BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780493|ref|YP_003064906.1|
phosphoribosylaminoimidazole-succinocarboxamide synthase [Candidatus
Liberibacter asiaticus str. psy62]
         (323 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780493|ref|YP_003064906.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040170|gb|ACT56966.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 323

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/323 (100%), Positives = 323/323 (100%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT
Sbjct: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK
Sbjct: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY
Sbjct: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE
Sbjct: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE
Sbjct: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300

Query: 301 LPPLERIRNNLRKYTHRHLSSRN 323
           LPPLERIRNNLRKYTHRHLSSRN
Sbjct: 301 LPPLERIRNNLRKYTHRHLSSRN 323


>gi|315122329|ref|YP_004062818.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495731|gb|ADR52330.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 330

 Score =  524 bits (1349), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 248/316 (78%), Positives = 279/316 (88%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           RI+S+AYIPELPNYY GKVRENYFL+DGTRITIATDRLSAFD+NI CIP+KGE+LN+ITQ
Sbjct: 12  RIISEAYIPELPNYYPGKVRENYFLNDGTRITIATDRLSAFDRNITCIPHKGELLNKITQ 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           YWF HTSDIC NH LDYPDPNVLVG+QLQMFPIELIVRGYLAGNTKTSLLTFYK G+R I
Sbjct: 72  YWFQHTSDICENHALDYPDPNVLVGKQLQMFPIELIVRGYLAGNTKTSLLTFYKKGQRTI 131

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPDNM DNQKLP+ +ITPTTKSS      D+PISP+EII +GILT+NQWETISSYA
Sbjct: 132 YGHSLPDNMHDNQKLPHTIITPTTKSSGPNFEHDKPISPHEIIQKGILTQNQWETISSYA 191

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LFERGCKLA E  LILVDSKYEFG+DKK NI+LADEIHTPDSSRYW+ ETYEKS +EG
Sbjct: 192 LALFERGCKLASERDLILVDSKYEFGLDKKNNIVLADEIHTPDSSRYWKAETYEKSLKEG 251

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
            +P GLDKD IRNWILT CNPY+DNIP+IPENI+L  SQTY+ AYE+ITGLKFI +NS+ 
Sbjct: 252 TSPEGLDKDLIRNWILTHCNPYKDNIPNIPENILLHISQTYMTAYERITGLKFIGENSDF 311

Query: 302 PPLERIRNNLRKYTHR 317
            PL RIRNNL +Y +R
Sbjct: 312 SPLHRIRNNLEQYINR 327


>gi|86359001|ref|YP_470893.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           etli CFN 42]
 gi|86283103|gb|ABC92166.1| phosphoribosylaminoimidazole-succinocarboxamide synthase protein
           [Rhizobium etli CFN 42]
          Length = 314

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/311 (62%), Positives = 236/311 (75%), Gaps = 2/311 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 1   MRILSEAHFPELPNYYRGKVRENYDLPDGRRIIISTDRLSAFDRILTCIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH LDYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEATKDICPNHVLDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGQRE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K  E   G D+P++P EI+ RG+LT  QWE++S Y
Sbjct: 121 MYGMRLPDGMRDNQILPEPVITPTSK--EFDGGHDEPLTPAEIVTRGLLTSQQWESLSKY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG ++A   GLILVD+KYEFG D+  NIILADEIHTPDSSRYW  ETY  SF  
Sbjct: 179 ALALFARGQEMATRRGLILVDTKYEFGTDRDGNIILADEIHTPDSSRYWLAETYPASFAA 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI AYE ITG +F+ADNS 
Sbjct: 239 GKRPDSFDKDFVRAWVAERCDPYKDEIPEIPTELIEQTSAVYIRAYEAITGERFVADNSG 298

Query: 301 LPPLERIRNNL 311
             PL R+RNNL
Sbjct: 299 ETPLARVRNNL 309


>gi|116253612|ref|YP_769450.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115258260|emb|CAK09362.1| putative phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 314

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 239/314 (76%), Gaps = 2/314 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 1   MRILSEAHFPELPNYYRGKVRENYDLPDGRRIIISTDRLSAFDRILTCIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH LDYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEATKDICPNHVLDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGERE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K  E   G D+P++P EI+ RG+LT  QW+T+S+Y
Sbjct: 121 MYGMRLPDGMRDNQILPEPVITPTSK--EFDGGHDEPLTPTEIVTRGLLTNEQWQTLSTY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG ++A +NGLILVD+KYEFG D   NIILADEIHTPDSSRYW  E+Y  SF  
Sbjct: 179 ALALFARGQEMAAKNGLILVDTKYEFGTDGDGNIILADEIHTPDSSRYWLAESYPASFAA 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI AYE ITG +F+ D+S 
Sbjct: 239 GKRPESFDKDFVRAWVAERCDPYKDEIPEIPAELIEQTSAVYIKAYEAITGERFVPDDSG 298

Query: 301 LPPLERIRNNLRKY 314
             PL R+RNNL +Y
Sbjct: 299 ETPLARVRNNLARY 312


>gi|241206132|ref|YP_002977228.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860022|gb|ACS57689.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 314

 Score =  414 bits (1064), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 237/314 (75%), Gaps = 2/314 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKGEVL Q  
Sbjct: 1   MRILSEAHFPELPNYYRGKVRENYDLPDGRRIIISTDRLSAFDRILTCIPYKGEVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH LDYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEATKDICPNHVLDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGERE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K  E   G D+P++P EI+ RG+LT  QW+T+S+Y
Sbjct: 121 MYGMRLPDGMRDNQILPEPVITPTSK--EFDGGHDEPLTPTEIVTRGLLTNEQWQTLSTY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG ++A  NGLILVD+KYEFG D   NIILADEIHTPDSSRYW  E+Y  SF  
Sbjct: 179 ALALFARGQEMAANNGLILVDTKYEFGTDGDGNIILADEIHTPDSSRYWLAESYPASFVA 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI AYE ITG +F+ D+S 
Sbjct: 239 GKRPESFDKDFVRAWVAERCDPYKDEIPEIPAELIEQTSAVYIKAYEAITGERFVPDDSG 298

Query: 301 LPPLERIRNNLRKY 314
             PL R+R NL +Y
Sbjct: 299 ETPLARVRTNLTRY 312


>gi|327188985|gb|EGE56174.1| phosphoribosylamidoimidazolesuccinocarboxamide synthase protein
           [Rhizobium etli CNPAF512]
          Length = 331

 Score =  414 bits (1064), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 192/314 (61%), Positives = 237/314 (75%), Gaps = 2/314 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           +RILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 18  VRILSEAHFPELPNYYRGKVRENYDLPDGHRIIISTDRLSAFDRILTCIPYKGQVLTQTA 77

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH +DYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 78  RYWFEATKDICPNHVIDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGERE 137

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K  E   G D+P++P EI+ RG+LT+ QWET+S Y
Sbjct: 138 MYGMRLPDGMRDNQILPEPVITPTSK--EFDGGHDEPLTPAEIVGRGLLTKEQWETLSRY 195

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG  +A E GLILVD+KYEFG D   NIILADEIHTPDSSRYW   +Y  SF  
Sbjct: 196 ALALFARGQAMAAERGLILVDTKYEFGTDGDGNIILADEIHTPDSSRYWLAASYPASFAA 255

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI+AYE ITG +FI D+S 
Sbjct: 256 GKRPESFDKDFVRAWVAERCDPYKDEIPEIPTELIEQTSAVYISAYEAITGERFIPDDSG 315

Query: 301 LPPLERIRNNLRKY 314
             PL R+RNNL +Y
Sbjct: 316 ETPLARVRNNLSRY 329


>gi|325293919|ref|YP_004279783.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Agrobacterium sp. H13-3]
 gi|325061772|gb|ADY65463.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Agrobacterium sp. H13-3]
          Length = 316

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 184/314 (58%), Positives = 243/314 (77%), Gaps = 2/314 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRIL +A IPELPNYY GKVRENY L DG RI I+TDRLSAFD+ + C+PYKG+VL Q  
Sbjct: 1   MRILDEAVIPELPNYYRGKVRENYDLPDGNRIIISTDRLSAFDRILTCVPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH + YPDPNV++G++L++ P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEQTKDICPNHVVSYPDPNVVIGKRLEILPVEVVVRGYLAGTTGTSILTLYKKGQRQ 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K+ +   G D+P++P EI+ + +LT+ QW+T+S Y
Sbjct: 121 MYGMSLPDGMKDNQILPEPVITPTSKAFD--GGHDEPLTPAEIVEKKLLTQEQWDTLSRY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF+RG ++A + GLILVD+KYEFG D+   IILADEIHTPDSSRYW  ETYE+SF  
Sbjct: 179 ALALFKRGQEIAAKQGLILVDTKYEFGTDENGTIILADEIHTPDSSRYWMAETYEESFLN 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D++P+IP+ ++L+TS+ YI AYE+ITG  F+ D+S 
Sbjct: 239 GARPASFDKDFVRAWVAERCDPYKDDVPEIPQELVLQTSRVYIDAYERITGQSFVPDDSG 298

Query: 301 LPPLERIRNNLRKY 314
             PL R+R NL ++
Sbjct: 299 ETPLARVRRNLEQF 312


>gi|15889807|ref|NP_355488.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium tumefaciens str. C58]
 gi|39931997|sp|Q8UCE7|PUR72_AGRT5 RecName: Full=Putative
           phosphoribosylaminoimidazole-succinocarboxamide synthase
           2; AltName: Full=SAICAR synthetase 2
 gi|15157737|gb|AAK88273.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium tumefaciens str. C58]
          Length = 316

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 186/314 (59%), Positives = 242/314 (77%), Gaps = 2/314 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRIL +A IPELPNYY GKVRENY L DG RI I+TDRLSAFDQ + CIPYKG+VL Q  
Sbjct: 1   MRILDEAVIPELPNYYRGKVRENYDLPDGNRIIISTDRLSAFDQILTCIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH + YPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEQTKDICPNHVVSYPDPNVVIGKRLDILPVEVVVRGYLAGTTGTSILTLYKKGERQ 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K+ +   G D+P++P+EI+ + +LT+ QW+T+S Y
Sbjct: 121 MYGMSLPDGMKDNQILPEPVITPTSKAFD--GGHDEPLTPSEIVEKKLLTQEQWDTLSRY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF  G ++A + GLILVD+KYEFG D+   IILADEIHTPDSSRYW  ++Y++SFRE
Sbjct: 179 ALALFRHGQEIAAKQGLILVDTKYEFGTDENGTIILADEIHTPDSSRYWMADSYDESFRE 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D +P IPE+++L+TSQ YI AYE+ITG +F+ D+S 
Sbjct: 239 GKRPASFDKDFVRAWVGERCDPYKDAVPKIPEDLVLQTSQVYIDAYERITGQRFVPDDSG 298

