HHsearch alignment of GI: 254780493 and MMDB domain: 2ywv_A_89-219

>2ywv_A (A:89-219) Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus}
Probab=100.00  E-value=4.5e-44  Score=300.43  Aligned_cols=131  Identities=29%  Similarity=0.462  Sum_probs=125.8

Q ss_pred             CCCCEEEEECCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHCCC
Q ss_conf             46505788521224432200122102476513446632122235688740223210333345777555545666530499
Q gi|254780493|r   91 MFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILT  170 (323)
Q Consensus        91 ~iPiE~VvR~y~~GS~~~~~~~~~k~~~~~~~g~~lp~gl~~~~~l~~Pi~tpstK~~~~~~~~D~~i~~~~~~~~~~~~  170 (323)
                      |||||||||||+|||+|++|                  |+.++++|++|++||++|+++   .|||+|+++++.+.|+++
T Consensus         1 miPiE~IvR~~~~GS~~rry------------------~~~eg~~~~~Pi~e~~~K~d~---~~D~~i~~~~~~~~~~~~   59 (131)
T 2ywv_A            1 IIPLEVVVRNVVAGSLAKRI------------------GLEEGTPLEAPLVEFYYKNDD---LGDPLLLEDHIFILKLAS   59 (131)
T ss_dssp             ECSEEEEEEEEECHHHHHHH------------------TCCTTEEEEEEEEEEEECCGG---GTCCEECHHHHHHHTSSC
T ss_pred             CCCEEEEEEEEEECCCCCCC------------------CCCCCCCCCCCCCCCCCCCCC---CCCCCCCHHHHHHHHHHH
T ss_conf             55479999999843641037------------------887886789875665315622---365434214677751035


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEECCCCCEEEECCCCCCCCCHHHCCCHHHHHHHCCCCCCCCCHH
Q ss_conf             89998999999999999999988679788742324455088625762000481000000000001233125444432378
Q gi|254780493|r  171 RNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKD  250 (323)
Q Consensus       171 ~~~~~~i~~~sl~i~~~~~~~~~~~GliLvD~K~EFG~~~~g~iiL~DEv~TPDssR~W~~~~ye~~~~~g~~~~s~DKq  250 (323)
                      ++++++|+++++++|..++++|+++|++|||||||||++.+|+|+|+||| ||||||||++++|+          ++|||
T Consensus        60 ~~e~~~i~~~~l~i~~~l~~~~~~~Gl~LvD~K~EFG~d~~g~iiL~DEi-tpDs~R~w~~~~~~----------~ldKe  128 (131)
T 2ywv_A           60 REEVAALKQAALAVNDVLRLHFAERNVRLIDFKLEFGRTADGAILLADEI-SPDTCRLWDAKTNE----------KLDKD  128 (131)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTEEEEEEEECEEECTTSCEEECSCC-STTTEEEEETTTCC----------BCSTH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCEEEEEEC-CCCCCCCCCCCCCC----------CCCHH
T ss_conf             87653357777778899999998779841111359737689938999942-89864445089864----------33859


Q ss_pred             HHH
Q ss_conf             887
Q gi|254780493|r  251 FIR  253 (323)
Q Consensus       251 ~~R  253 (323)
                      ++|
T Consensus       129 ~~R  131 (131)
T 2ywv_A          129 VFR  131 (131)
T ss_dssp             HHH
T ss_pred             HHH
T ss_conf             997