>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism. In bacteria, formation of pyridoxine 5'-phosphate is a step in the biosynthesis of vitamin B6. PNP synthase, a homooctameric enzyme, catalyzes the final step in PNP biosynthesis, the condensation of 1-amino-acetone 3-phosphate and 1-deoxy-D-xylulose 5-phosphate. PNP synthase adopts a TIM barrel topology, intersubunit contacts are mediated by three ''extra'' helices, generating a tetramer of symmetric dimers with shared active sites; the open state has been proposed to accept substrates and to release products, while most of the catalytic events are likely to occur in the closed state; a hydrophilic channel running through the center of the barrel was identified as the essential structural feature that enables PNP synthase to release water molecules produced during the reaction from the closed,

Probab=95.62 E-value=0.13 Score=30.57 Aligned_cols=117 Identities=14% Similarity=0.148 Sum_probs=75.3 Q ss_pred HHHHHHHHHHHHHCCCEEEEEE--------CCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHCCCCCE Q ss_conf 5799999999996498389973--------03688874428999998876213688324102569999999874157606 Q gi|254780485|r 90 VDQVLKEAKNAKENGATRYCMG--------AAWREPKERDLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDY 161 (328) Q Consensus 90 ~Eei~~~a~~~~~~G~~~~~l~--------~~~~~~~~~~~~~~~e~i~~i~~~~~~i~~~~g~~~~~~~~~Lk~aG~~~ 161 (328) T Consensus 72 ~~emi~ia~~~---kP~~vtLVPe~r~elTTegGld~~~~~~~L~~~i~~lk~~~IrvSLFI-DPd~~qi~~a~~~Gad~ 147 (234) T cd00003 72 TEEMLEIALEV---KPHQVTLVPEKREELTTEGGLDVAGQAEKLKPIIERLKDAGIRVSLFI-DPDPEQIEAAKEVGADR 147 (234) T ss_pred CHHHHHHHHHC---CCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE-CCCHHHHHHHHHHCCCE T ss_conf 38999999984---998789878887864178892665478899999999986598279972-79878999999849399 Q ss_pred EEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHH Q ss_conf 97513437777320588889899999999999879855770786689899999 Q gi|254780485|r 162 YNHNIDTSERFYPHVTTTHTFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDR 214 (328) Q Consensus 162 ~~~~let~~~~~~~~~~~~~~~~~l~~~~~a~~~G~~~~sg~l~G~gEt~eer 214 (328) T Consensus 148 VElhTG~Ya~a~~~~~~~~el~~i~~aa~~A~~lGL~VnA----GHgLn~~Nl 196 (234) T cd00003 148 VELHTGPYANAYDKAEREAELERIAKAAKLARELGLGVNA----GHGLNYENV 196 (234) T ss_pred EEEECHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCEEEC----CCCCCHHHH T ss_conf 9982478786348103999999999999999985987854----789887679

HHsearch alignment for GI: 254780485 and conserved domain: cd00003