Query: 301 LPPLERIRNNLRKY 314
             PL R+R NL  +
Sbjct: 299 ETPLARVRRNLEPF 312


>gi|190893228|ref|YP_001979770.1| phosphoribosylamidoimidazolesuccinocarboxamide synthase [Rhizobium
           etli CIAT 652]
 gi|190698507|gb|ACE92592.1| phosphoribosylamidoimidazolesuccinocarboxamide synthase protein
           [Rhizobium etli CIAT 652]
          Length = 314

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 236/314 (75%), Gaps = 2/314 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 1   MRILSEAHFPELPNYYRGKVRENYDLLDGHRIIISTDRLSAFDRILTCIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH +DYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEATKDICPNHVIDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGERE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K  E   G D+P++P EI+ RG+LT+ QWET+S Y
Sbjct: 121 MYGMRLPDGMRDNQILPEPVITPTSK--EFDGGHDEPLTPAEIVGRGLLTKEQWETLSRY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG  +A E GLILVD+KYEFG D   NIILADEIHTPDSSRYW   +Y  SF  
Sbjct: 179 ALALFARGQAMAAERGLILVDTKYEFGTDGDGNIILADEIHTPDSSRYWLSASYPASFAA 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI AYE ITG +FI D+S 
Sbjct: 239 GKRPESFDKDFVRAWVAERCDPYKDEIPEIPPELIEQTSAVYIRAYEAITGERFIPDDSG 298

Query: 301 LPPLERIRNNLRKY 314
             PL R+RNNL +Y
Sbjct: 299 ETPLARVRNNLSRY 312


>gi|222106973|ref|YP_002547764.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium vitis S4]
 gi|221738152|gb|ACM39048.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium vitis S4]
          Length = 316

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 240/318 (75%), Gaps = 2/318 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRIL +A+ PELPNYY GKVRENY L DG+RI I+TDRLSAFD+ +ACIPYKG+VL Q  
Sbjct: 1   MRILKEAFFPELPNYYRGKVRENYDLPDGSRIIISTDRLSAFDRILACIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T+DIC NH + YPDP +++G++L + P+E++VRGYLAG T TS+LT YK G+R 
Sbjct: 61  RYWFEQTADICPNHVIAYPDPAIVIGKRLTILPVEVVVRGYLAGTTGTSILTLYKKGQRT 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQKLP  +ITPT+K  E   G D P++P EII  G+LT +QW+ +S Y
Sbjct: 121 MYGMTLPDGMRDNQKLPQAIITPTSK--EFDGGHDAPLTPAEIIDNGLLTPDQWQQLSQY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG + A E GLILVD+KYEFG D+  NI+LADEIHTPDSSRYW  ETYE++F +
Sbjct: 179 ALALFARGQQKAAERGLILVDTKYEFGTDEAGNILLADEIHTPDSSRYWIAETYEQAFAQ 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R+W+  RC+PY+D+IP+IP++++  TS+ YI AYE ITGL F AD+S 
Sbjct: 239 GTRPASFDKDFVRSWVAERCDPYKDDIPEIPQDLVEATSKVYIQAYEAITGLTFQADDSG 298

Query: 301 LPPLERIRNNLRKYTHRH 318
             P +R++ NL  Y  R 
Sbjct: 299 ETPFDRVKANLFSYLDRR 316


>gi|218682337|ref|ZP_03529938.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           etli CIAT 894]
          Length = 314

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/314 (60%), Positives = 236/314 (75%), Gaps = 2/314 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 1   MRILSEAHFPELPNYYRGKVRENYDLPDGRRIIISTDRLSAFDRILTCIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH +DYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEATKDICPNHVIDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGERE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K  E   G D+P++P EI+ RG+LT  QW+ +S+Y
Sbjct: 121 MYGMRLPDGMRDNQILPEPVITPTSK--EFDGGHDEPLTPAEIVTRGLLTAEQWQALSTY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG ++A + GLILVD+KYEFG D   NIILADEIHTPDSSRYW  E+Y  SF  
Sbjct: 179 ALALFARGQEMAAKRGLILVDTKYEFGTDSDGNIILADEIHTPDSSRYWLAESYPASFAA 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI AYE ITG +F+ DNS 
Sbjct: 239 GRRPESFDKDFVRAWVAERCDPYKDEIPEIPVELIEQTSAVYIKAYEAITGERFVPDNSH 298

Query: 301 LPPLERIRNNLRKY 314
             PL R+R+NL  Y
Sbjct: 299 DTPLARVRSNLAPY 312


>gi|209550729|ref|YP_002282646.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209536485|gb|ACI56420.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 314

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/311 (61%), Positives = 234/311 (75%), Gaps = 2/311 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 1   MRILSEAHFPELPNYYRGKVRENYDLPDGRRIIISTDRLSAFDRILTCIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH LDYPD NV++G++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 61  RYWFEATKDICPNHVLDYPDANVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGERE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP PVITPT+K  E   G D+P++P EI+ RG+LT+ QWET+S Y
Sbjct: 121 MYGMRLPDGMRDNQILPEPVITPTSK--EFDGGHDEPLTPAEIVSRGLLTKEQWETLSRY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG ++A + GLILVD+KYEFG D   NIILADEIHTPDSSRYW  E+Y  SF  
Sbjct: 179 ALALFARGQEMAAKRGLILVDTKYEFGTDGDGNIILADEIHTPDSSRYWLAESYPASFAA 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP  +I +TS  YI AYE ITG +F+ D+S 
Sbjct: 239 GKRPESFDKDFVRAWVAERCDPYKDEIPEIPTELIEQTSAVYIRAYEAITGERFVPDDSG 298

Query: 301 LPPLERIRNNL 311
             PL RIR NL
Sbjct: 299 ETPLARIRQNL 309


>gi|222084361|ref|YP_002542890.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium radiobacter K84]
 gi|221721809|gb|ACM24965.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Agrobacterium radiobacter K84]
          Length = 329

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 237/314 (75%), Gaps = 2/314 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           +RILS+A+ PELPNYY GKVRENY L DG+RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 16  LRILSEAHFPELPNYYRGKVRENYDLPDGSRIIISTDRLSAFDRILTCIPYKGQVLTQTA 75

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T DIC NH + YPDPNV+VG++L + P+E++VRGYLAG T TS+LT YK G+R+
Sbjct: 76  RYWFEATKDICPNHVIAYPDPNVVVGKRLDILPVEVVVRGYLAGTTGTSILTLYKKGQRE 135

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD M DNQ LP P+ITPT+K  E   G D+P++P +I+  G+LT  QW+T+S Y
Sbjct: 136 MYGITLPDGMRDNQILPTPIITPTSK--EFDGGHDEPLTPTQIVEGGLLTSEQWQTLSDY 193

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL+LF RG ++A + GLILVD+KYEFG D+   IILADEIHTPDSSRYW  ++Y+ SF +
Sbjct: 194 ALALFARGQEIASKQGLILVDTKYEFGTDENGTIILADEIHTPDSSRYWLADSYQDSFDK 253

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R W+  RC+PY+D IP+IP +++ +TS+ YI AYE ITG  F+ D+  
Sbjct: 254 GTRPASFDKDFVRAWVAERCDPYKDEIPEIPLDLVEQTSKVYIRAYEAITGKSFVPDDRG 313

Query: 301 LPPLERIRNNLRKY 314
             P +R+R +L +Y
Sbjct: 314 ATPRDRVRASLERY 327


>gi|260467484|ref|ZP_05813653.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Mesorhizobium opportunistum WSM2075]
 gi|259028766|gb|EEW30073.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Mesorhizobium opportunistum WSM2075]
          Length = 313

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 229/314 (72%), Gaps = 2/314 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS A+IPELP +Y GKVRENY L+DG RI IATDRLSAFD  +  IP+KGE+L Q  
Sbjct: 1   MRILSDAFIPELPGHYKGKVRENYDLADGRRIIIATDRLSAFDIILTSIPFKGEILTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T+DIC NH L+YPDPNV+VG +L + P+E++VRGYLAG T TS+LT YK G+R 
Sbjct: 61  RYWFEETADICPNHVLEYPDPNVVVGTRLDILPVEIVVRGYLAGTTSTSILTRYKRGERD 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD + DN+KL  PVITPT+K+++   G D+P+S  EI+  G+LT  QW+T+S Y
Sbjct: 121 MYGMRLPDGLRDNEKLAEPVITPTSKAAD--GGHDEPLSKTEILDHGLLTEPQWDTVSGY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL LF RG   A E GLIL D+KYEFG DK   IILADEIHTPDSSRYW   +YE++   
Sbjct: 179 ALKLFARGQARAAERGLILADTKYEFGTDKDGTIILADEIHTPDSSRYWIARSYEQALAN 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDFIR+W+  RC+PY+D +P IP+ I+ + S+ Y  AY+ ITG +F+ D S 
Sbjct: 239 GTRPESFDKDFIRSWVAARCDPYKDTVPKIPDEIVEQASKVYAQAYQAITGKEFLPDVSG 298

Query: 301 LPPLERIRNNLRKY 314
              L+RIR+NL +Y
Sbjct: 299 ETVLDRIRSNLARY 312


>gi|39932001|sp|Q98I23|PUR72_RHILO RecName: Full=Putative
           phosphoribosylaminoimidazole-succinocarboxamide synthase
           2; AltName: Full=SAICAR synthetase 2
          Length = 313

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 230/314 (73%), Gaps = 2/314 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MR LS A+IPELP YY GKVRENY L+DG RI IATDRLSAFD  +  IP+KGE+L Q  
Sbjct: 1   MRTLSDAFIPELPGYYKGKVRENYDLADGRRIIIATDRLSAFDIILTSIPFKGEILTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T+DIC NH L+YPDPNV+VG +L + P+E++VRGYLAG T TS+LT Y+ G+R+
Sbjct: 61  RYWFEETADICPNHVLEYPDPNVVVGTRLDILPVEIVVRGYLAGTTSTSILTRYRRGERE 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD + DN+KL  PVITPT+K+++   G D+P+S  EI+ +G+LT+ QW+T+S Y
Sbjct: 121 MYGMRLPDGLRDNEKLAAPVITPTSKAAD--GGHDEPLSRAEILAQGLLTQAQWDTVSDY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL LF RG   A E GLIL D+KYEFG DK   IILADEIHTPDSSRYW   +YE++   
Sbjct: 179 ALKLFARGQARAAERGLILADTKYEFGTDKNGTIILADEIHTPDSSRYWIAASYEQALAS 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDFIR+W+  RC+PY+D IP IP+ I+ + S+ Y  AYE ITG  F+ D S 
Sbjct: 239 GTRPDSFDKDFIRSWVAARCDPYKDPIPRIPDEIVEQASRIYAQAYEAITGKAFVPDLSG 298

