HHsearch alignment for GI: 254780488 and conserved domain: TIGR00858

>TIGR00858 bioF 8-amino-7-oxononanoate synthase; InterPro: IPR004723 8-amino-7-oxononanoate synthase (2.3.1.47 from EC) is involved in biotin biosynthesis. Synonym(s): AONS, 8-amino-7-ketopelargonate synthase, 7-keto-8-amino-pelargonic acid synthetase, 7-KAP synthetase; GO: 0008710 8-amino-7-oxononanoate synthase activity, 0009102 biotin biosynthetic process.
Probab=99.87  E-value=2.2e-21  Score=164.53  Aligned_cols=334  Identities=19%  Similarity=0.264  Sum_probs=220.6

Q ss_pred             EEEEEEEEEEEECCC--CEEEECHHHH-HHHCCCCCCHHHHHH-HHHHHHHHCCHH-----CCCCCCHHHHHHHHHHHHH
Q ss_conf             688621328996898--7646410237-753678789999999-999998522010-----2456897899999999972
Q gi|254780488|r   25 KIIKTEGSYLIDENH--DKIIDAISSW-WVITHGHRHPIIMNA-IRSASENYDQII-----FSEYTHEPAEQLARLLIKI   95 (423)
Q Consensus        25 ~i~~~~G~~l~d~dG--~~~lD~~~g~-~~~~lGh~~~~i~~a-~~~q~~~~~~~~-----~~~~~~~~~~~la~~l~~~   95 (423)
T Consensus         7 ~~~~~~~~~~~-~dgPP~~~l~FsSNDYLGL---a~hp~l~~af~~~~~~~~G~Gs~aSrLv~G~-~~~H~~LE~~lA~~   81 (378)
T TIGR00858         7 PLSRAPGPEVV-RDGPPRRLLNFSSNDYLGL---ASHPELIQAFAQQAAEQYGAGSTASRLVTGN-SPLHEELEEELAEF   81 (378)
T ss_pred             CCCCCCCCEEE-ECCCCHHHHHCCCCCCHHH---CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCC-CHHHHHHHHHHHHH
T ss_conf             43468866788-7688714653136440100---3798899999999998668773674340378-56899999999986


Q ss_pred             CCCCCCCEEECCCCCCHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCEEC
Q ss_conf             037864111026542025677776430013344332113432025665321123432233333322--234454210001
Q gi|254780488|r   96 APLGLQYVFFSDSGSTSIEVALKMALGFFNNNNMPRNKIVVMEHGYHGDTIGSMSVSMRGAFNNSY--EPLLFDVETIPF  173 (423)
Q Consensus        96 ~p~~~~~v~f~~SGsEA~e~Alklar~~~~~~~~~r~~ii~~~~~yHG~t~~a~s~s~~~~~~~~~--~p~~~~~~~i~~  173 (423)
T Consensus        82 k--g~EaALlFsSGY~AN~Gvi~aL~---~~~~l~~~Dlils----------------D~LNHASl~dG~rLS~A~~~~y  140 (378)
T TIGR00858        82 K--GTEAALLFSSGYLANVGVISALV---GKRVLEKGDLILS----------------DALNHASLIDGCRLSGARVLRY  140 (378)
T ss_pred             H--CCCCEEEEHHHHHHHHHHHHHHH---HCCCCCCCCEEEE----------------HHHHHHHHHHHHHCCCCCEEEC
T ss_conf             2--88203420027899999999875---1576567860442----------------0254777898641598627870


