein YsxC [Hydrogenobacter
           thermophilus TK-6]
          Length = 186

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 109/189 (57%), Gaps = 17/189 (8%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LPK    E+ F GRSNVGKSSLIN+LV  + +AR S  PGRT+ +N F+ +         
Sbjct: 13  LPKDHFKEVVFVGRSNVGKSSLINMLVG-EPVARVSKEPGRTRSINAFLLEG-------- 63

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSER-STLRCVYLLIDCRHGVKQIDQDVF 142
             + LVD+PGYG+A+  K   +SW  LI  Y  ER   +RCV++LID + G   +D+ + 
Sbjct: 64  -RIKLVDVPGYGFAKVSKAERESWKRLIESYFRERRQNIRCVFVLIDSKVGPTDLDKLMI 122

Query: 143 SFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVL 202
            +L    + Y++VLTK DK S     ++LE  K +  N      EVI TS+ + KG + L
Sbjct: 123 EWLRHINIPYKVVLTKTDKASQKELSKSLELLKVVGVN------EVIITSAKEGKGKKEL 176

Query: 203 RKAILETIN 211
            ++ILE + 
Sbjct: 177 YRSILEVVE 185


>gi|227514778|ref|ZP_03944827.1| GTPase [Lactobacillus fermentum ATCC 14931]
 gi|260663640|ref|ZP_05864529.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           fermentum 28-3-CHN]
 gi|227086887|gb|EEI22199.1| GTPase [Lactobacillus fermentum ATCC 14931]
 gi|260551866|gb|EEX24981.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           fermentum 28-3-CHN]
          Length = 197

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 101/184 (54%), Gaps = 11/184 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PE+A  GRSNVGKSSL N+L+NRKN A TS+ PG+TQ LNF+  +          
Sbjct: 19  PATALPELALVGRSNVGKSSLTNVLINRKNYAHTSSQPGKTQTLNFYEVEH--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  KK  + +G +I  YL+ R  LR V  L+D RH   + D+ +F +
Sbjct: 70  KLYFVDVPGYGYAKVSKKQREKFGKMIENYLTTREQLRGVVQLVDGRHAPTEDDRMMFQW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   +V TK+DK+ P      ++  K  +        ++I  S+  +KG E + +
Sbjct: 130 LAYYHIPTLVVATKVDKVKPNAHNRIVKVVKEGLG--AAKDQDLILFSATTKKGAESVWQ 187

Query: 205 AILE 208
            I E
Sbjct: 188 WIEE 191


>gi|42518938|ref|NP_964868.1| GTPase EngB [Lactobacillus johnsonii NCC 533]
 gi|38606910|gb|AAR25449.1| GTP binding protein [Lactobacillus johnsonii]
 gi|41583225|gb|AAS08834.1| probable GTP-binding protein EngB [Lactobacillus johnsonii NCC 533]
 gi|329667518|gb|AEB93466.1| putative GTP-binding protein [Lactobacillus johnsonii DPC 6026]
          Length = 194

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 101/176 (57%), Gaps = 10/176 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PE A +GRSNVGKSSLIN +VNR+ LARTS  PG+TQ LNF+       + N L 
Sbjct: 19  PKDDLPEFALAGRSNVGKSSLINTIVNRRKLARTSQQPGKTQTLNFY------KVNNEL- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  KK   ++G +I  YL  R+ L+ + LL+D RH     D ++F++
Sbjct: 72  --YLVDVPGYGYAKVSKKQRAAFGEMIQDYLETRADLKGLILLVDARHNPTADDINMFNY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
                +   +V TK+DKL    A +  +K    + +    +   +P SSV +  ++
Sbjct: 130 ALYLDIPILVVATKMDKLKKMEASQIKQKIGKSL-DLSQENVSFLPFSSVSKLNVD 184


>gi|330718623|ref|ZP_08313223.1| GTP-binding protein YsxC [Leuconostoc fallax KCTC 3537]
          Length = 162