Query: 301 LPPLERIRNNLRKY 314
              L+RIR+NL ++
Sbjct: 299 DTVLDRIRSNLVRF 312


>gi|13472340|ref|NP_103907.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mesorhizobium loti MAFF303099]
 gi|14023086|dbj|BAB49693.1| 5'-phosphoribosyl-4-(N-succinocarboxamide)-5- aminoimidazole
           synthetase [Mesorhizobium loti MAFF303099]
          Length = 337

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/314 (57%), Positives = 230/314 (73%), Gaps = 2/314 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MR LS A+IPELP YY GKVRENY L+DG RI IATDRLSAFD  +  IP+KGE+L Q  
Sbjct: 25  MRTLSDAFIPELPGYYKGKVRENYDLADGRRIIIATDRLSAFDIILTSIPFKGEILTQTA 84

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T+DIC NH L+YPDPNV+VG +L + P+E++VRGYLAG T TS+LT Y+ G+R+
Sbjct: 85  RYWFEETADICPNHVLEYPDPNVVVGTRLDILPVEIVVRGYLAGTTSTSILTRYRRGERE 144

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD + DN+KL  PVITPT+K+++   G D+P+S  EI+ +G+LT+ QW+T+S Y
Sbjct: 145 MYGMRLPDGLRDNEKLAAPVITPTSKAAD--GGHDEPLSRAEILAQGLLTQAQWDTVSDY 202

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL LF RG   A E GLIL D+KYEFG DK   IILADEIHTPDSSRYW   +YE++   
Sbjct: 203 ALKLFARGQARAAERGLILADTKYEFGTDKNGTIILADEIHTPDSSRYWIAASYEQALAS 262

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDFIR+W+  RC+PY+D IP IP+ I+ + S+ Y  AYE ITG  F+ D S 
Sbjct: 263 GTRPDSFDKDFIRSWVAARCDPYKDPIPRIPDEIVEQASRIYAQAYEAITGKAFVPDLSG 322

Query: 301 LPPLERIRNNLRKY 314
              L+RIR+NL ++
Sbjct: 323 DTVLDRIRSNLVRF 336


>gi|296532991|ref|ZP_06895643.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Roseomonas cervicalis ATCC 49957]
 gi|296266679|gb|EFH12652.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Roseomonas cervicalis ATCC 49957]
          Length = 323

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/317 (56%), Positives = 233/317 (73%), Gaps = 11/317 (3%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           +IL  A IPELPN+Y+GKVR+NY L DG RI IATDRLSAFD+ +  +P+KG+VL Q  +
Sbjct: 12  QILRDATIPELPNHYAGKVRDNYDLPDGRRIIIATDRLSAFDRILCAVPFKGQVLTQTAR 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T DIC NH LDYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R++
Sbjct: 72  HWFEQTRDICPNHVLDYPDPNVVIGRRLDILPVEIVVRGYLAGTTGTSILTLYKAGQREM 131

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y   LPD M DNQKLP  +ITPT+K+ +   G D+P++P EI+ R +LT  QWE ++ YA
Sbjct: 132 YGTRLPDGMRDNQKLPQAIITPTSKAFD--GGHDEPLTPAEILERKLLTPAQWEQLNHYA 189

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  +A E GLIL D+KYEFG D +  I+LADEIHTPDSSRYW+  +++  F  G
Sbjct: 190 LALFARGQAMAAERGLILADTKYEFGTDAEGKIVLADEIHTPDSSRYWKAASFQARFEAG 249

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKDF+R+W+  RC+PYRD IP+IPE++IL T+  YI A+E ITG +F     EL
Sbjct: 250 EKPESFDKDFVRSWVAARCDPYRDPIPEIPEDLILATAAVYIEAFEMITGQRF-----EL 304

Query: 302 PP----LERIRNNLRKY 314
           PP    LERIR NL ++
Sbjct: 305 PPAQPVLERIRANLARF 321


>gi|220923609|ref|YP_002498911.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium nodulans ORS 2060]
 gi|219948216|gb|ACL58608.1| SAICAR synthetase [Methylobacterium nodulans ORS 2060]
          Length = 323

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/313 (55%), Positives = 228/313 (72%), Gaps = 2/313 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L++A +PELPN+  GKVR+NY L DG RI I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 12  RVLAEATLPELPNHSRGKVRDNYDLPDGRRILISSDRISAFDRILAAIPFKGQVLTQTAR 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           YWF  T D+C NH LDYPDPNV+V ++L + P+E++VRGYLAG T TS+LT Y+ G R++
Sbjct: 72  YWFEATRDLCPNHVLDYPDPNVVVARRLDILPVEIVVRGYLAGTTATSILTQYRAGLREM 131

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPD M  N++LP  ++TPTTK+ E   G D P++P+ I+ +G+LT+ QWET+S  A
Sbjct: 132 YGHRLPDGMRPNERLPEAILTPTTKAGEG--GHDTPLTPDAILAQGLLTQEQWETVSRAA 189

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG +LA   GLIL D+KYEFG D    I+LADEIHTPDSSRYW   +Y + F  G
Sbjct: 190 LALFARGQELAARRGLILADTKYEFGTDADGRIVLADEIHTPDSSRYWFAASYPERFAAG 249

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKDFIRNW++ RC+PYRD IP IP  ++L T+  YI A+E ITG  FI  +  L
Sbjct: 250 TAPESFDKDFIRNWVVARCDPYRDAIPAIPPEMVLETASVYIRAFETITGETFILPDLSL 309

Query: 302 PPLERIRNNLRKY 314
            PLERIR NLR Y
Sbjct: 310 APLERIRRNLRAY 322


>gi|319781936|ref|YP_004141412.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167824|gb|ADV11362.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 313

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/314 (56%), Positives = 227/314 (72%), Gaps = 2/314 (0%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MR L  A+IPELP +YSGKVRENY L+DG RI IATDRLSAFD  +  IPYKGE+L Q  
Sbjct: 1   MRTLPDAFIPELPGHYSGKVRENYDLADGRRIIIATDRLSAFDIILTSIPYKGEILTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           +YWF  T+DIC NH L+YPDPNV+VG +L + P+E++VRGYLAG T TS+LT YK G R 
Sbjct: 61  RYWFEETADICPNHVLEYPDPNVVVGTRLDILPVEIVVRGYLAGTTSTSILTRYKRGDRD 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +Y   LPD + DN++L  P+ITPT+K++    G D+P+S  EI+ +G+LT+ QW+ +S Y
Sbjct: 121 MYGIRLPDGLRDNERLAEPIITPTSKAAH--GGHDEPLSKAEILEQGLLTQAQWDIVSGY 178

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL LF RG + A E GLIL D+KYEFG D+   IILADEIHTPDSSRYW   +YE++  +
Sbjct: 179 ALRLFARGQQRATERGLILADTKYEFGTDRNGTIILADEIHTPDSSRYWIASSYEQALAD 238

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           G  P   DKDF+R+W+  RCNPY D +P+IP  I+ + S+ Y  AYE ITG +F  D S 
Sbjct: 239 GCRPESFDKDFVRSWVSARCNPYSDPVPEIPAEIVEQASRVYAQAYEAITGKEFSPDLSG 298

Query: 301 LPPLERIRNNLRKY 314
              L+RIR NLR+Y
Sbjct: 299 DSVLDRIRTNLRRY 312


>gi|170749356|ref|YP_001755616.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium radiotolerans JCM 2831]
 gi|170655878|gb|ACB24933.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 325

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 169/313 (53%), Positives = 227/313 (72%), Gaps = 2/313 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           ++L  A +PELP +Y GKVR+NY L DG RI I +DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 12  QVLRDATLPELPRHYRGKVRDNYDLPDGRRILITSDRISAFDRALAAIPFKGQVLTQTAR 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           YWF  T+D+C NH + YPDPNV+VG++L++ P+E++VRGYLAG T TS+LT Y+ G+R +
Sbjct: 72  YWFEQTADLCPNHVIAYPDPNVVVGRRLEILPVEVVVRGYLAGTTSTSILTRYRAGERDM 131

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y +  PD M  NQ+LP  +ITPTTK+ +   G D+P++  EI+ RG+LTR QW T+S  A
Sbjct: 132 YGHRFPDEMRPNQRLPEAIITPTTKAFDG--GHDEPLTEAEILERGLLTRAQWRTVSEAA 189

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  LA E GLIL D+KYEFG D +  I+LADEIHTPDSSRYW  ++Y + F  G
Sbjct: 190 LALFARGTALAAERGLILADTKYEFGTDPEGRIVLADEIHTPDSSRYWFAQSYPERFAAG 249

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKDF+RNW++ RC+PY+D IP+IP  ++L T+  YI AYE ITG +F+  +   
Sbjct: 250 SAPESFDKDFVRNWVVARCDPYKDPIPEIPAEVVLETAAVYIRAYETITGARFVLPDPAE 309

Query: 302 PPLERIRNNLRKY 314
            PLERIR N+  Y
Sbjct: 310 DPLERIRRNIAAY 322


>gi|163793460|ref|ZP_02187435.1| putative phosphoribosylamidoimidazole-succinocarboxamide synthase
           [alpha proteobacterium BAL199]
 gi|159181262|gb|EDP65777.1| putative phosphoribosylamidoimidazole-succinocarboxamide synthase
           [alpha proteobacterium BAL199]
          Length = 323

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 231/313 (73%), Gaps = 2/313 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L  A IPELPN+Y GKVR+NY L DG RI IA+DRLSAFD ++A IP+KGEVL +  +
Sbjct: 12  RVLQDATIPELPNHYRGKVRDNYDLPDGRRIIIASDRLSAFDISLASIPFKGEVLTRTAR 71

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T DIC NH L+YPDPNV++GQ+L++ P+E++VR YLAG T TS+LT YK G+R +
Sbjct: 72  FWFEATHDICPNHVLEYPDPNVVIGQRLEILPVEMVVRDYLAGTTGTSILTMYKAGRRDM 131

