>smart00876 BATS Biotin and Thiamin Synthesis associated domain. Biotin synthase (BioB), , catalyses the last step of the biotin biosynthetic pathway. The reaction consists in the introduction of a sulphur atom into dethiobiotin. BioB functions as a homodimer PUBMED:12482614. Thiamin synthesis if a complex process involving at least six gene products (ThiFSGH, ThiI and ThiJ). Two of the proteins required for the biosynthesis of the thiazole moiety of thiamine (vitamin B(1)) are ThiG and ThiH (this entry) and form a heterodimerPUBMED:12650933. Both of these reactions are thought of involve the binding of co-factors, and both function as dimers PUBMED:12482614, PUBMED:12650933. This domain therefore may be involved in co-factor binding or dimerisation.

Probab=99.76 E-value=2.7e-18 Score=142.31 Aligned_cols=93 Identities=45% Similarity=0.784 Sum_probs=85.4 Q ss_pred ECCCEEECCCCCCCCC-CCCCHHHHHHHHHHHHHHCCCCCCEEEEHHHHHCHHHHHHHHHHCCCEEEECCEEECCCCCCH Q ss_conf 0541120487412445-687989999999999996868721423115651656899999809988997786651588898 Q gi|254780485|r 232 PINLLIPIPGSKFEEN-KKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGDTLLTAKNPSY 310 (328) Q Consensus 232 ~~~~~~p~~gt~l~~~-~~~~~~e~lr~iAi~RL~lP~~~i~i~~~~~~~~~~~~~~~L~~GaN~~~~g~~~~t~~g~~~ 310 (328) T Consensus 1 pin~l~P~~Gtple~~~~~~~~~e~lk~ia~~Rl~~P~~~I~la~gr~~~~~~~~~~~l~aGan~~~~G~~~ltt~g~~~ 80 (94) T smart00876 1 PINRLRPIEGTPLEDPPPPVSPEEFLRTIAAARLALPDAGIRLSTGREALLRDLQALCFSAGANSIFGGDKYLTTSGPRS 80 (94) T ss_pred CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHCCCCHHCCCCCCCCCCCCH T ss_conf 96601368999778788999999999999999998699637973781200575899999834721404763307899587 Q ss_pred HHHHHHHHHCCCCC Q ss_conf 99999999829853 Q gi|254780485|r 311 NKDTILFNRLGLIP 324 (328) Q Consensus 311 ~~~~~~i~~~G~~P 324 (328) T Consensus 81 ~~d~~~i~~~G~~~ 94 (94) T smart00876 81 ADDVAMLEKLGLEP 94 (94) T ss_pred HHHHHHHHHCCCCC T ss_conf 89999999859999

HHsearch alignment for GI: 254780485 and conserved domain: smart00876