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 85/139 (61%), Gaps = 9/139 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PEIA  GRSNVGKSSL N L+NRK LARTS  PG+TQ LNF+  +D         
Sbjct: 19  PVTNLPEIALVGRSNVGKSSLTNTLINRKGLARTSAQPGKTQTLNFYNVED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
           A+  VD+PGYGYA+  KK  +++G +I  Y++ R+ LR V  L+D RH   + D  ++ +
Sbjct: 70  ALYFVDVPGYGYAKVSKKQREAFGEMIETYITSRAQLRGVVSLVDARHAPSEEDIMMYEW 129

Query: 145 LDKKAVSYQIVLTKIDKLS 163
           L    V   +V TK DK++
Sbjct: 130 LHYYKVPILVVATKADKIA 148


>gi|229543652|ref|ZP_04432712.1| small GTP-binding protein [Bacillus coagulans 36D1]
 gi|229328072|gb|EEN93747.1| small GTP-binding protein [Bacillus coagulans 36D1]
          Length = 194

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 107/193 (55%), Gaps = 25/193 (12%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+   PEIA +GRSNVGKSS IN ++NRK LARTS+ PG+TQ LNF+       ++N L 
Sbjct: 19  PEGHLPEIALAGRSNVGKSSFINKMINRKALARTSSKPGKTQTLNFY------KIENKL- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
               VD+PGYG+A+  KK  + WG +I  Y++ R  L+ V L++D RH     D  +++F
Sbjct: 72  --YFVDVPGYGFAKVSKKEREKWGRMIETYMTSRKQLKTVVLIVDVRHPPTNDDCLMYNF 129

Query: 145 LDKKAVSYQIVLTKIDKLSP-------TTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRK 197
           L    +   +V TK DK+          TA+ETL   K           E+I  SS   +
Sbjct: 130 LKYYKIPCIVVATKADKIPKGKWASHLKTAKETLNLEK---------EDEIILFSSETGE 180

Query: 198 GIEVLRKAILETI 210
           G + +  +++E I
Sbjct: 181 GKDKVWASLMERI 193


>gi|325916357|ref|ZP_08178632.1| cell division checkpoint GTPase YihA [Xanthomonas vesicatoria ATCC
           35937]
 gi|325537405|gb|EGD09126.1| cell division checkpoint GTPase YihA [Xanthomonas vesicatoria ATCC
           35937]
          Length = 207

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 94/180 (52%), Gaps = 9/180 (5%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP  G  E+AF+GRSN GKSS +N L  + +LAR S  PGRTQ L FF  +         
Sbjct: 20  LPDDGGYEVAFAGRSNAGKSSALNALTRQNSLARVSKTPGRTQQLVFFQIQ--------- 70

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P   LVD+PGYGYA+ P+     W   I RY   R  LR + +++D RH +K  D  +  
Sbjct: 71  PERYLVDLPGYGYAKVPQDLQAHWQAFIDRYFRTREALRGLVVVMDIRHPLKDYDLQMLG 130

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +  ++ +    +LTK DKL      +TL+K K  + +       V   S   R+G++ LR
Sbjct: 131 YAAERGLPAHGLLTKADKLGRGQQMQTLQKVKKEVTSRFGDSVTVQTYSGESRQGVDELR 190


>gi|227889796|ref|ZP_04007601.1| GTPase [Lactobacillus johnsonii ATCC 33200]
 gi|227849660|gb|EEJ59746.1| GTPase [Lactobacillus johnsonii ATCC 33200]
          Length = 194

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 101/176 (57%), Gaps = 10/176 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PE A +GRSNVGKSSLIN +VNR+ LARTS  PG+TQ LNF+       + N L 
Sbjct: 19  PKDDLPEFALAGRSNVGKSSLINTIVNRRKLARTSQQPGKTQTLNFY------KVNNEL- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  KK   ++G +I  YL  R+ L+ + LL+D RH     D ++F++
Sbjct: 72  --YLVDVPGYGYAKVSKKQRAAFGEMIQDYLETRADLKGLILLVDARHNPTADDINMFNY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIE 200
                +   +V TK+DKL    A +  +K    + +    +   +P SSV +  ++
Sbjct: 130 ALYLDIPILVVATKMDKLKKMEASQIKQKIGKSL-DLSQENVSFLPFSSVSKLNVD 184


