RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780490|ref|YP_003064903.1| site-specific tyrosine recombinase XerC [Candidatus Liberibacter asiaticus str. psy62] (67 letters) >gnl|CDD|34580 COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair]. Length = 300 Score = 88.0 bits (218), Expect = 5e-19 Identities = 34/57 (59%), Positives = 44/57 (77%) Query: 2 STTAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQTHP 58 + HTLRHSFATHLL NG DLR +Q +LGH+ +STTQIYT+V +R+ ++Y Q HP Sbjct: 242 KISPHTLRHSFATHLLENGADLRVVQELLGHADISTTQIYTHVTKERLRDLYAQHHP 298 >gnl|CDD|29499 cd00798, INT_XerDC, XerD and XerC integrases, DNA breaking-rejoining enzymes, N- and C-terminal domains. XerD-like integrases are involved in the site-specific integration and excision of lysogenic bacteriophage genomes, transposition of conjugative transposons, termination of chromosomal replication, and stable plasmid inheritance. They share the same fold in their catalytic domain containing six conserved active site residues and the overall reaction mechanism with the DNA breaking-rejoining enzyme superfamily. In Escherichia coli, the Xer site-specific recombination system acts to convert dimeric chromosomes, which are formed by homologous recombination to monomers. Two related recombinases, XerC and XerD, bind cooperatively to a recombination site present in the E. coli chromosome. Each recombinase catalyzes the exchange of one pair of DNA strand in a reaction that proceeds through a Holliday junction intermediate. These enzymes can bridge two different and well-separated DNA sequences called arm- and core-sites. The C-terminal domain binds, cleaves and re-ligates DNA strands at the core-sites, while the N-terminal domain is largely responsible for high-affinity binding to the arm-type sites.. Length = 284 Score = 83.7 bits (207), Expect = 9e-18 Identities = 31/52 (59%), Positives = 42/52 (80%) Query: 2 STTAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIY 53 + HTLRHSFATHLL NG DLR++Q +LGH+ L+TTQIYT+V+ + + E+Y Sbjct: 233 KISPHTLRHSFATHLLENGADLRAVQELLGHASLATTQIYTHVSFEHLKEVY 284 >gnl|CDD|34579 COG4973, XerC, Site-specific recombinase XerC [DNA replication, recombination, and repair]. Length = 299 Score = 80.0 bits (197), Expect = 1e-16 Identities = 31/58 (53%), Positives = 44/58 (75%) Query: 6 HTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQTHPSITQK 63 H LRHSFATH+L + GDLR++Q +LGH+ LSTTQIYT+++ + + +YD HP +K Sbjct: 242 HKLRHSFATHMLESSGDLRAVQELLGHANLSTTQIYTHLDFQHLASVYDAAHPRAKRK 299 >gnl|CDD|29514 cd01193, INT_IntI, IntI (E2) integrases, site-specific tyrosine recombinases, DNA breaking-rejoining enzymes, N- and C-terminal domains. This CD includes integrases which are components of multiresistant integrons and mediate recombination between a proximal attI site and a secondary target called the attC (or 59-base element) present on various mobile gene cassettes. Integron-integrases are present in many natural occurring mobile elements, including transposons and conjugative plasmids. Vibrio, Shewanella, Xanthomonas and Pseudomonas species harbor chromosomal super-integrons. All integron-integrases carry large inserts unlike the TnpF ermF-like proteins also seen in this group.. Length = 242 Score = 69.1 bits (169), Expect = 3e-13 Identities = 29/41 (70%), Positives = 33/41 (80%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNV 44 T HTLRHSFATHLL G D+R+IQ +LGHS L TT IYT+V Sbjct: 202 TPHTLRHSFATHLLEAGYDIRTIQELLGHSDLKTTMIYTHV 242 >gnl|CDD|144254 