Q ss_pred             CCCCCCCCCCCHHHHHCC----CCCEEEEECCCCCCCCCCCCCCCCCCCCEEECCCCCCCCEECCCCCCCCCCCCCC--C
Q ss_conf             222222211110122127----7511343116554321122223332110011011123420001221244445554--3
Q gi|254780488|r  174 PHHNEEQKTLDDLEKHCS----TQKIAAFLVEPLILGAGGMQTYRPYILKEFMRITKKYDTLLIADEVMTGWGRTGK--I  247 (423)
Q Consensus       174 ~~~~~~~~~l~~l~~~~~----~~~iaavi~EP~i~~~gG~~~~~~~~l~~lr~lc~~~g~llI~DEV~tG~GRtG~--~  247 (423)
T Consensus       141 ~H-----~D~~~L~~lL~~~~g~~~~~livTDG-VFSMDGD~AP----L~~L~~la~~~~A~L~VDD-AHgtGVlG~~G~  209 (378)
T TIGR00858       141 RH-----NDVEHLERLLEKNRGKERRKLIVTDG-VFSMDGDIAP----LPQLVALAERYGAWLMVDD-AHGTGVLGEDGR  209 (378)
T ss_pred             CC-----CCHHHHHHHHHHCCCCCCCEEEEECC-EECCCCCCCC----HHHHHHHHHHCCCEEEEEC-CCCCCCCCCCCC
T ss_conf             68-----99899999997401513776889700-1316888489----7899999987098899986-545366288754


Q ss_pred             CCCCCCCCCC---CEE--ECCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHCCHHHCC-CC
Q ss_conf             1122334444---202--01344332223444332240132100012222222233333222210011000000000-11
Q gi|254780488|r  248 FACNHADITP---DIL--CLSKGITGGALPLAATLCSEEIFDSHLSSDKKKTFFHSSSYTANPIACAAALANLQIWE-KE  321 (423)
Q Consensus       248 ~a~~~~gi~P---Di~--~~gK~l~gG~~pisav~~~~~i~~~~~~~~~~~~~~h~~T~~gnpl~~aaa~a~L~~i~-~~  321 (423)
T Consensus       210 G~~~~fgl~~~~~~i~~GTlSKAlGs~---Ga~V~g~~~l~~yL~n~--AR~~If~TaL--PPa~~aA~~aAl~~i~~~~  282 (378)
T TIGR00858       210 GTLEHFGLKPAPVDIQVGTLSKALGSY---GAYVAGSEALIDYLINR--ARTFIFSTAL--PPAVVAAALAALELIQEEE  282 (378)
T ss_pred             HHHHHCCCCCCCEEEEEEECCHHHHHC---HHHHHHHHHHHHHHHHC--CCCCEECCCC--CHHHHHHHHHHHHHHHCCC
T ss_conf             149765988887269986131665405---25635458999999841--5764232366--5889999999999722248


Q ss_pred             C-CCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCEEEEEECCCCC------CCCCHHHHHHHHHHHHCCEEEEE-----
Q ss_conf             2-33222100267898999975189777774553399999706876------66410689999999978859995-----
Q gi|254780488|r  322 P-VIERIKNLERMHADRLSLLKSNKKFVNIRQMGTIVALDFNVQNK------GYFFDKNAKLKNFFREKKILIRP-----  389 (423)
Q Consensus       322 ~-l~~~~~~~g~~l~~~l~~L~~~~~v~~vrG~Gl~~~iel~~~~~------~~~~~~~~~l~~~l~~~Gil~~~-----  389 (423)
T Consensus       283 ~~rr~~L~~~~~~~~~~l~~~~-~~~------------f~~~~~~TPI~P~~~G~~~~al~~a~~L~~~G~~v~AIRPPT  349 (378)
T TIGR00858       283 PWRREKLLALIARLRKGLEALG-KLV------------FQLMPSETPIVPVIIGDEESALALAEELQEQGIFVGAIRPPT  349 (378)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCC-CCC------------CEECCCCCCCEEEEECCCHHHHHHHHHHHHCCCEEECCCCCC
T ss_conf             6478999999999999987547-663------------101678986258870892899999999987794791025888


Q ss_pred             --CC-CEEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             --19-989956898787999999999999
Q gi|254780488|r  390 --LG-HIMYLMPPYCITATDLDHIYNTIN  415 (423)
Q Consensus       390 --~g-n~i~l~Ppl~it~~eId~~l~~l~  415 (423)
T Consensus       350 VP~G~sRLR~Tl~A~Ht~~di~~L~~~l~  378 (378)
T TIGR00858       350 VPKGTSRLRLTLSAAHTEGDIDRLLEALK  378 (378)
T ss_pred             CCCCCCEEEEEEEECCCHHHHHHHHHHCC
T ss_conf             87796104557740489889999999739