>gi|325928435|ref|ZP_08189626.1| cell division checkpoint GTPase YihA [Xanthomonas perforans 91-118]
 gi|119369279|sp|Q3BXK1|ENGB_XANC5 RecName: Full=Probable GTP-binding protein EngB
 gi|325541152|gb|EGD12703.1| cell division checkpoint GTPase YihA [Xanthomonas perforans 91-118]
          Length = 207

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/183 (36%), Positives = 94/183 (51%), Gaps = 9/183 (4%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP  G  E+AF+GRSN GKSS +N L  +  LAR S  PGRTQ L FF  +         
Sbjct: 20  LPDDGGYEVAFAGRSNAGKSSALNALTRQNALARVSKTPGRTQQLVFFQIQ--------- 70

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P   LVD+PGYGYA+ P+     W   I RY   R  LR + +++D RH +K  D  +  
Sbjct: 71  PERYLVDLPGYGYAKVPQDLQAHWQAFIDRYFRTREALRGLVVVMDIRHPLKDYDLQMLG 130

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +  ++ +    +LTK DKL      +TL+K K  + +       V   S   R+G++ LR
Sbjct: 131 YAAERGLPAHGLLTKADKLGRGQQMQTLQKVKKEVTSRFGDSVTVQTYSGESRQGVDELR 190

Query: 204 KAI 206
             +
Sbjct: 191 AIV 193


>gi|91785434|ref|YP_560640.1| GTPase EngB [Burkholderia xenovorans LB400]
 gi|119368799|sp|Q13TK1|ENGB_BURXL RecName: Full=Probable GTP-binding protein EngB
 gi|91689388|gb|ABE32588.1| cell division checkpoint GTPase YihA [Burkholderia xenovorans
           LB400]
          Length = 217

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 98/191 (51%), Gaps = 9/191 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP    PEI F+GRSN GKS+ INIL N+K LA  S  PGRTQH+N+   
Sbjct: 10  FFTTVNHLQDLPATSQPEICFAGRSNAGKSTAINILCNQKRLAFASKTPGRTQHINY--- 66

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
             FS    + P   LVD+PGYGYA  P      W  L+  YL  RS LR + L++D R  
Sbjct: 67  --FSVGNADEPTAHLVDLPGYGYAEVPGAAKAHWEALLSAYLQSRSQLRGMILMMDSRRP 124

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA--HPEVIPT 191
           +  +D+ +  +          +LTK DKL+   +   L  T+  +  Y  A    E+   
Sbjct: 125 LTDLDRRMIEWFVPTGKPIHTLLTKCDKLTRQESVNALRATQKGLAEYRAAGYRGELTAQ 184

Query: 192 --SSVKRKGIE 200
             S++KR GI+
Sbjct: 185 LFSALKRIGID 195


>gi|300361499|ref|ZP_07057676.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus gasseri
           JV-V03]
 gi|300354118|gb|EFJ69989.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus gasseri
           JV-V03]
          Length = 194

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 90/149 (60%), Gaps = 9/149 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PE A +GRSNVGKSSLIN +VNR+ LARTS  PG+TQ LNF+       + N L 
Sbjct: 19  PKDDLPEFALAGRSNVGKSSLINTIVNRRKLARTSQQPGKTQTLNFY------KVNNEL- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  KK   ++G +I  YL  R+ L+ + LL+D RH     D ++F++
Sbjct: 72  --YLVDVPGYGYAKVSKKQRAAFGEMIQDYLETRADLKGLVLLVDARHDPTADDINMFNY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEK 173
                +   +V TK+DKL    A +  +K
Sbjct: 130 ALYLDIPILVVATKMDKLKKMEASQIKQK 158


