BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780492|ref|YP_003064905.1| hypothetical protein CLIBASIA_01895 [Candidatus Liberibacter asiaticus str. psy62] (40 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780880|ref|YP_003065293.1| hypothetical protein CLIBASIA_03885 [Candidatus Liberibacter asiaticus str. psy62] Length = 40 Score = 85.9 bits (211), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 40/40 (100%), Positives = 40/40 (100%) Query: 1 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH Sbjct: 1 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40 >gi|254780830|ref|YP_003065243.1| hypothetical protein CLIBASIA_03615 [Candidatus Liberibacter asiaticus str. psy62] Length = 40 Score = 85.9 bits (211), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 40/40 (100%), Positives = 40/40 (100%) Query: 1 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH Sbjct: 1 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40 >gi|254780492|ref|YP_003064905.1| hypothetical protein CLIBASIA_01895 [Candidatus Liberibacter asiaticus str. psy62] Length = 40 Score = 85.9 bits (211), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 40/40 (100%), Positives = 40/40 (100%) Query: 1 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH Sbjct: 1 MTIDNESNQARKGIWWMPWHAQAMKDVICCDKLWGAANKH 40 >gi|254780669|ref|YP_003065082.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter asiaticus str. psy62] Length = 301 Score = 22.7 bits (47), Expect = 1.1, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 9/31 (29%) Query: 11 RKGIWWMPW---------HAQAMKDVICCDK 32 +KG + PW HA KDV+ C++ Sbjct: 164 KKGQFLSPWEMHNILQKLHAHGAKDVLFCER 194 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.130 0.500 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,315 Number of Sequences: 1233 Number of extensions: 476 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 40 length of database: 328,796 effective HSP length: 14 effective length of query: 26 effective length of database: 311,534 effective search space: 8099884 effective search space used: 8099884 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.1 bits) S2: 31 (16.5 bits)