RPSBLAST alignment for GI: 254780488 and conserved domain: PRK12389

>gnl|CDD|183493 PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional. Length = 428
 Score = 86.2 bits (214), Expect = 1e-17
 Identities = 87/328 (26%), Positives = 150/328 (45%), Gaps = 51/328 (15%)

Query: 28  KTEGSYLIDENHDKIIDAISSWWVITHGHRHPIIMNAIRSASENYDQIIFSEYTHEPAE- 86
           + +G+Y  D + +K ID ++++  I  GH HP I  AI  A+EN   +++   T    E 
Sbjct: 41  RGKGAYFYDVDGNKYIDYLAAYGPIITGHAHPHITKAITEAAEN--GVLYG--TPTELEI 96

Query: 87  QLARLLIKIAPLGLQYVFFSDSGSTSIEVALKMALGFFNNNNMPRNKIVVMEHGYHG--- 143
           + A++L +  P  L+ V F +SG+ ++   +++A  +       R KI+     YHG   
Sbjct: 97  EFAKMLKEAIP-SLEKVRFVNSGTEAVMTTIRVARAYTG-----RTKIIKFAGCYHGHSD 150

Query: 144 ----------DTIG---SMSVSMRGAFNNSYEPLLFDVETIPFPHHNEEQKTLDDLEKHC 190
                      T+G   S  V    A          +V T+PF      ++ LD      
Sbjct: 151 LVLVAAGSGPSTLGTPDSAGVPKSIA---------QEVITVPFNDIEALKEALD----KW 197

Query: 191 STQKIAAFLVEPLILGAGGMQTYRPYILKEFMRITKKYDTLLIADEVMTGWGRTGKIFAC 250
             + +AA LVEP I+G  G+   +P  L+    +  +   L+I DEV+T + R     A 
Sbjct: 198 GDE-VAAVLVEP-IVGNFGIVEPKPGFLEAVNELAHEAGALVIYDEVITAF-RFMYGGAQ 254

Query: 251 NHADITPDILCLSKGITGGALPLAATLCSEEIFD--SHLSSDKKKTFFHSSSYTANPIAC 308
           +   + PD+  L K I GG LP+ A    ++I +  + L        + + +   NP + 
Sbjct: 255 DLLGVEPDLTALGK-IIGGGLPIGAYGGRKDIMEQVAPLGPA-----YQAGTMAGNPASM 308

Query: 309 AAALANLQIWEKEPVIERIKNLERMHAD 336
           AA +A L++ ++E V E++  L  M  +
Sbjct: 309 AAGIACLEVLQQEGVYEKLDRLGAMLEE 336