>gi|116492901|ref|YP_804636.1| ribosome biogenesis GTP-binding protein YsxC [Pediococcus
           pentosaceus ATCC 25745]
 gi|122265635|sp|Q03F28|ENGB_PEDPA RecName: Full=Probable GTP-binding protein EngB
 gi|116103051|gb|ABJ68194.1| Predicted GTPase [Pediococcus pentosaceus ATCC 25745]
          Length = 195

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 85/139 (61%), Gaps = 9/139 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P+ G PEIA  GRSNVGKSSL N L+NRK+ ARTS+ PG+TQ LNF+  +D         
Sbjct: 19  PEQGYPEIALVGRSNVGKSSLTNTLINRKSYARTSSQPGKTQTLNFYRVED--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  +K  + WG +I +Y++ R  L+ V  L+D RH     D  ++ +
Sbjct: 70  QLFFVDVPGYGYAKVSQKEREKWGKMIEKYITSRKELKGVISLVDARHEPTDDDITMYQY 129

Query: 145 LDKKAVSYQIVLTKIDKLS 163
           L    +   +V TK DK++
Sbjct: 130 LRYYDIPVLVVATKSDKIA 148


>gi|333030034|ref|ZP_08458095.1| GTP-binding protein engB [Bacteroides coprosuis DSM 18011]
 gi|332740631|gb|EGJ71113.1| GTP-binding protein engB [Bacteroides coprosuis DSM 18011]
          Length = 200

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 104/198 (52%), Gaps = 10/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+    E+   P  G PE AF GRSNVGKSSLIN+L NRK LA TS  PG+T  +N F+ 
Sbjct: 8   FVISNTEVKKCPTDGLPEYAFIGRSNVGKSSLINMLTNRKGLAMTSAKPGKTMLINHFLI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +            +VD+PGYGYA+  +K       +I  Y+ ER+ +  +++LIDCR  
Sbjct: 68  NE---------EWYIVDLPGYGYAKRNQKGQQQIKTIIEDYILERTAMTNLFVLIDCRLS 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            +QID +   +L +  + + IV TK DKL+       +E     ++      P    TSS
Sbjct: 119 PQQIDLEFIEWLGENNIPFSIVFTKGDKLTKNKLDSNVEAFLNELKKQWEELPPYFITSS 178

Query: 194 VKRKGIEVLRKAILETIN 211
            KR G + +   I E IN
Sbjct: 179 EKRMGRDEMLNYI-EQIN 195


>gi|184155097|ref|YP_001843437.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus
           fermentum IFO 3956]
 gi|238692961|sp|B2GBC5|ENGB_LACF3 RecName: Full=Probable GTP-binding protein EngB
 gi|183226441|dbj|BAG26957.1| GTP-binding protein [Lactobacillus fermentum IFO 3956]
          Length = 197

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 100/184 (54%), Gaps = 11/184 (5%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           P    PE+A  GRSNVGKSSL N+L+NRKN A TS  PG+TQ LNF+  +          
Sbjct: 19  PATALPELALVGRSNVGKSSLTNVLINRKNYAHTSGQPGKTQTLNFYEVEH--------- 69

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
            +  VD+PGYGYA+  KK  + +G +I  YL+ R  LR V  L+D RH   + D+ +F +
Sbjct: 70  KLYFVDVPGYGYAKVSKKQREKFGKMIENYLTTREQLRGVVQLVDGRHAPTEDDRMMFQW 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRK 204
           L    +   +V TK+DK+ P      ++  K  +        ++I  S+  +KG E + +
Sbjct: 130 LAYYHIPTLVVATKVDKVKPNAHNRIVKVVKEGLG--AAKDQDLILFSATTKKGAESVWQ 187

Query: 205 AILE 208
            I E
Sbjct: 188 WIEE 191


>gi|197333942|ref|YP_002154844.1| ribosome biogenesis GTP-binding protein YsxC [Vibrio fischeri MJ11]
 gi|238690290|sp|B5FFA6|ENGB_VIBFM RecName: Full=Probable GTP-binding protein EngB
 gi|197315432|gb|ACH64879.1| ribosome biogenesis GTP-binding protein YsxC [Vibrio fischeri MJ11]
          Length = 215