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y   LPD++ DN KLP  +ITPT+K++  +   D+P++P++I+ +G+LT  QW T+S YA
Sbjct: 132 YGVRLPDDLRDNAKLPQTIITPTSKAALGSH--DEPLTPDDIVGKGLLTAEQWRTVSDYA 189

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG ++A E GLILVD+KYEFG D    I+LADEIHTPDSSRYW +++Y+     G
Sbjct: 190 LALFARGREMARERGLILVDTKYEFGTDADGRIVLADEIHTPDSSRYWFLDSYQDRVDRG 249

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKDF+RNW++ RCNPY+D IP IP+ ++L+T++ YI A+E ITG  F       
Sbjct: 250 EKPESFDKDFMRNWVVARCNPYKDAIPPIPDEVVLQTAEVYIRAFETITGQPFEIPAMTG 309

Query: 302 PPLERIRNNLRKY 314
             L+RIR NL ++
Sbjct: 310 SVLDRIRRNLARH 322


>gi|126461701|ref|YP_001042815.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126103365|gb|ABN76043.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 319

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/316 (54%), Positives = 233/316 (73%), Gaps = 2/316 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L +A+IPELP+ Y GKVR+ Y L DG R+ I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 6   RVLPEAHIPELPDPYYGKVRDCYDLPDGRRLLISSDRISAFDRILAAIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+DIC NH L YPDPNV++ +++ + P+E++VRGYLAG T TS+LT YK G R++
Sbjct: 66  FWFDATADICPNHVLSYPDPNVVLARRVTILPVEVVVRGYLAGTTGTSVLTLYKQGVREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPD + DN+ LP P+ITPT+K+ +   G D+P++  EI+ +G+LTR QW+ +S+ A
Sbjct: 126 YGHRLPDGLHDNEVLPAPLITPTSKAFDG--GHDEPLTEAEIVAQGLLTRAQWDEVSAKA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  +A E GLILVD+KYEFG+D++  I++ADEIHTPDSSRYW    YE++FR G
Sbjct: 184 LALFARGQAMAAERGLILVDTKYEFGLDEEGRILIADEIHTPDSSRYWIASGYEEAFRTG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR W+  RC+PYRD IP+IP+ +I RTS+ Y+ A+E ITG  F  D S  
Sbjct: 244 QRPPSFDKDVIRAWVAARCDPYRDPIPEIPDEMIRRTSEVYVEAFETITGRPFEPDLSGA 303

Query: 302 PPLERIRNNLRKYTHR 317
            PLERIR NL  Y  R
Sbjct: 304 TPLERIRANLAPYFTR 319


>gi|146278274|ref|YP_001168433.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145556515|gb|ABP71128.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 319

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 167/316 (52%), Positives = 235/316 (74%), Gaps = 2/316 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L +A+IPELPN Y GKVR+ Y L DG R+ I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 6   RVLPEAHIPELPNPYYGKVRDCYDLPDGRRLLISSDRISAFDRILAAIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+DIC NH + YPDPNV++ +++ + P+E++VRGYLAG T TS+LT YK G R++
Sbjct: 66  FWFDATADICPNHVISYPDPNVVLAKRVTILPVEIVVRGYLAGTTGTSVLTLYKQGAREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPD + DN+ LP P+ITPT+K+ +   G D+P++ +EI+ +G+L+  QW+ +S++A
Sbjct: 126 YGHRLPDGLRDNEALPTPIITPTSKAFDG--GHDEPLTASEIVTQGLLSAAQWDEVSAHA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG K+A E GLILVD+KYEFG+D +  I++ADEIHTPDSSRYW    Y+++FR+G
Sbjct: 184 LALFARGQKMAAERGLILVDTKYEFGLDDEGRILIADEIHTPDSSRYWIASGYDEAFRDG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR+W+  RC+PYRD IP+IP+ +I RTS  Y+ A+E ITG  F  D S  
Sbjct: 244 SRPPSFDKDVIRSWVAARCDPYRDAIPEIPDEMIRRTSDVYVEAFETITGRPFEPDLSGA 303

Query: 302 PPLERIRNNLRKYTHR 317
            PL+RIR NL  +  R
Sbjct: 304 TPLDRIRANLASFFTR 319


>gi|77462809|ref|YP_352313.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides 2.4.1]
 gi|77387227|gb|ABA78412.1| SAICAR synthetase [Rhodobacter sphaeroides 2.4.1]
          Length = 319

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 172/316 (54%), Positives = 233/316 (73%), Gaps = 2/316 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L +A+IPELP+ Y GKVR+ Y L DG R+ I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 6   RVLPEAHIPELPDPYYGKVRDCYDLPDGRRLLISSDRISAFDRILAAIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  TSDIC NH L YPDPNV++ +++ + P+E++VRGYLAG T TS+LT YK G R++
Sbjct: 66  FWFDATSDICPNHVLSYPDPNVVLARRVTILPVEVVVRGYLAGTTGTSVLTLYKQGVREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPD + DN+ LP P+ITPT+K+ +   G D+P++  EI+ +G+LTR QW+ +S+ A
Sbjct: 126 YGHRLPDGLRDNEVLPAPLITPTSKAFDG--GHDEPLTEAEIVAQGLLTRAQWDEVSAKA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  +A E GLILVD+KYEFG+D++  I++ADEIHTPDSSRYW    YE++FR G
Sbjct: 184 LALFARGQAMAAERGLILVDTKYEFGLDEEGRILIADEIHTPDSSRYWIASGYEEAFRTG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR W+  RC+PYRD IP+IP+ +I RTS+ YI A+E ITG  F  D S  
Sbjct: 244 QRPPSFDKDVIRAWVAARCDPYRDPIPEIPDEMIRRTSEVYIEAFETITGRPFEPDLSGA 303

Query: 302 PPLERIRNNLRKYTHR 317
            PLERIR NL  +  R
Sbjct: 304 TPLERIRANLAPHFTR 319


>gi|332557696|ref|ZP_08412018.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides WS8N]
 gi|332275408|gb|EGJ20723.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides WS8N]
          Length = 319

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 170/316 (53%), Positives = 233/316 (73%), Gaps = 2/316 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L +A+IPELP+ Y GKVR+ Y L DG R+ I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 6   RVLPEAHIPELPDPYYGKVRDCYDLPDGRRLLISSDRISAFDRILAAIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+DIC NH L YPDPNV++ +++ + P+E++VRGYLAG T TS+LT YK G R++
Sbjct: 66  FWFDATADICPNHVLSYPDPNVVLARRVTILPVEVVVRGYLAGTTGTSVLTLYKQGVREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPD + DN+ LP P+ITPT+K+ +   G D+P++  EI+ +G+LTR QW+ +S+ A
Sbjct: 126 YGHRLPDGLRDNEVLPAPLITPTSKAFDG--GHDEPLTEAEIVAQGLLTRAQWDEVSAKA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  +A E GLILVD+KYEFG+D++  I++ADEIHTPDSSRYW    YE++FR G
Sbjct: 184 LALFARGQAMAAERGLILVDTKYEFGLDEEGRILIADEIHTPDSSRYWIASGYEEAFRTG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR W+  RC+PYRD IP+IP+ +I RTS+ Y+ A+E ITG  F  D +  
Sbjct: 244 QRPPSFDKDVIRAWVAARCDPYRDPIPEIPDEMIRRTSEVYVEAFETITGRPFEPDLAGA 303

Query: 302 PPLERIRNNLRKYTHR 317
            PLERIR NL  Y  R
Sbjct: 304 TPLERIRANLAPYFTR 319


>gi|221638675|ref|YP_002524937.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides KD131]
 gi|221159456|gb|ACM00436.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacter sphaeroides KD131]
          Length = 319

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/316 (54%), Positives = 232/316 (73%), Gaps = 2/316 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L +A+IPELP+ Y GKVR+ Y L DG R+ I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 6   RVLPEAHIPELPDPYYGKVRDCYDLPDGRRLLISSDRISAFDRILAAIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T+DIC NH + YPDPNV++ +++ + P+E++VRGYLAG T TS+LT YK G R++
Sbjct: 66  FWFDATADICPNHVISYPDPNVVLARRVTILPVEVVVRGYLAGTTGTSVLTLYKQGVREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y + LPD + DN+ LP P+ITPT+K+ +   G D+P++  EI+ +G+LTR QW+ +S+ A
Sbjct: 126 YGHRLPDGLRDNEVLPAPLITPTSKAFDG--GHDEPLTEAEIVSQGLLTRAQWDEVSAKA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF RG  +A E GLILVD+KYEFG+D +  I++ADEIHTPDSSRYW    YE++FR G
Sbjct: 184 LALFARGQAMAAERGLILVDTKYEFGLDGEGRILIADEIHTPDSSRYWIASGYEEAFRTG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR W+  RC+PYRD IP+IP+ +I RTS+ YI A+E ITG  F  D S  
Sbjct: 244 QRPPSFDKDVIRAWVAARCDPYRDPIPEIPDEMIRRTSEVYIEAFETITGRPFEPDLSGA 303

Query: 302 PPLERIRNNLRKYTHR 317
            PLERIR NL  Y  R
Sbjct: 304 TPLERIRANLAPYFTR 319


>gi|16127472|ref|NP_422036.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caulobacter crescentus CB15]
 gi|221236286|ref|YP_002518723.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caulobacter crescentus NA1000]
 gi|39932002|sp|Q9A3G2|PUR72_CAUCR RecName: Full=Putative
           phosphoribosylaminoimidazole-succinocarboxamide synthase
           2; AltName: Full=SAICAR synthetase 2
 gi|13424928|gb|AAK25204.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Caulobacter crescentus CB15]
 gi|220965459|gb|ACL96815.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Caulobacter crescentus NA1000]
          Length = 320

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 160/311 (51%), Positives = 224/311 (72%), Gaps = 2/311 (0%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L+   +P LPN+Y GKVR+NY L DG R+ +A+DRLSAFD+N+  +P KG+VL +  ++W
Sbjct: 9   LAVVDLPCLPNHYRGKVRDNYDLPDGRRVIVASDRLSAFDRNLCAVPGKGQVLTETARFW 68

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F  T+DIC NH + YPDPNVL+G++L+M P+EL+VRGYLAG T TS+LT Y  G+R++Y 
Sbjct: 69  FDATADICPNHVVAYPDPNVLIGKRLKMLPVELVVRGYLAGTTSTSILTLYNKGERQMYG 128

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LPD +  NQ+LP  ++TPT+K+++     D P+SP+E++ +G++T  QWE +S+YAL+
Sbjct: 129 VTLPDGLKANQRLPQAILTPTSKAADGDH--DAPLSPDEVLAQGLVTPAQWEQLSAYALA 186

