RPSBLAST alignment for GI: 254780484 and conserved domain: pfam01926

>gnl|CDD|145217 pfam01926, MMR_HSR1, GTPase of unknown function. Length = 106
 Score = 72.7 bits (179), Expect = 6e-14
 Identities = 30/118 (25%), Positives = 49/118 (41%), Gaps = 12/118 (10%)

Query: 41  GKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAP 100
           GKS+LIN L  +K  A  S+ PG T+  N         ++ +   + LVD PG     + 
Sbjct: 1   GKSTLINALTGKKR-AIVSDYPGTTRDPNEGR------VELDGKQIILVDTPGIIEGASK 53

Query: 101 KKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTK 158
            +     G L  R L        +  ++D   G+ + D ++   L +      +VL K
Sbjct: 54  GE-----GELGNRTLEAIEEADLILHVVDASEGLTEEDLEILDLLLELGKPVILVLNK 106