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 109/195 (55%), Gaps = 10/195 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP+    E+AF+GRSN GKSS +N L N+K+LA+TS  PGRTQ +N F  
Sbjct: 12  FITSAPDIRHLPEDEGIEVAFAGRSNAGKSSALNRLTNQKSLAKTSKTPGRTQLINLFKV 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
           ++  +         +VD+PGYG+A+ P +    W   +  YL +R  L+ + +L+D RH 
Sbjct: 72  EENCH---------IVDLPGYGFAQVPLEMKKKWQKSLGEYLQKRQCLQGLVVLMDIRHP 122

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K IDQ +  +   + +  QI+LTK DKL     +  + K +    ++     EV   SS
Sbjct: 123 LKDIDQQLVFWAVDQNIPVQILLTKADKLKSGARKAQVLKVREAAVDF-GGEVEVDAFSS 181

Query: 194 VKRKGIEVLRKAILE 208
           +K  G++ LR  + E
Sbjct: 182 LKGIGVDKLRAKLDE 196


>gi|83748180|ref|ZP_00945207.1| GTP-binding protein YihA [Ralstonia solanacearum UW551]
 gi|207721867|ref|YP_002252305.1| gtpase protein [Ralstonia solanacearum MolK2]
 gi|207744545|ref|YP_002260937.1| gtpase protein [Ralstonia solanacearum IPO1609]
 gi|83725148|gb|EAP72299.1| GTP-binding protein YihA [Ralstonia solanacearum UW551]
 gi|206587034|emb|CAQ17618.1| gtpase protein [Ralstonia solanacearum MolK2]
 gi|206595951|emb|CAQ62878.1| gtpase protein [Ralstonia solanacearum IPO1609]
          Length = 233

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 104/198 (52%), Gaps = 8/198 (4%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F   V  +  LP    PE+AF+GRSN GKS+ IN+L N+K LA +S  PGRTQH+N+F  
Sbjct: 9   FFTTVNHLRDLPATAVPEVAFAGRSNAGKSTAINVLCNQKRLAFSSKTPGRTQHINYFSV 68

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                L    P   LVD+PGYGYA  P +    W  L+  YL  R  L  + +++D R  
Sbjct: 69  MPAKALD---PLGFLVDLPGYGYAEVPGEAKSHWEHLLGDYLQTRPQLAGLIIMMDARRP 125

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA-HPEVIPT- 191
             ++D  +  +         ++LTK DKL+   A   L   + ++ +Y T    +V  T 
Sbjct: 126 FTELDCQMVEWFLSTGKPIHVLLTKADKLTNNDASRALMSARKVLADYRTQIEGDVSLTV 185

Query: 192 ---SSVKRKGIEVLRKAI 206
              SS+KR+GIE  ++ +
Sbjct: 186 QLFSSLKRRGIEEAQRTV 203


>gi|325922584|ref|ZP_08184338.1| cell division checkpoint GTPase YihA [Xanthomonas gardneri ATCC
           19865]
 gi|325546934|gb|EGD18034.1| cell division checkpoint GTPase YihA [Xanthomonas gardneri ATCC
           19865]
          Length = 207

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 93/180 (51%), Gaps = 9/180 (5%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
           LP  G  E+AF+GRSN GKSS +N L  +  LAR S  PGRTQ L FF  +         
Sbjct: 20  LPDDGGYEVAFAGRSNAGKSSALNALTRQNALARVSKTPGRTQQLVFFQIQ--------- 70

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
           P   LVD+PGYGYA+ P+     W   I RY   R  LR + +++D RH +K  D  +  
Sbjct: 71  PERCLVDLPGYGYAKVPQDLQAHWQAFIDRYFRTREALRGLVVVMDIRHPLKDYDLQMLG 130