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF RG  +A E GLIL D+KYEFG+D+   I+LADEIHTPDSSR+W+  TYE  F  G  
Sbjct: 187 LFARGQAMAAERGLILADTKYEFGLDETGAIVLADEIHTPDSSRFWKAATYEARFEAGQR 246

Query: 244 PIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPP 303
           P   DKDF+R W+  RC+PY D+IP+IP  +I + S  YI A+E ITG  F A ++  P 
Sbjct: 247 PESFDKDFVRAWVAERCDPYNDSIPEIPAELIAQASAVYIEAFEAITGQTFAAPDASEPV 306

Query: 304 LERIRNNLRKY 314
           + R++ NL  Y
Sbjct: 307 MARVKRNLDAY 317


>gi|83855066|ref|ZP_00948596.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfitobacter sp. NAS-14.1]
 gi|83842909|gb|EAP82076.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfitobacter sp. NAS-14.1]
          Length = 319

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 171/313 (54%), Positives = 226/313 (72%), Gaps = 2/313 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R L  A I ELPN Y GKVR+ Y L D  RI I++DR+SAFD+ +  IP+KG+VL Q  +
Sbjct: 6   RTLDHARIDELPNPYFGKVRDCYDLPDDRRILISSDRISAFDRILTSIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF +TSDIC NH LDYPDPNV++G+ L + P+E++VRGYLAG+T TS+LT YK G+R++
Sbjct: 66  FWFDNTSDICPNHVLDYPDPNVVIGKHLTILPVEIVVRGYLAGSTGTSVLTLYKKGEREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y +  PD + DNQ LP P+ITPT+K  E   G D P++  EI+ +G+LT+ QW+ IS  A
Sbjct: 126 YGHRFPDGLRDNQALPAPIITPTSK--EFDGGHDAPLTAQEIVDQGLLTQAQWDQISDIA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L LF RG ++A +NGLILVD+KYEFG D + NI+LADEIHTPDSSR+W  E Y+ +   G
Sbjct: 184 LKLFARGQEMAAKNGLILVDTKYEFGTDAQGNILLADEIHTPDSSRFWLAEGYDAALENG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR+W+  RC+PY D+IP+IP ++I  TSQ YI AYE ITG +F+ D    
Sbjct: 244 TRPPSFDKDVIRSWVDARCDPYHDDIPEIPADLIAATSQVYIDAYEAITGQRFVPDLEGD 303

Query: 302 PPLERIRNNLRKY 314
             L+R+R+NLR Y
Sbjct: 304 TVLDRVRHNLRPY 316


>gi|83941590|ref|ZP_00954052.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfitobacter sp. EE-36]
 gi|83847410|gb|EAP85285.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sulfitobacter sp. EE-36]
          Length = 319

 Score =  365 bits (937), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 169/313 (53%), Positives = 226/313 (72%), Gaps = 2/313 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R L  A I ELPN Y GKVR+ Y L D  RI I++DR+SAFD+ +  IP+KG+VL Q  +
Sbjct: 6   RTLDHARIDELPNPYFGKVRDCYDLPDDRRILISSDRISAFDRILTSIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF +TSDIC NH LDYPDPNV++G+ L + P+E++VRGYLAG+T TS+LT YK G+R++
Sbjct: 66  FWFDNTSDICPNHVLDYPDPNVVIGKHLTILPVEIVVRGYLAGSTGTSVLTLYKKGEREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y +  PD + DNQ LP P+ITPT+K  E   G D P++  EI+ +G+LT+ QW+ IS  A
Sbjct: 126 YGHRFPDGLRDNQALPAPIITPTSK--EFDGGHDAPLTAQEIVDQGLLTQAQWDQISDIA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L LF RG ++A +NGLILVD+KYEFG D + NI+LADEIHTPDSSR+W  + Y+ +   G
Sbjct: 184 LKLFARGQEMAAKNGLILVDTKYEFGTDAQGNILLADEIHTPDSSRFWLADGYDAALDNG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR+W+  RC+PY D+IP+IP ++I  TSQ YI A+E ITG +F+ D    
Sbjct: 244 TRPPSFDKDVIRSWVDARCDPYHDDIPEIPADLIAATSQVYIDAFEAITGQRFVPDLEGD 303

Query: 302 PPLERIRNNLRKY 314
             L+R+R+NLR Y
Sbjct: 304 TVLDRVRHNLRPY 316


>gi|170741807|ref|YP_001770462.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylobacterium sp. 4-46]
 gi|168196081|gb|ACA18028.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Methylobacterium sp. 4-46]
          Length = 325

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 162/311 (52%), Positives = 218/311 (70%), Gaps = 2/311 (0%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L++A +P+LPNY  GKVR+NY L DG RI I++DR+SAFD+ +A IP KG+VL Q  ++W
Sbjct: 14  LAEAVLPDLPNYVRGKVRDNYDLPDGRRILISSDRISAFDRILAAIPLKGQVLTQTARFW 73

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F  T D+C NH L YPDPNV+V ++L + P+E++VRGYLAG T TS+LT Y+ G+R++Y 
Sbjct: 74  FEATRDLCPNHVLAYPDPNVVVARRLTILPVEIVVRGYLAGTTATSILTLYRAGQREMYG 133

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
           + LP+ +  N+KL   ++TPT+K+ E   G D P++P  I+ +G+LT  QW T+S  AL+
Sbjct: 134 HRLPEGLRPNEKLAQAILTPTSKAGEG--GHDAPLTPEAILAQGLLTEAQWRTVSETALA 191

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF RG  LA   GLIL D+KYEFG D +  I+LADEIHTPDSSRYW   +Y   F  G  
Sbjct: 192 LFARGQDLAARRGLILADTKYEFGTDAQGRIVLADEIHTPDSSRYWFAGSYPARFAAGEA 251

Query: 244 PIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPP 303
           P   DKDF+RNW++ RC+PYRD IP IP  +++ T+  Y+ A+E ITG  F   +   PP
Sbjct: 252 PESFDKDFVRNWVVARCDPYRDPIPAIPPEVVMETALVYVRAFETITGQPFALPDPAEPP 311

Query: 304 LERIRNNLRKY 314
           L RIR NLR Y
Sbjct: 312 LARIRRNLRTY 322


>gi|260575349|ref|ZP_05843349.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodobacter sp. SW2]
 gi|259022609|gb|EEW25905.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodobacter sp. SW2]
          Length = 325

 Score =  362 bits (929), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 166/318 (52%), Positives = 227/318 (71%), Gaps = 7/318 (2%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFL-SDGT----RITIATDRLSAFDQNIACIPYKGEVL 56
           R+L  A+I ELPN Y GKVR+ Y L +D T    RI I++DR+SAFD+ +A IP+KG+VL
Sbjct: 6   RVLDHAHIAELPNPYYGKVRDCYDLPADATHGPRRILISSDRISAFDRILAAIPWKGQVL 65

Query: 57  NQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
            Q+ ++WF  T+DIC NH L YPDPNV++G+ L + P+E++VRGYLAG T TS+LT YK 
Sbjct: 66  TQVARFWFDRTADICPNHVLSYPDPNVVIGEHLTILPVEIVVRGYLAGTTGTSVLTLYKQ 125

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G R++Y + LPD + DNQ LP P+ITPT+K+ +   G D+P++  EI+ +G+LT+ QW+ 
Sbjct: 126 GARQMYGHSLPDGLRDNQALPAPIITPTSKAFDG--GHDEPLTATEIVAQGLLTQAQWDE 183

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +++ +L+LF RG ++A + GLILVD+KYEFG D    I LADEIHTPDSSRYW    Y +
Sbjct: 184 VAAVSLALFARGQQIAAKRGLILVDTKYEFGTDAAGTIKLADEIHTPDSSRYWIASGYAE 243

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
           +F  G  P   DKD IR+W+  RC+PY D IP+IP  +I  T+Q YI AY+ ITG  F+ 
Sbjct: 244 AFANGSRPPSFDKDVIRSWVAARCDPYHDPIPEIPAEMIAATAQVYIDAYQAITGQTFVP 303

Query: 297 DNSELPPLERIRNNLRKY 314
           D+S   PL+R+R NL  Y
Sbjct: 304 DSSGATPLDRVRANLAPY 321


>gi|288962273|ref|YP_003452568.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Azospirillum sp. B510]
 gi|288914539|dbj|BAI76024.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Azospirillum sp. B510]
          Length = 330

 Score =  358 bits (919), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 164/316 (51%), Positives = 223/316 (70%), Gaps = 6/316 (1%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSD----GTRITIATDRLSAFDQNIACIPYKGEVLNQ 58
           +L  A+IPELPN+Y GKVRENY L D      RI I TDRLSAFD+ +  IP+KG+VL Q
Sbjct: 14  VLRDAFIPELPNHYRGKVRENYDLPDQGDGARRILITTDRLSAFDRILTAIPFKGQVLTQ 73

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
             ++WF  T DIC+NH L+YPDPNV+V ++L + P+E++VR Y+AG T TS+ + YK G+
Sbjct: 74  TARFWFEATKDICANHVLEYPDPNVVVAKRLTIMPVEIVVRDYMAGTTGTSIWSMYKQGR 133

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R++Y ++ PD +  NQKL  P+ITPTTK+ ++  G D+ ++  EI+ R +LT  QW+ +S
Sbjct: 134 REMYGHVFPDGLRQNQKLDAPIITPTTKAFDA--GHDEELTATEIVGRNLLTSAQWDEVS 191

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
             AL+LF RG K+A E GLILVD+KYEFG D   NI+LADEIHTPDSSRYW   +Y++ F
Sbjct: 192 EKALALFARGQKMAAERGLILVDTKYEFGFDADGNILLADEIHTPDSSRYWFAGSYQERF 251

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADN 298
             G  P   DKDF+RNW++ RC+PY  +IP+IP +++L  ++ YI A E ITG  F    
Sbjct: 252 ESGGKPESFDKDFVRNWVVARCDPYTQDIPEIPGDVVLEAARVYIEAGETITGRPFEVPA 311

Query: 299 SELPPLERIRNNLRKY 314
           + +P L+RIR NL  Y
Sbjct: 312 TAVPVLDRIRANLAPY 327


>gi|217979155|ref|YP_002363302.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylocella silvestris BL2]
 gi|217504531|gb|ACK51940.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Methylocella silvestris BL2]
          Length = 330

