BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780484|ref|YP_003064897.1| GTPase EngB [Candidatus Liberibacter asiaticus str. psy62] (212 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780484|ref|YP_003064897.1| GTPase EngB [Candidatus Liberibacter asiaticus str. psy62] Length = 212 Score = 437 bits (1124), Expect = e-125, Method: Compositional matrix adjust. Identities = 212/212 (100%), Positives = 212/212 (100%) Query: 1 MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSN 60 MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSN Sbjct: 1 MVSHTIFTKSAWIFLRGVPEIGLLPKAGPPEIAFSGRSNVGKSSLINILVNRKNLARTSN 60 Query: 61 APGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST 120 APGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST Sbjct: 61 APGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGGLIVRYLSERST 120 Query: 121 LRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180 LRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN Sbjct: 121 LRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRN 180 Query: 181 YPTAHPEVIPTSSVKRKGIEVLRKAILETINY 212 YPTAHPEVIPTSSVKRKGIEVLRKAILETINY Sbjct: 181 YPTAHPEVIPTSSVKRKGIEVLRKAILETINY 212 >gi|255764471|ref|YP_003064835.2| GTP-binding protein EngA [Candidatus Liberibacter asiaticus str. psy62] Length = 470 Score = 41.6 bits (96), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 41/134 (30%), Positives = 60/134 (44%), Gaps = 21/134 (15%) Query: 32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDM 91 IA G NVGKS+L N LV +K +A N PG T+ + + N +VD Sbjct: 5 IAIVGAPNVGKSTLFNRLVKKK-MAVVGNHPGITRD------RLYGQAIINGVIFNIVDT 57 Query: 92 PGYGYARAPKKNVDSWGGLIVRYLSERSTL-----RCVYLLIDCRHGVKQIDQDVFSFLD 146 G A KN I + +++++ L + LID + G+ D + SFL Sbjct: 58 AGI----ADGKNCS-----IAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLR 108 Query: 147 KKAVSYQIVLTKID 160 KK + IV K+D Sbjct: 109 KKNIPIIIVSNKMD 122 Score = 28.5 bits (62), Expect = 0.098, Method: Compositional matrix adjust. Identities = 16/35 (45%), Positives = 20/35 (57%) Query: 27 AGPPEIAFSGRSNVGKSSLINILVNRKNLARTSNA 61 + P IA GR NVGKS+LIN L+ L S + Sbjct: 201 SKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQS 235 >gi|254780941|ref|YP_003065354.1| GTP-binding protein Era [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 34.7 bits (78), Expect = 0.001, Method: Compositional matrix adjust. Identities = 38/150 (25%), Positives = 65/150 (43%), Gaps = 18/150 (12%) Query: 32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDM 91 +A G +N GKS+L+N V A+ S + Q V S ++ + +D Sbjct: 25 VALVGATNAGKSTLVNRFVG----AKVSIVTHKVQTTRSIVRGIVSEKESQI---VFLDT 77 Query: 92 PGYGYARAPKKNVDSWGGLIVRYLSERSTLR---CVYLLIDCRHGVKQIDQDVFSFLDKK 148 PG A+ DS+ L++R ST++ V L++D +K D+ + K+ Sbjct: 78 PGIFNAK------DSYHKLMIRL--SWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKR 129 Query: 149 AVSYQIVLTKIDKLSPTTAQETLEKTKYLI 178 + ++L KID + P E E L+ Sbjct: 130 SSRLILILNKIDCVKPERLLEQAEIANKLV 159 >gi|254780809|ref|YP_003065222.1| tRNA modification GTPase TrmE [Candidatus Liberibacter asiaticus str. psy62] Length = 440 Score = 30.4 bits (67), Expect = 0.025, Method: Compositional matrix adjust. Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query: 32 IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQ 66 I G SN GKSSL N L +K++A ++ PG T+ Sbjct: 222 IVILGHSNAGKSSLFNALA-KKDVAIVTDIPGTTR 255 >gi|254780134|ref|YP_003064547.1| phage-related integrase/recombinase [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 23.5 bits (49), Expect = 2.9, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Query: 119 STLRCVYLLIDCRHGVKQIDQDVFSFLDKK 148 S LRC CR GV+ + ++FS +K Sbjct: 202 SGLRCS---DSCRAGVQHLQNNIFSIKTQK 228 >gi|254780448|ref|YP_003064861.1| hypothetical protein CLIBASIA_01665 [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 23.5 bits (49), Expect = 3.2, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 17 GVPEIGLLPKAGPPEIAFSGRSN 39 G+ G+L + PPE+ FS N Sbjct: 289 GIKAEGILSRNAPPELHFSSYVN 311 >gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Score = 21.9 bits (45), Expect = 9.8, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Query: 5 TIFTKSAWIFLRGVP---EIGLLPKAGPPEIAFSGRSNVGKSSLINILV 50 T+F + + +G P I L K+G A G S GKS++IN+L+ Sbjct: 353 TVFRDVFFSYKQGHPVLSGINLCFKSGKMT-ALVGPSGSGKSTIINLLM 400 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.136 0.399 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 136,945 Number of Sequences: 1233 Number of extensions: 5553 Number of successful extensions: 15 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 9 length of query: 212 length of database: 328,796 effective HSP length: 70 effective length of query: 142 effective length of database: 242,486 effective search space: 34433012 effective search space used: 34433012 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 36 (18.5 bits)