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +  ++ +    +LTK DKL      +TL+K K  + +       V   S   R+G++ LR
Sbjct: 131 YAAERGLPAHGLLTKADKLGRGQQMQTLQKVKKEVTSRFGDSVTVQTYSGESRQGVDELR 190


>gi|256544471|ref|ZP_05471844.1| ribosome biogenesis GTP-binding protein YsxC [Anaerococcus
           vaginalis ATCC 51170]
 gi|256399796|gb|EEU13400.1| ribosome biogenesis GTP-binding protein YsxC [Anaerococcus
           vaginalis ATCC 51170]
          Length = 195

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 86/142 (60%), Gaps = 9/142 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
            P     EIAF+GRSNVGKSS IN  +++KNLA+TS+ PG+T+ +NF+   D        
Sbjct: 18  FPNDDFEEIAFAGRSNVGKSSFINSFLDKKNLAKTSSKPGKTKTINFYKIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
               LVD+PGYGYA+  K   + W  LI +YL ER  L+ V+LL+D RH   + D++++ 
Sbjct: 70  -KFRLVDLPGYGYAKVSKTEKEKWNNLIHKYLYERENLKEVFLLVDIRHAPTKQDKEMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPT 165
           ++     +  ++ TK DK+  T
Sbjct: 129 WIIDSGFTGFVIATKYDKIPKT 150


>gi|116629800|ref|YP_814972.1| GTPase EngB [Lactobacillus gasseri ATCC 33323]
 gi|238853431|ref|ZP_04643810.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus gasseri
           202-4]
 gi|282851696|ref|ZP_06261061.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus gasseri
           224-1]
 gi|311110559|ref|ZP_07711956.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus gasseri
           MV-22]
 gi|122273262|sp|Q042T8|ENGB_LACGA RecName: Full=Probable GTP-binding protein EngB
 gi|116095382|gb|ABJ60534.1| Predicted GTPase [Lactobacillus gasseri ATCC 33323]
 gi|238834003|gb|EEQ26261.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus gasseri
           202-4]
 gi|282557664|gb|EFB63261.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus gasseri
           224-1]
 gi|311065713|gb|EFQ46053.1| ribosome biogenesis GTP-binding protein YsxC [Lactobacillus gasseri
           MV-22]
          Length = 194

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 90/149 (60%), Gaps = 9/149 (6%)

Query: 25  PKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLP 84
           PK   PE A +GRSNVGKSSLIN +VNR+ LARTS  PG+TQ LNF+       + N L 
Sbjct: 19  PKDDLPEFALAGRSNVGKSSLINTIVNRRKLARTSQQPGKTQTLNFY------KVNNEL- 71

Query: 85  AMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSF 144
              LVD+PGYGYA+  KK   ++G +I  YL  R+ L+ + LL+D RH     D ++F++
Sbjct: 72  --YLVDVPGYGYAKVSKKQRAAFGEMIQDYLETRADLKGLILLVDARHDPTADDINMFNY 129

Query: 145 LDKKAVSYQIVLTKIDKLSPTTAQETLEK 173
                +   +V TK+DKL    A +  +K
Sbjct: 130 ALYLDIPILVVATKMDKLKKMEASQIKQK 158


>gi|284009009|emb|CBA75939.1| probable GTP-binding protein [Arsenophonus nasoniae]
          Length = 208

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 104/198 (52%), Gaps = 10/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F+   P+I  LP     EIAF+GRSN GKSS +N L  +KNLARTS  PGRTQ +N F  
Sbjct: 14  FVTSAPDIHHLPNDHGIEIAFAGRSNAGKSSALNALTQQKNLARTSKTPGRTQLINLFEV 73

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            +          + LVD+PGYGYA  P+     W   +  YL +R  L+ + +L+D RH 
Sbjct: 74  AE---------GIRLVDLPGYGYAEVPESVKRQWQQALSEYLQKRKCLKGLIILMDIRHP 124

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
           +K +D  +  +     +   I+LTK DKL P   +  L      ++     + +V   SS
Sbjct: 125 LKDMDIQMIEWSVAMNIPILILLTKADKLVPNKRKTQLIAVHNKLKTV-AGNIQVETFSS 183