 Score =  357 bits (917), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 168/315 (53%), Positives = 220/315 (69%), Gaps = 2/315 (0%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
           +L  A+IPELPNYY GKVRENY L +G RI IATDR+SAFDQN+A IP+KG+VL  I ++
Sbjct: 18  LLEDAFIPELPNYYRGKVRENYDLPNGERILIATDRVSAFDQNLASIPFKGQVLTDIARF 77

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF  T+DIC NH    PDPNV+V ++L+M P+E+IVR YLAG+T TS+LT YK G R++Y
Sbjct: 78  WFEATADICPNHVRANPDPNVVVVERLEMMPVEIIVRDYLAGSTATSILTMYKAGARRMY 137

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
                D +  N+KLP  ++TPT+K+   +   D P++ +EI+  G+LT  QWE +   AL
Sbjct: 138 GLDFADGLRANEKLPQTIVTPTSKAGHGSH--DAPLTADEILDSGLLTPRQWEDVCEKAL 195

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
           +LF RG ++A   GLIL D+KYEFG + + +I+LADEIHTPDSSRYW  ETY +    G 
Sbjct: 196 ALFTRGREIAAGRGLILADTKYEFGFNAEGHIVLADEIHTPDSSRYWLEETYPERLESGG 255

Query: 243 TPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
            P  LDKDFIRNW+  RC+PYRD IP IP ++IL  + TYI  +E I+G  F+    +  
Sbjct: 256 APDSLDKDFIRNWVSARCDPYRDPIPQIPPDVILEAAATYIRTFETISGRSFVFPEDQSA 315

Query: 303 PLERIRNNLRKYTHR 317
           PL+RIR NL  Y  R
Sbjct: 316 PLDRIRANLAFYWTR 330


>gi|254487363|ref|ZP_05100568.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. GAI101]
 gi|214044232|gb|EEB84870.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Roseobacter sp. GAI101]
          Length = 319

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 167/313 (53%), Positives = 223/313 (71%), Gaps = 2/313 (0%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           RIL  A I ELPN Y GKVR+ Y L DG RI I++DR+SAFD+ +A IP+KG+VL Q  +
Sbjct: 6   RILDHARIDELPNPYFGKVRDCYDLPDGRRILISSDRISAFDRILASIPFKGQVLTQTAR 65

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF HT+DIC NH LDYPDPNV++G++L + PIE++VRGYLAG+T TS+LT YK G+R++
Sbjct: 66  FWFDHTTDICPNHVLDYPDPNVVIGKRLDILPIEIVVRGYLAGSTGTSVLTLYKKGEREM 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
           Y +  PD + DN+ LP  +ITPT+K  E   G D P++  EI+ +G+LT+ QW+ IS  A
Sbjct: 126 YGHRFPDGLRDNEALPQAIITPTSK--EFDGGHDAPLTATEIVEQGLLTQAQWDEISDIA 183

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L LF RG ++A +NGLILVD+KYEFG D    ++LADEIHTPDSSR+W  + Y+ +   G
Sbjct: 184 LRLFARGQEMAAQNGLILVDTKYEFGTDADGKLMLADEIHTPDSSRFWLADGYQSALENG 243

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DKD IR+W+  RC+PY D+IP+IP ++I  TSQ YI AY+ ITG  F  +    
Sbjct: 244 TRPPSFDKDVIRSWVDARCDPYVDDIPEIPADLIAATSQVYIDAYQAITGQIFEPNMDGD 303

Query: 302 PPLERIRNNLRKY 314
             L+R+R NL  Y
Sbjct: 304 TVLDRVRANLAPY 316


>gi|83311130|ref|YP_421394.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Magnetospirillum magneticum AMB-1]
 gi|82945971|dbj|BAE50835.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Magnetospirillum magneticum AMB-1]
          Length = 325

 Score =  342 bits (877), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 158/312 (50%), Positives = 215/312 (68%), Gaps = 2/312 (0%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
           +L++A  PELPNYY GKVRENY L DG RI I+TDR SAFDQ +A +P+KG+VL Q  ++
Sbjct: 14  VLTEAEFPELPNYYRGKVRENYDLPDGRRILISTDRQSAFDQVLAAVPFKGQVLTQTARF 73

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF  T DIC NH ++YPDPNV+VG++L M PIE++VR YL G+T TS+ + YK G+R +Y
Sbjct: 74  WFEATKDICPNHVIEYPDPNVVVGRRLDMLPIEMVVRDYLTGSTDTSIWSMYKAGRRTMY 133

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
                D M  N KLP  ++TPTTK+     G D P+SP E++ RG+L++ QW+ ++  +L
Sbjct: 134 GLDFADGMVKNDKLPATILTPTTKA--DVGGHDAPVSPAEVVARGLLSQAQWDELARLSL 191

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
           +LF RG ++A  +GLILVD+K+EFG+D    I LADEI TPDSSRYW+ ++Y     +G 
Sbjct: 192 ALFARGREIAARHGLILVDTKFEFGVDADGRITLADEILTPDSSRYWKADSYGARHAKGE 251

Query: 243 TPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
            P  LDK+F+R WI  RC+PY   IP IP++ ++  S  YI+ YE +TG  F A ++   
Sbjct: 252 EPESLDKEFLRIWIAARCDPYTQPIPVIPDDTLVEFSAKYISLYETVTGQTFEAPSAAET 311

Query: 303 PLERIRNNLRKY 314
             ERIR NL  Y
Sbjct: 312 VKERIRRNLAPY 323


>gi|23013287|ref|ZP_00053200.1| COG0152: Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
           synthase [Magnetospirillum magnetotacticum MS-1]
          Length = 325

 Score =  341 bits (875), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 158/312 (50%), Positives = 217/312 (69%), Gaps = 2/312 (0%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQY 62
           +L++A  PELPNYY GKVRENY L DG RI I+TDR SAFDQ +A +P+KG+VL Q  ++
Sbjct: 14  VLTEAEFPELPNYYRGKVRENYDLPDGRRILISTDRQSAFDQVLAAVPFKGQVLTQTARF 73

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF  T DIC NH ++YPDPNV+VG++L M PIE++VR YL G+T TS+ + YK G+R +Y
Sbjct: 74  WFEATKDICPNHVIEYPDPNVVVGKRLDMLPIEMVVRDYLTGSTDTSIWSMYKAGRRNMY 133

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
                D M  N KLP  ++TPTTK+     G D PISP +++ RG+LT+ QW+ ++  +L
Sbjct: 134 GLDFADGMVKNDKLPLTILTPTTKA--DVGGHDAPISPADVVARGLLTQAQWDELARLSL 191

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
           +LF RG ++A ++GLILVD+K+EFG+D +  I LADEI TPDSSRYW+ ++Y        
Sbjct: 192 ALFARGREIAAKHGLILVDTKFEFGVDGQGRITLADEILTPDSSRYWKADSYAGRHARAE 251

Query: 243 TPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
            P  LDK+F+R WI  RC+PY   IP IP++ ++  S  YI+ +E +TGL F A +S   
Sbjct: 252 EPESLDKEFLRIWIAARCDPYTQPIPVIPDDTLVEFSAKYISLFETVTGLPFEAPSSAET 311

Query: 303 PLERIRNNLRKY 314
             +RIR NL +Y
Sbjct: 312 VKDRIRRNLARY 323


>gi|126724328|ref|ZP_01740171.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacterales bacterium HTCC2150]
 gi|126705492|gb|EBA04582.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodobacterales bacterium HTCC2150]
          Length = 328

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 151/310 (48%), Positives = 202/310 (65%), Gaps = 2/310 (0%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L+    PELP +   KVR+ Y L  G R+ I+TDR SAFDQ +   P KG+VL Q  +YW
Sbjct: 15  LTDTEFPELPGFTRNKVRDTYKLPGGRRLLISTDRQSAFDQILTATPNKGQVLTQTARYW 74

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F  T+DIC N  + YPDPNV++ + L M PIE++VR YL G+T TS+   Y+ G+R IY 
Sbjct: 75  FDATADICPNQVISYPDPNVVLVKDLDMLPIEIVVRAYLTGSTNTSVWPMYERGERVIYG 134

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
           +   D  S NQKLP  +ITPTTK      G D PI+  EI+  G+LT +QW  IS  +L+
Sbjct: 135 HEFADGYSKNQKLPEAIITPTTKPD--GGGHDAPITAAEILETGLLTADQWADISKKSLA 192

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF RG KLA E GLILVD+KYEFG+D+   I++ADEIHTPDSSR+W  + Y++    G+ 
Sbjct: 193 LFARGQKLAAEKGLILVDTKYEFGVDENGVIVIADEIHTPDSSRFWIADVYQERVDAGLE 252

Query: 244 PIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPP 303
           P  LDK+F+R W++ +C+PY D IP+IP+  +L  S  YIA +E +TGL F   +  +  
Sbjct: 253 PESLDKEFLRLWVVGQCDPYNDPIPEIPDETVLEFSNKYIALFETVTGLTFDRPDPAISV 312

Query: 304 LERIRNNLRK 313
            +RIR  L K
Sbjct: 313 KDRIRAALVK 322


>gi|218507717|ref|ZP_03505595.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           etli Brasil 5]
          Length = 245

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 143/245 (58%), Positives = 181/245 (73%), Gaps = 2/245 (0%)

Query: 70  ICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDN 129
           IC NH +DYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G+R++Y   LPD 
Sbjct: 1   ICPNHVIDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKGEREMYGMRLPDG 60

Query: 130 MSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGC 189
           M DNQ LP  +ITPT+K  E   G D+P++P+EI+ RG+LT+ QWET+S YAL+LF RG 
Sbjct: 61  MRDNQILPEAIITPTSK--EFDGGHDEPLTPDEIVGRGLLTKEQWETLSRYALALFARGQ 118

Query: 190 KLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
            +A E GLILVD+KYEFG D   NIILADEIHTPDSSRYW   +Y  SF  G  P   DK
Sbjct: 119 TMAAERGLILVDTKYEFGTDGDGNIILADEIHTPDSSRYWLAASYPASFAAGKRPESFDK 178

Query: 250 DFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRN 309
           DF+R W+  RC+PY+D IP+IP  +I +TS  YI AYE ITG +FI D+S   PL R+RN
Sbjct: 179 DFVRAWVAERCDPYKDEIPEIPTELIEQTSAVYIRAYEAITGERFIPDDSGETPLARVRN 238

Query: 310 NLRKY 314
           NL +Y
Sbjct: 239 NLSRY 243


>gi|42526200|ref|NP_971298.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Treponema
           denticola ATCC 35405]
 gi|41816312|gb|AAS11179.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Treponema
           denticola ATCC 35405]
          Length = 316

