RPSBLAST alignment for GI: 254780484 and conserved domain: cd00881

>gnl|CDD|133257 cd00881, GTP_translation_factor, GTP translation factor family. This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation. In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function. Length = 189
 Score = 37.3 bits (87), Expect = 0.003
 Identities = 26/134 (19%), Positives = 54/134 (40%), Gaps = 24/134 (17%)

Query: 88  LVDMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDK 147
            +D PG+          D +   ++R LS         L++D   GV+   ++      +
Sbjct: 66  FIDTPGH---------ED-FSSEVIRGLS---VSDGAILVVDANEGVQPQTREHLRIARE 112

Query: 148 KAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPE-----------VIPTSSVKR 196
             +   + + KID++     +E L + K L+        +           ++P S++  
Sbjct: 113 GGLPIIVAINKIDRVGEEDLEEVLREIKELLGLIGFISTKEEGTRNGLLVPIVPGSALTG 172

Query: 197 KGIEVLRKAILETI 210
            G+E L +AI+E +
Sbjct: 173 IGVEELLEAIVEHL 186