Query: 194 VKRKGIEVLRKAILETIN 211
           +K+ GI+ L+  + E  N
Sbjct: 184 LKKMGIDKLQLKLDEWFN 201


>gi|308070420|ref|YP_003872025.1| GTP-binding protein engB [Paenibacillus polymyxa E681]
 gi|305859699|gb|ADM71487.1| Probable GTP-binding protein engB [Paenibacillus polymyxa E681]
          Length = 203

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 73/183 (39%), Positives = 99/183 (54%), Gaps = 11/183 (6%)

Query: 24  LPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNL 83
            P    PEIA +GRSNVGKSSLIN L+NRKNLARTS+ PG+TQ LN++   D        
Sbjct: 18  FPVDALPEIALAGRSNVGKSSLINRLINRKNLARTSSTPGKTQQLNYYRIND-------- 69

Query: 84  PAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFS 143
             +  VD PGYGYA+  K +  +WG +I  YL ER  L+ V  ++D RH   + D  ++ 
Sbjct: 70  -DLYFVDFPGYGYAKVSKTSRKAWGQMIESYLLEREPLKLVLQMVDLRHPPSKDDIMMYD 128

Query: 144 FLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLR 203
           +L    +   +V TK DK+  T  ++  +  K  +   P      IP SS +  G E L 
Sbjct: 129 WLRHNGLPVCVVGTKADKIPKTRREKHYKVIKQELGILPGGL--FIPFSSEEGMGKEELW 186

Query: 204 KAI 206
             I
Sbjct: 187 SVI 189


>gi|284125883|ref|ZP_06386995.1| GTP-binding protein engB [Candidatus Poribacteria sp. WGA-A3]
 gi|283829177|gb|EFC33603.1| GTP-binding protein engB [Candidatus Poribacteria sp. WGA-A3]
          Length = 209

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 91/150 (60%), Gaps = 4/150 (2%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           F++   +    P    PE+AF GRSNVGKSS IN L+NRK++A+ S  PG+TQ LNFF  
Sbjct: 12  FVKSCMKPAHYPHERLPEVAFVGRSNVGKSSAINSLLNRKSIAKVSTTPGKTQTLNFFRV 71

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
                +   +PA+  VD+PGYGYA+A K   + WG +I RYLS+R+ L  V  L+D R G
Sbjct: 72  LTSDKV---VPAIFFVDLPGYGYAKAAKSVREQWGPMIERYLSQRAQLCAVVQLVDAR-G 127

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLS 163
           ++  D     +L        +V+TKIDKLS
Sbjct: 128 LEAHDVTTLEWLTHLGHRPIVVVTKIDKLS 157


>gi|282877547|ref|ZP_06286364.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella buccalis
           ATCC 35310]
 gi|281300332|gb|EFA92684.1| ribosome biogenesis GTP-binding protein YsxC [Prevotella buccalis
           ATCC 35310]
          Length = 199

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 105/198 (53%), Gaps = 10/198 (5%)

Query: 14  FLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVP 73
           FL   P I   PK    E AF GRSNVGKSSLIN+L N K L++TS+ PG+T  +N F+ 
Sbjct: 8   FLISSPTIDKCPKDNRIEYAFIGRSNVGKSSLINMLCNHKGLSKTSSTPGKTLLINHFLI 67

Query: 74  KDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHG 133
            D            LVD+PGYG+A+  KK       +I  Y+ +R  L  +++LID RH 
Sbjct: 68  ND---------EWYLVDLPGYGFAKRSKKVQADIEKMINTYILQREQLVNLFVLIDVRHE 118

Query: 134 VKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEVIPTSS 193
            ++ID+    +L +  + + IV TK DKL    A+    +    +R+     P    TSS
Sbjct: 119 QQKIDRAFIDWLGENEIPFTIVFTKADKLGTVKAKANAAQWMEQLRDAWEELPPYFITSS 178

Query: 194 VKRKGIEVLRKAILETIN 21