BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780485|ref|YP_003064898.1| biotin synthase [Candidatus Liberibacter asiaticus str. psy62] (328 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780485|ref|YP_003064898.1| biotin synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 328 Score = 683 bits (1762), Expect = 0.0, Method: Compositional matrix adjust. Identities = 328/328 (100%), Positives = 328/328 (100%) Query: 1 MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60 MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI Sbjct: 1 MSRSTVVPEENPTKKPKVWTSKEVFQIYNMPFNDLLFWSHTVHRKNFEPNHIQLSKLLNI 60 Query: 61 KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120 KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER Sbjct: 61 KTGGCPENCGYCNQSVHNKSKLKASKLINVDQVLKEAKNAKENGATRYCMGAAWREPKER 120 Query: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH Sbjct: 121 DLSIIVDMIKGVKSLGLETCMTLGMLSFEQAQILSKAGLDYYNHNIDTSERFYPHVTTTH 180 Query: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP Sbjct: 181 TFEDRLQTLENVRKSGIKVCCGGILGLGEMIDDRIDMLLTLANLSTPPESIPINLLIPIP 240 Query: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD Sbjct: 241 GSKFEENKKVDPIEHVRIISVARILMPKSRLRLAAGRAMMSDELQALCFFSGANSIFVGD 300 Query: 301 TLLTAKNPSYNKDTILFNRLGLIPDLSA 328 TLLTAKNPSYNKDTILFNRLGLIPDLSA Sbjct: 301 TLLTAKNPSYNKDTILFNRLGLIPDLSA 328 >gi|254781011|ref|YP_003065424.1| orotate phosphoribosyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 228 Score = 23.9 bits (50), Expect = 4.5, Method: Compositional matrix adjust. Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 11/77 (14%) Query: 128 MIKGVKSLGLETCMTLGMLSFEQAQILSKA--------GLDYYNHNIDTSERFYPHVTTT 179 + KG + L +E +TLG FE +++ + GL +Y+ + RF + Sbjct: 123 LFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKL 182 Query: 180 H---TFEDRLQTLENVR 193 H T+ D L E ++ Sbjct: 183 HYLATWNDILTIAEKLK 199 >gi|254780427|ref|YP_003064840.1| hypothetical protein CLIBASIA_01560 [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Score = 23.1 bits (48), Expect = 6.1, Method: Compositional matrix adjust. Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Query: 259 ISVARILMPKSRLRLAAGRAMMSDE--LQALC 288 +SV ++ +P+ L++A A+ DE L+ LC Sbjct: 1 MSVKKVNLPRLDLQIAVENALWGDEIHLRTLC 32 >gi|254780546|ref|YP_003064959.1| hypothetical protein CLIBASIA_02165 [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Score = 22.7 bits (47), Expect = 7.9, Method: Compositional matrix adjust. Identities = 7/14 (50%), Positives = 12/14 (85%) Query: 176 VTTTHTFEDRLQTL 189 + T HTF+D+L+T+ Sbjct: 122 IMTAHTFDDQLETV 135 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.135 0.400 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 214,932 Number of Sequences: 1233 Number of extensions: 8818 Number of successful extensions: 23 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 19 Number of HSP's gapped (non-prelim): 6 length of query: 328 length of database: 328,796 effective HSP length: 74 effective length of query: 254 effective length of database: 237,554 effective search space: 60338716 effective search space used: 60338716 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 38 (19.2 bits)