pfam00589, Phage_integrase, Phage integrase family. Members of this family cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment. The catalytic site residues in CRE recombinase are Arg-173, His-289, Arg-292 and Tyr-324. Length = 170 Score = 63.9 bits (156), Expect = 9e-12 Identities = 26/45 (57%), Positives = 32/45 (71%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKR 48 T H LRH+FATHL NG LR IQ +LGHS +S T YT+V ++R Sbjct: 126 TPHDLRHTFATHLAENGVPLRVIQKLLGHSSISMTMRYTHVAAER 170 >gnl|CDD|29506 cd01185, INT_Tn4399, Tn4399 and related integrases, DNA breaking-rejoining enzymes, integrase/recombinases, N- and C-terminal domains. This CD includes various bacterial integrases, including cLV25, a Bacteroides fragilis chromosomal transfer factor integrase similar to the Bacteroides mobilizable transposon, Tn4399, integrase.. Length = 299 Score = 58.0 bits (140), Expect = 6e-10 Identities = 18/41 (43%), Positives = 27/41 (65%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNV 44 T H RH+FAT L +GG + ++ +LGH+ + TTQ+Y V Sbjct: 247 TFHCARHTFATLQLLSGGPIETVSKMLGHTNIKTTQVYARV 287 >gnl|CDD|29498 cd00797, HP1_INT_C, Phage HP1 integrase, C-terminal catalytic domain. Bacteriophage HP1 and related integrases are found in eubacteria, plasmids and temperate bacteriophages of the P2 family. They belong to the DNA breaking-rejoining enzyme superfamily, which includes tyrosine recombinases and type IB topoisomerases. These enzymes share the same fold in their C-terminal catalytic domain containing six conserved active site residues and the overall reaction mechanism. The HP1 recombinase controls phage replication by site-specific recombination between the HP1 genome and the chromosomal DNA. It is a heterobifunctional DNA-binding protein, which recognizes two different DNA sequence motifs (type I and type II binding sites). The C-terminal catalytic domain of the HP1 integrase binds to the type I site, while the less conserved N-terminal domain is largely responsible for binding to the type II site.. Length = 158 Score = 54.5 bits (131), Expect = 6e-09 Identities = 17/36 (47%), Positives = 26/36 (72%) Query: 6 HTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIY 41 H LRH+FA+H + NGG++ ++Q ILGH+ + T Y Sbjct: 107 HILRHTFASHFMMNGGNIATLQHILGHATIEMTMRY 142 >gnl|CDD|29503 cd01182, INT_REC_C, DNA breaking-rejoining enzymes, intergrase/recombinases, C-terminal catalytic domain. The tyrosine recombinase/integrase family share the same catalytic domain containing six conserved active site residues. The best-studied members of this diverse family include the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many intergrase/recombinases also have N-terminal domains, which show little sequence or structure similarity.. Length = 162 Score = 54.5 bits (130), Expect = 7e-09 Identities = 22/39 (56%), Positives = 26/39 (66%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYT 42 T H LRH+FAT LL G L IQ +LGHS +STT+ Y Sbjct: 123 TPHDLRHTFATRLLEAGVPLEVIQELLGHSSISTTERYL 161 >gnl|CDD|29511 cd01190, INT_SG5, INT_SG5, DNA breaking-rejoining enzymes, integrase/recombinases subgroup 5, N- and C-terminal domains. The CD contains mainly predicted bacterial integrase/recombinases.. Length = 260 Score = 53.0 bits (127), Expect = 2e-08 Identities = 20/55 (36%), Positives = 28/55 (50%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQTHP 58 + H LRH+ A HLL +G D+ I LGH+ L TT IY + + + P Sbjct: 206 SPHVLRHTTAMHLLQSGVDIVVIALWLGHASLETTNIYAEADLEMKRRALAKATP 260 >gnl|CDD|29495 cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine recombinases that share the same fold in their catalytic domain containing six conserved active site residues. The best-studied members of this diverse superfamily include human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.. Length = 164 Score = 53.1 bits (127), Expect = 2e-08 Identities = 19/39 (48%), Positives = 28/39 (71%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYT 42 T H+LRH+FA+ LL+ G DL ++Q +LGHS ++ T Y Sbjct: 125 TPHSLRHTFASALLNAGLDLEAVQDLLGHSSIAMTMRYA 163 >gnl|CDD|29509 cd01188, INT_pAE1, pAE1 and related integrases, DNA breaking-rejoining enzymes, integrase/recombinases, C-terminal domain. This CD includes various bacterial integrases, including the predicted integrase of the deletion-prone region of plasmid pAE1 of Alcaligenes eutrophus H1.. Length = 188 Score = 51.0 bits (122), Expect = 6e-08 Identities = 21/48 (43%), Positives = 26/48 (54%) Query: 5 AHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEI 52 AH LRHS AT LL G L+ I +LGH +T IY V+ + I Sbjct: 135 AHLLRHSLATRLLRAGAPLKEIGDVLGHRSPDSTAIYAKVDVDALRAI 182 >gnl|CDD|29504 cd01183, INT_SG1_C, INT_SG1, DNA breaking-rejoining enzymes, integrase/recombinases subgroup 1, C-terminal catalytic domain. The CD contains mainly predicted integrase/recombinase and site-specific XerD recombinases. The members of this CD are found predominantly in proteobacteria. These proteins have not been biochemically characerised as yet.. Length = 196 Score = 45.0 bits (106), Expect = 4e-06 Identities = 16/39 (41%), Positives = 23/39 (58%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYT 42 + H LRH+ A+H L+ G L +Q LGH+ + TT Y Sbjct: 157 STHWLRHTHASHDLAAGVPLEHVQDNLGHASIDTTSRYL 195 >gnl|CDD|29510 cd01189, INT_phiLC3_C, phiLC3 phage and phage-related integrases, site-specific recombinases, DNA breaking-rejoining enzymes, C-terminal catalytic domain. This CD includes various bacterial (mainly gram positive) and phage integrases, including those similar to Lactococcus phage phiLC3, TPW22, Tuc2009, BK5-T, A2, bIL285, bIL286, bIL311, ul36 and phi g1e; Staphylococcus aureus phage phi13 and phi42; Oenococcus oeni phage fOg44; Streptococcus thermophilus phage O1205 and Sfi21; and Streptococcus pyogenes phage T12 and T270.. Length = 191 Score = 42.5 bits (100), Expect = 2e-05 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTT-QIYTNVNSKR 48 T H LRH+ A+ LL G ++ + LGH+ +STT Y+++ ++ Sbjct: 145 TFHGLRHTHASLLLEAGVSIKYVSERLGHADISTTLDTYSHLLPEK 190 >gnl|CDD|29513 cd01192, INT_P22_C, P22-like integrases, site-specific recombinases, DNA breaking-rejoining enzymes, C-terminal catalytic domain. This CD includes various bacterial and phage integrases, including those similar to phage P22-like integrases, DLP12 and APSE-1.. Length = 177 Score = 42.2 bits (99), Expect = 3e-05 Identities = 15/36 (41%), Positives = 23/36 (63%) Query: 6 HTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIY 41 H LRH++A+ L+ +G L +Q +LGHS L + Y Sbjct: 123 HDLRHTWASWLVQSGVPLYVLQELLGHSSLQMVRRY 158 >gnl|CDD|29518 cd01197, INT_FimBE_C, FimB and FimE and related proteins, DNA breaking-rejoining enzymes, integrase/recombinases, catalytic domain. This CD includes those proteins similar to E.coli FimE and FimB regulatory proteins and Proteus mirabilis MrpI.. Length = 180 Score = 41.9 bits (98), Expect = 4e-05 Identities = 19/53 (35%), Positives = 27/53 (50%) Query: 1 MSTTAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIY 53 + H LRH+ L + G D R IQ LGH + T IYT N+ R + ++ Sbjct: 128 IKVHPHMLRHACGYALANQGADTRLIQDYLGHRNIRHTVIYTASNAARFLNLW 180 >gnl|CDD|29520 cd01199, INT_Tn1545_C, Tn1545-related conjugative transposon integrases, site-specific recombinases, DNA breaking-rejoining enzymes, C-terminal catalytic domain. This CD includes bacterial (gram positive) and phage integrases, including those similar to Tn1545, Tn5252, and Tn5276 conjugative transposon integrases and Lactobacillus phage phi adh integrase.. Length = 205 Score = 40.7 bits (95), Expect = 1e-04 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTT-QIYTNVNSKRMMEI 52 T H RH+ + L G L++I +GHS TT +IY++V K EI Sbjct: 152 TTHIFRHTHISFLAEEGVPLKAIMDRVGHSDGKTTLRIYSHVTEKMKDEI 201 >gnl|CDD|29517 cd01196, INT_VanD, VanD integrase, IntD, and related integrases, DNA breaking-rejoining enzymes, integrase/recombinases, N- and C-terminal domains. This CD includes various bacterial integrases including those similar to IntD, a putative integrase-like protein, a component of the vanD glycopeptide resistance cluster in Enterococcus faecium BM4339. Members of this CD are predominantly bacterial in origin.. Length = 263 Score = 39.6 bits (92), Expect = 2e-04 Identities = 16/50 (32%), Positives = 26/50 (52%) Query: 6 HTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQ 55 H+ RH FA + L+ DL + ++GH + TT+IY + I D+ Sbjct: 210 HSFRHLFAKNFLAKYNDLALLADLMGHESIETTRIYLRKTATEQQRIVDK 259 >gnl|CDD|29519 cd01198, INT_ASSRA_C, Archaeal site-specific recombinase A (ASSRA), DNA breaking-rejoining enzymes, integrase/recombinases, C-terminal catalytic domain. Members of this CD are archael in origin. No biochemical characterization is available for the proteins of this subgroup at this point.. Length = 186 Score = 39.6 bits (92), Expect = 2e-04 Identities = 20/58 (34%), Positives = 27/58 (46%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQTHPSIT 61 T H RH F T L GGD +Q + G SR YT++ + E Y + PS+ Sbjct: 129 TPHCFRHFFTTWLRRRGGDRGVVQELRGDSRDEAIDTYTHIWGDELREAYLKHIPSLG 186 >gnl|CDD|29516 cd01195, INT_Tn544B_C, Tn544B and related transposases, DNA breaking-rejoining enzymes, integrase/recombinases, catalytic domain. This CD includes various bacterial transposases similar to TnpB from transposon Tn554.. Length = 195 Score = 38.5 bits (89), Expect = 4e-04 Identities = 15/40 (37%), Positives = 22/40 (55%) Query: 5 AHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNV 44 AH RH+ AT +++NG + IQ LGH T Y ++ Sbjct: 147 AHAFRHTVATRMINNGMPIHIIQKFLGHESPEMTSRYAHI 186 >gnl|CDD|29515 cd01194, INT_Tn554A_C, Tn544A and related transposases, DNA breaking-rejoining enzymes, integrase/recombinases, C-terminal catalytic domain. This CD includes various bacterial transposases similar to TnpA from transposon Tn554.. Length = 186 Score = 34.9 bits (80), Expect = 0.005 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTT-QIYTNVNSKRMMEIY 53 T H RH+ AT L+ G + + LGH+ + TT Y +++ + + + Sbjct: 134 TPHMFRHTHATELIRAGWSIEVVADRLGHAHVQTTLNTYGHLSEEDIRREF 184 >gnl|CDD|29505 cd01184, INT_SG2_C, INT_SG2, DNA breaking-rejoining enzymes, integrase/recombinases subgroup 2, C-terminal catalytic domain. The CD contains mainly predicted integrase/recombinases and phage-related integrases. Some have N-terminal domains, which show little sequence similarity to each other. Members of this subgroup are predominantly found in proteobacteria.. Length = 181 Score = 32.6 bits (74), Expect = 0.026 Identities = 13/36 (36%), Positives = 20/36 (55%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQ 39 + H+ RH+F T L + G I +I+GH +TT Sbjct: 141 SFHSFRHTFITELRNAGVSRELIAAIMGHEEGTTTF 176 >gnl|CDD|29500 cd00799, INT_Cre, Cre recombinase, C-terminal catalytic domain. Cre-like recombinases belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The bacteriophage P1 Cre recombinase maintains the circular phage replicon in a monomeric state by catalyzing a site-specific recombination between two loxP sites. The catalytic core domain of Cre recombinase is linked to a more divergent helical N-terminal domain, which interacts primarily with the DNA major groove proximal to the crossover region.. Length = 287 Score = 32.2 bits (73), Expect = 0.032 Identities = 10/38 (26%), Positives = 12/38 (31%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIY 41 + H+LR FAT G L I Y Sbjct: 235 SGHSLRRGFATEAARAGYSLLEIMRQGRWRSPKMVSRY 272 >gnl|CDD|29507 cd01186, INT_SG3_C, INT_SG3, DNA breaking-rejoining enzymes, integrase/recombinases subgroup 3, catalytic domain. The CD contains various predicted bacterial and phage integrase/recombinase sequences for which not much experimental characterization is available.. Length = 180 Score = 31.3 bits (71), Expect = 0.065 Identities = 14/50 (28%), Positives = 21/50 (42%) Query: 6 HTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMMEIYDQ 55 HTLR +F H D+ + I HS + T Y +N + + D Sbjct: 128 HTLRKTFGYHYYKQTKDIALLMEIFNHSSPAITLRYIGINQDEIDKQLDN 177 >gnl|CDD|29508 cd01187, INT_SG4, INT_SG4, DNA breaking-rejoining enzymes, integrase/recombinases subgroup 4, N- and C-terminal domains. The CD contains mainly predicted bacterial integrase/recombinases for which not much biochemical characterization is available.. Length = 299 Score = 29.1 bits (65), Expect = 0.31 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 8/44 (18%) Query: 6 HTLRHSFATHLLS----NGGD----LRSIQSILGHSRLSTTQIY 41 H LRH FA L+ G D L + + LGH+ ++ T Y Sbjct: 241 HDLRHRFAVTRLTRWYRAGADVERKLPVLATYLGHANITDTYWY 284 >gnl|CDD|29502 cd00801, INT_P4, Bacteriophage P4 integrase. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. They share the same fold in their catalytic domain and the overall reaction mechanism with the superfamily of DNA breaking-rejoining enzymes. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes.. Length = 357 Score = 28.7 bits (64), Expect = 0.40 Identities = 10/30 (33%), Positives = 12/30 (40%) Query: 4 TAHTLRHSFATHLLSNGGDLRSIQSILGHS 33 T H LR + T L G I+ L H Sbjct: 301 TPHGLRRTARTWLNELGFPPDVIERQLAHV 330 >gnl|CDD|29497 cd00796, INT_Rci, Rci recombinase, C-terminal catalytic domain. Rci enzymes are found in IncI1 incompatibility group plasmids such as R64. These recombinases belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The R64 Rci recombinase mediates site specific recombination at the highly mobile DNA segments called shufflon located in the C-terminal region of the pilV gene, which determines the recipient specificity in liquid mating. This gene encodes a thin pilus component that recognizes recipient's receptors required for liquid mating. The recombination occurs between any of the seven inverted repeats that separate four DNA segments of the shufflon. The segments can be inverted independently or in groups, resulting in a complex DNA rearrangement. The catalytic domain of Rci is linked to a variable N-terminal domain, whose function is unknown.. Length = 206 Score = 28.3 bits (63), Expect = 0.45 Identities = 12/38 (31%), Positives = 17/38 (44%) Query: 6 HTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTN 43 H LRH + L G + + SI GH + YT+ Sbjct: 160 HDLRHEATSRLFEKGLSIMEVASISGHRDWRMLKRYTH 197 >gnl|CDD|30927 COG0582, XerC, Integrase [DNA replication, recombination, and repair]. Length = 309 Score = 28.4 bits (60), Expect = 0.48 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Query: 2 STTAHTLRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIYTNVNSKRMME 51 T H LRH+FAT LL GGD R IQ +LGH+ L+TTQ S ++ Sbjct: 248 KITPHGLRHTFATLLL-AGGDERVIQKLLGHASLNTTQTVYYHASDERLK 296 >gnl|CDD|145902 pfam03000, NPH3, NPH3 family. Phototropism of Arabidopsis thaliana seedlings in response to a blue light source is initiated by nonphototropic hypocotyl 1 (NPH1), a light-activated serine-threonine protein kinase. Mutations in NPH3 disrupt early signaling occurring downstream of the NPH1 photoreceptor. The NPH3 gene encodes a NPH1-interacting protein. NPH3 is a member of a large protein family, apparently specific to higher plants, and may function as an adapter or scaffold protein to bring together the enzymatic components of a NPH1-activated phosphorelay. Length = 246 Score = 27.5 bits (62), Expect = 0.86 Identities = 10/41 (24%), Positives = 22/41 (53%), Gaps = 6/41 (14%) Query: 26 IQSILGHSRLSTTQIYTNVNSKRMMEIYDQTHPSITQKDKK 66 +++ +R S +Y R ++IY + HP +++ +KK Sbjct: 196 AEALPDSARPSHDGLY------RAIDIYLKAHPGLSESEKK 230 >gnl|CDD|29512 cd01191, INT_phiCTX_C, phiCTX phage and phage-related integrases, site-specific recombinases, DNA breaking-rejoining enzymes, C-terminal catalytic domain. This CD includes various phage and bacterial integrases, including those similar to phage integrases: Bordetella and Pseudomonas phiCTX; E. coli Rac, Qin, and Shiga toxin 2 933W; and Salmonella typhimurium LT2 Gifsy-2 and Fels-1; and a putative pore-forming cytotoxin integrase from Vibrio parahaemolyticus O3:K6.. Length = 196 Score = 27.2 bits (60), Expect = 1.1 Identities = 10/34 (29%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Query: 8 LRHSFATHLLSNGGDLRSIQSILGHSRLSTTQIY 41 +RH+FA+ +L+ G + I +GH S ++ Sbjct: 158 MRHTFASWMLTAGANPAFIADQMGHK--SAEMVF 189 >gnl|CDD|31403 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]. Length = 291 Score = 25.1 bits (55), Expect = 4.2 Identities = 6/16 (37%), Positives = 12/16 (75%) Query: 45 NSKRMMEIYDQTHPSI 60 K+M+E+Y++T S+ Sbjct: 141 CLKQMIELYEETGGSV 156 >gnl|CDD|145244 pfam01964, ThiC, ThiC family. ThiC is found within the thiamine biosynthesis operon. ThiC is involved in pyrimidine biosynthesis. The precise catalytic function of ThiC is still not known. ThiC participates in the formation of 4-Amino-5-hydroxymethyl-2-methylpyrimidine from AIR, an intermediate in the de novo pyrimidine biosynthesis. Length = 421 Score = 24.3 bits (54), Expect = 8.4 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Query: 17 LSNGGDLRSI-QSILGHSRLS--TTQIY 41 LS GGDL I ++IL +S + T IY Sbjct: 96 LSTGGDLDEIRRAILENSPVPVGTVPIY 123 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.124 0.341 Gapped Lambda K H 0.267 0.0797 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 673,660 Number of extensions: 22898 Number of successful extensions: 70 Number of sequences better than 10.0: 1 Number of HSP's gapped: 70 Number of HSP's successfully gapped: 33 Length of query: 67 Length of database: 6,263,737 Length adjustment: 38 Effective length of query: 29 Effective length of database: 5,442,595 Effective search space: 157835255 Effective search space used: 157835255 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.3 bits)