 Score =  288 bits (738), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 141/302 (46%), Positives = 200/302 (66%), Gaps = 4/302 (1%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDIC 71
           LP+  +GKVR+ Y   +G R+ + TDR+SAFD+ +  +PYKG+VLNQ++ +WF +T DI 
Sbjct: 15  LPSKQTGKVRDWYSPEEGKRLIVTTDRISAFDRVLTALPYKGQVLNQLSLWWFENTKDII 74

Query: 72  SNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMS 131
            NH +  PDPN ++  +++  PIE+IVRGY+ G T T+L   Y  G+R IY Y  P+ + 
Sbjct: 75  KNHIISCPDPNCIIVTEVKPLPIEVIVRGYITGVTSTALWYRYSLGERNIYGYDFPEGLK 134

Query: 132 DNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKL 191
            NQ LP P+ITPTTK     +G D+ ++ +E++ +G L++ QW+ +   AL+LFERG K 
Sbjct: 135 KNQALPKPIITPTTKG--GPTGHDERLTCDEVVSQGYLSKEQWDFVQKAALALFERGQKS 192

Query: 192 ALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDF 251
           A E GLILVD+KYEFG+DK  NI+L DE+HTPDSSRYW+++TYE+  +EG  P   DK+F
Sbjct: 193 AKEAGLILVDTKYEFGVDKNNNILLIDEVHTPDSSRYWKLDTYEQRLKEGKEPENFDKEF 252

Query: 252 IRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNL 311
           +R     +       IP++ EN+     Q YI AYEK+T  KF+    E P  ERI  NL
Sbjct: 253 VRMAYAAKGYRGDGEIPELDENVWNEAIQLYITAYEKLTKSKFVP--GEYPAEERIVKNL 310

Query: 312 RK 313
           +K
Sbjct: 311 KK 312


>gi|52841903|ref|YP_095702.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52629014|gb|AAU27755.1| phosphoribosylimidazole-succinocarboxamide synthase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 331

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 140/300 (46%), Positives = 199/300 (66%), Gaps = 6/300 (2%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           Y GKVR+ Y L D   I + TDR SAFD+ +A +PYKG+VLN  + +WF +T  I  NH 
Sbjct: 35  YKGKVRDTYDLGD-QLILVTTDRQSAFDRCLAAVPYKGQVLNLTSAWWFKNTQSIVPNHL 93

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
           +  PDPNV + ++ ++FPIE +VRGY++G+T TSL T Y+ G R+      PD +  NQK
Sbjct: 94  IAVPDPNVAIAKKCKIFPIEFVVRGYISGSTSTSLWTQYQKGVREYCGITFPDGLRKNQK 153

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           L  PVITPTTK +      D+PISP+EI+  G +T+  W+  SSYAL LF+ G ++A ++
Sbjct: 154 LESPVITPTTKETLH----DRPISPHEIVAEGWMTQEDWDETSSYALKLFQHGMEVAQQH 209

Query: 196 GLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNW 255
           GLILVD+KYEFG D +  I+L DEIHTPDSSRYW    Y++ F  G  P  +DK+F+R W
Sbjct: 210 GLILVDTKYEFGRDAEGRIVLVDEIHTPDSSRYWLFNGYQERFDAGKEPENIDKEFLRLW 269

Query: 256 ILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKY 314
            +  C+PY+D + P  P+ +I+  +  YI  YE ITG  F+ D++  P  +RI +N++++
Sbjct: 270 FVDHCDPYKDEVLPQAPQELIVTLASRYIQLYEMITGESFVYDSNPGPVNDRILHNIQRW 329


>gi|148359212|ref|YP_001250419.1| phosphoribosylimidazole-succinocarboxamidesynthase [Legionella
           pneumophila str. Corby]
 gi|296107256|ref|YP_003618956.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella pneumophila 2300/99 Alcoy]
 gi|148280985|gb|ABQ55073.1| phosphoribosylimidazole-succinocarboxamidesynthase [Legionella
           pneumophila str. Corby]
 gi|295649157|gb|ADG25004.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella pneumophila 2300/99 Alcoy]
          Length = 326

 Score =  288 bits (737), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 140/300 (46%), Positives = 199/300 (66%), Gaps = 6/300 (2%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           Y GKVR+ Y L D   I + TDR SAFD+ +A +PYKG+VLN  + +WF +T  I  NH 
Sbjct: 30  YKGKVRDTYDLGD-QLILVTTDRQSAFDRCLAAVPYKGQVLNLTSAWWFKNTQSIVPNHL 88

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
           +  PDPNV + ++ ++FPIE +VRGY++G+T TSL T Y+ G R+      PD +  NQK
Sbjct: 89  IAVPDPNVAIAKKCKIFPIEFVVRGYISGSTSTSLWTQYQKGVREYCGITFPDGLRKNQK 148

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           L  PVITPTTK +      D+PISP+EI+  G +T+  W+  SSYAL LF+ G ++A ++
Sbjct: 149 LESPVITPTTKETLH----DRPISPHEIVAEGWMTQEDWDETSSYALKLFQHGMEVAQQH 204

Query: 196 GLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNW 255
           GLILVD+KYEFG D +  I+L DEIHTPDSSRYW    Y++ F  G  P  +DK+F+R W
Sbjct: 205 GLILVDTKYEFGRDAEGRIVLVDEIHTPDSSRYWLFNGYQERFDAGKEPENIDKEFLRLW 264

Query: 256 ILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKY 314
            +  C+PY+D + P  P+ +I+  +  YI  YE ITG  F+ D++  P  +RI +N++++
Sbjct: 265 FVDHCDPYKDEVLPQAPQELIVTLASRYIQLYEMITGESFVYDSNPGPVNDRILHNIQRW 324


>gi|307610376|emb|CBW99945.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Legionella pneumophila 130b]
          Length = 326

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 200/300 (66%), Gaps = 6/300 (2%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           Y GKVR+ Y L D   I + TDR SAFD+ +A +PYKG+VLN  + +WF +T  I  NH 
Sbjct: 30  YKGKVRDTYDLGDQL-ILVTTDRQSAFDRCLAAVPYKGQVLNLTSVWWFKNTQSIVPNHL 88

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
           +  PDPNV + ++ ++FP+E +VRGY++G+T TSL T Y+ G R+      PD +  NQK
Sbjct: 89  IAVPDPNVAIAKKCKIFPVEFVVRGYISGSTSTSLWTQYQKGVREYCGITFPDGLRKNQK 148

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           L  PVITPTTK +      D+PISP+EI+  G +T+  W+  SSYAL LF+ G ++A ++
Sbjct: 149 LESPVITPTTKETIH----DRPISPHEIVAEGWMTQEDWDETSSYALRLFQHGMEVAQQH 204

Query: 196 GLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNW 255
           GLILVD+KYEFG D +  I+L DEIHTPDSSRYW   +Y++ F  G  P  +DK+F+R W
Sbjct: 205 GLILVDTKYEFGRDAEGRIVLVDEIHTPDSSRYWLFNSYQERFDAGKEPENIDKEFLRLW 264

Query: 256 ILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKY 314
            +  C+PY+D + P  P+ +I+  +  YI  YE ITG  F+ D++  P  +RI +N++++
Sbjct: 265 FVDHCDPYKDEVLPQAPQELIVTLASRYIQLYEMITGESFVYDSNPGPVNDRILHNIQRW 324


>gi|54297596|ref|YP_123965.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella pneumophila str. Paris]
 gi|81370473|sp|Q5X4M9|PUR7_LEGPA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|53751381|emb|CAH12799.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Legionella pneumophila str. Paris]
          Length = 312

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 140/300 (46%), Positives = 199/300 (66%), Gaps = 6/300 (2%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           Y GKVR+ Y L D   I + TDR SAFD+ +A +PYKG+VLN  + +WF +T  I  NH 
Sbjct: 16  YKGKVRDTYDLGD-QLILVTTDRQSAFDRCLAAVPYKGQVLNLTSVWWFKNTQSIVPNHL 74

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
           +  PDPNV + ++ ++FPIE +VRGY++G+T TSL T Y+ G R+      PD +  NQK
Sbjct: 75  IAVPDPNVAIAKKCKIFPIEFVVRGYISGSTSTSLWTQYQKGVREYCGITFPDGLRKNQK 134

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           L  PVITPTTK +      D+PISP+EI+  G +T+  W+  SSYAL LF+ G ++A ++
Sbjct: 135 LESPVITPTTKETLH----DRPISPHEIVAEGWMTQEDWDETSSYALKLFQHGMEVAQQH 190

Query: 196 GLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNW 255
           GLILVD+KYEFG D +  I+L DEIHTPDSSRYW    Y++ F  G  P  +DK+F+R W
Sbjct: 191 GLILVDTKYEFGRDAEGRIVLVDEIHTPDSSRYWLFNGYQERFDAGKEPENIDKEFLRLW 250

Query: 256 ILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKY 314
            +  C+PY+D + P  P+ +I+  +  YI  YE ITG  F+ D++  P  +RI +N++++
Sbjct: 251 FVDHCDPYKDEVLPQAPQELIVTLASRYIQLYEMITGESFVYDSNPGPVNDRILHNIQRW 310


>gi|325473536|gb|EGC76729.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Treponema
           denticola F0402]
          Length = 316

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 140/302 (46%), Positives = 200/302 (66%), Gaps = 4/302 (1%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDIC 71
           LP+  +GKVR+ Y   +G R+ + TDR+SAFD+ +  +PYKG+VLNQ++ +WF +T DI 
Sbjct: 15  LPSKQTGKVRDWYSPEEGKRLIVTTDRISAFDRVLTALPYKGQVLNQLSLWWFENTKDII 74

Query: 72  SNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMS 131
            NH +  PDPN ++  +++  PIE+IVRGY+ G T T+L   Y  G+R IY Y  P+ + 
Sbjct: 75  KNHIISCPDPNCIIVTEVKPLPIEVIVRGYITGVTSTALWYRYSLGERNIYGYDFPEGLK 134

Query: 132 DNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKL 191
            NQ LP P+ITPTTK     +G D+ ++ +E++ +G L++ QW+ +   AL+LFERG K 
Sbjct: 135 KNQALPKPIITPTTKG--GPTGHDERLTCDEVVSQGYLSKEQWDFVQKAALALFERGQKS 192

