>cd01884 EF_Tu EF-Tu subfamily. This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts. It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors. The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family. EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors. Transfer RNA is carried to the ribosome in these complexes for protein translation.

Probab=93.26 E-value=0.62 Score=25.28 Aligned_cols=64 Identities=16% Similarity=0.157 Sum_probs=37.1 Q ss_pred HCCEEEEECCCCCCCCCCCCCCHHHHHH-HHCC-CEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCC Q ss_conf 2887999227655566767530899999-7479-448970577650457999999998479907999976977 Q gi|254780487|r 93 INDSIIIEGIGGLLVPLTTEYLFIDLIE-RWQF-PIILCARTSLGTINHSLLSLETLRNRNINIIGIAFIGDS 163 (217) Q Consensus 93 ~~D~viIEGagg~~~~~~~~~~~~dla~-~l~~-~vILV~~~~~g~i~~~~l~~~~~~~~g~~i~GiIlN~~~ 163 (217) T Consensus 64 ~~~~~~IDtPGH~------dF-~~~~i~g~~~~D~aiLVVdA~eGv~~QT~eh~~la~~lgi~~iiV~iNK~D 129 (195) T cd01884 64 NRHYAHVDCPGHA------DY-IKNMITGAAQMDGAILVVSATDGPMPQTREHLLLARQVGVPYIVVFLNKAD 129 (195) T ss_pred CEEEEECCCCCHH------HH-HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEECCC T ss_conf 8169962689607------78-889986351136268998527787478999999999809996279996877

HHsearch alignment for GI: 254780487 and conserved domain: cd01884