Query: 192 ALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDF 251
           A E GLILVD+KYEFG++K  NI+L DE+HTPDSSRYW+++TYE+  +EG  P   DK+F
Sbjct: 193 AKEAGLILVDTKYEFGVNKDNNILLIDEVHTPDSSRYWKLDTYEQRLKEGKEPENFDKEF 252

Query: 252 IRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNL 311
           +R     +       IP++ EN+     Q YI AYEK+T  KF+    E P  ERI  NL
Sbjct: 253 VRMAYAAKGYRGDGEIPELDENVWNEAIQLYITAYEKLTKSKFVP--GEYPVEERIVKNL 310

Query: 312 RK 313
           +K
Sbjct: 311 KK 312


>gi|54294564|ref|YP_126979.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella pneumophila str. Lens]
 gi|81368528|sp|Q5WW20|PUR7_LEGPL RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|53754396|emb|CAH15880.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Legionella pneumophila str. Lens]
          Length = 312

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 198/300 (66%), Gaps = 6/300 (2%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           Y GKVR+ Y L D   I + TDR SAFD+ +A +PYKG+VLN  + +WF +T  I  NH 
Sbjct: 16  YKGKVRDTYDLGD-QLILVTTDRQSAFDRCLAAVPYKGQVLNLTSVWWFKNTQSIVPNHL 74

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
           +  PDPNV + ++ ++FP+E +VRGY++G+T TSL T Y+ G R+      PD +  NQK
Sbjct: 75  IAVPDPNVAIAKKCKIFPVEFVVRGYISGSTSTSLWTQYQKGVREYCGITFPDGLRKNQK 134

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           L  PVITPTTK +      D+PISP+EI+  G +T+  W+  SSYAL LF+ G ++A ++
Sbjct: 135 LESPVITPTTKETIH----DRPISPHEIVAEGWMTQEDWDETSSYALRLFQHGMEVAQQH 190

Query: 196 GLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNW 255
           GLILVD+KYEFG D +  I+L DEIHTPDSSRYW    Y++ F  G  P  +DK+F+R W
Sbjct: 191 GLILVDTKYEFGRDAEGRIVLVDEIHTPDSSRYWLFNGYQERFDAGKEPENIDKEFLRLW 250

Query: 256 ILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKY 314
            +  C+PY+D + P  P+ +I+  +  YI  YE ITG  F+ D++  P  +RI +N++ +
Sbjct: 251 FVDHCDPYKDEVLPQAPQELIVTLASRYIQLYEMITGESFVYDSNPGPVNDRILHNIQHW 310


>gi|56707995|ref|YP_169891.1| fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110670466|ref|YP_667023.1| fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           FSC198]
 gi|224457077|ref|ZP_03665550.1| fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254370478|ref|ZP_04986483.1| saicar synthetase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. tularensis FSC033]
 gi|254874795|ref|ZP_05247505.1| purC/purD fusion protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|56604487|emb|CAG45527.1| Fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110320799|emb|CAL08910.1| Fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           FSC198]
 gi|151568721|gb|EDN34375.1| saicar synthetase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. tularensis FSC033]
 gi|254840794|gb|EET19230.1| purC/purD fusion protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159183|gb|ADA78574.1| Fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 770

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 146/313 (46%), Positives = 201/313 (64%), Gaps = 13/313 (4%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDI 70
           ++ N Y GKVR+ YF +D   I I+TDR SAFD+++  IP+KG++L Q + +WF  T+ I
Sbjct: 21  DIKNKYIGKVRDMYF-TDDKSILISTDRQSAFDRSLGFIPFKGQILAQSSVWWFKETAHI 79

Query: 71  CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNM 130
             NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R     +LP+ +
Sbjct: 80  VKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDYCGNILPEGL 139

Query: 131 SDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCK 190
             NQKLP  ++TPTTK  +     D+PIS  +I+  G LT+ QW+  S  AL LFE G K
Sbjct: 140 KKNQKLPQNILTPTTKEQDH----DRPISAEDIVKEGWLTQQQWDFASQKALELFEFGQK 195

Query: 191 LALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
            ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  G  P  +DK
Sbjct: 196 KALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFENGEEPENIDK 255

Query: 250 DFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP-PLERI 307
           +F R W    C+PY D + P  P+ +++  SQ YIA +E ITG KF     E+P  LE I
Sbjct: 256 EFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYIALFEMITGQKF-----EVPRDLENI 310

Query: 308 RNNLRKYTHRHLS 320
              + K    +L+
Sbjct: 311 NQRIVKNVTDYLN 323


>gi|297172488|gb|ADI23460.1| phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [uncultured nuHF1 cluster bacterium HF0770_35I22]
          Length = 332

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 138/292 (47%), Positives = 200/292 (68%), Gaps = 2/292 (0%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L +A+  ELPNY  GKVR++Y L DG RI I+TDR SAFD  +A +P+KG+VLNQI+++W
Sbjct: 17  LDEAHFDELPNYDRGKVRDSYNLPDGRRIMISTDRQSAFDVILASVPFKGQVLNQISKFW 76

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F  T+ IC NH + +PDPN+++ + L+M PIE+IVR Y+ G+T+TS+   Y+ G+R +Y 
Sbjct: 77  FDSTNHICPNHVIKFPDPNIVITKNLKMLPIEIIVRDYMTGSTETSIWPMYQKGERHMYG 136

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
           +   D    NQKL   +ITPTTK+ +     D PI+  EII + +L++  W+ +S  AL+
Sbjct: 137 HAFDDGFVKNQKLKTTIITPTTKAIQGEH--DAPITATEIIEKKLLSQETWDEVSKKALA 194

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF  G K++ +NGLILVD+KYEFGID    + +ADEIHTPDSSR+W   +Y+        
Sbjct: 195 LFSEGRKISSQNGLILVDTKYEFGIDDTGVVTIADEIHTPDSSRFWVKASYKPRMLAKEE 254

Query: 244 PIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
           P  LDK+F+R WI  +C+PY D IP IP+  ++  S+ Y+  +E++TG KF+
Sbjct: 255 PESLDKEFLRLWISQKCDPYTDPIPAIPQKTLVEFSKKYVRLFEQVTGQKFL 306


>gi|134302215|ref|YP_001122184.1| fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|134049992|gb|ABO47063.1| fusion protein PurC/PurD [Francisella tularensis subsp. tularensis
           WY96-3418]
          Length = 770

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 146/313 (46%), Positives = 201/313 (64%), Gaps = 13/313 (4%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDI 70
           ++ N Y GKVR+ YF +D   I I+TDR SAFD+++  IP+KG++L Q + +WF  T+ I
Sbjct: 21  DIKNKYIGKVRDMYF-TDDKSILISTDRQSAFDRSLGFIPFKGQILAQSSVWWFKETAHI 79

Query: 71  CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNM 130
             NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R     +LP+ +
Sbjct: 80  VKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDYCGNILPEGL 139

Query: 131 SDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCK 190
             NQKLP  ++TPTTK  +     D+PIS  +I+  G LT+ QW+  S  AL LFE G K
Sbjct: 140 KKNQKLPQNILTPTTKEQDH----DRPISAEDIVKEGWLTQQQWDFASQKALELFEFGQK 195

Query: 191 LALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
            ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  G  P  +DK
Sbjct: 196 KALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFENGEEPENIDK 255

Query: 250 DFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP-PLERI 307
           +F R W    C+PY D + P  P+ +++  SQ YIA +E ITG KF     E+P  LE I
Sbjct: 256 EFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYIALFEMITGQKF-----EVPRDLENI 310

Query: 308 RNNLRKYTHRHLS 320
              + K    +L+
Sbjct: 311 NQRIVKNVTDYLN 323


>gi|208780484|ref|ZP_03247824.1| phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Francisella novicida FTG]
 gi|208743630|gb|EDZ89934.1| phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Francisella novicida FTG]
          Length = 770

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 146/313 (46%), Positives = 200/313 (63%), Gaps = 13/313 (4%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDI 70
           ++ N Y GKVR+ YF +D   I I+TDR SAFD+++  IP+KG++L Q + +WF  T+ I
Sbjct: 21  DIKNKYIGKVRDMYF-TDDKSILISTDRQSAFDRSLGFIPFKGQILAQSSVWWFKETAHI 79

Query: 71  CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNM 130
             NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R     +LP+ +
Sbjct: 80  VKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDYCGNILPEGL 139

Query: 131 SDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCK 190
             NQKLP  ++TPTTK  +     D+PIS  +I+  G LT+ QW+  S  AL LFE G K
Sbjct: 140 KKNQKLPQNILTPTTKEQDH----DRPISAEDIVKEGWLTQQQWDFASQKALELFEFGQK 195

Query: 191 LALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
            ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  G  P  +DK
Sbjct: 196 KALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFENGEEPENIDK 255

Query: 250 DFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP-PLERI 307
           +F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     E+P  LE I
Sbjct: 256 EFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKF-----EVPRDLENI 310

Query: 308 RNNLRKYTHRHLS 320
              + K    +LS
Sbjct: 311 NQRIVKNVTDYLS 323


>gi|328676491|gb|AEB27361.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase /
           Phosphoribosylamine--glycine ligase [Francisella cf.
           novicida Fx1]
          Length = 770

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 146/313 (46%), Positives = 200/313 (63%), Gaps = 13/313 (4%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDI 70
           ++ N Y GKVR+ YF +D   I I+TDR SAFD+++  IP+KG++L Q + +WF  T+ I
Sbjct: 21  DIKNKYIGKVRDMYF-TDDKSILISTDRQSAFDRSLGFIPFKGQILAQSSVWWFKETAHI 79

Query: 71  CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNM 130
             NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R     +LP+ +
Sbjct: 80  VKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDYCGNILPEGL 139

Query: 131 SDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCK 190
             NQKLP  ++TPTTK  +     D+PIS  +I+  G LT+ QW+  S  AL LFE G K
Sbjct: 140 KKNQKLPQNILTPTTKEQDH----DRPISAEDIVKEGWLTQQQWDFASQKALELFEFGQK 195

Query: 191 LALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
            ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  G  P  +DK
Sbjct: 196 KALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFENGEEPENIDK 255

Query: 250 DFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP-PLERI 307
           +F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     E+P  LE I
Sbjct: 256 EFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKF-----EVPRDLENI 310

Query: 308 RNNLRKYTHRHLS 320
              + K    +LS
Sbjct: 311 NQRIVKNVTDYLS 323


>gi|254373858|ref|ZP_04989340.1| fusion protein PurC/PurD [Francisella novicida GA99-3548]
 gi|151571578|gb|EDN37232.1| fusion protein PurC/PurD [Francisella novicida GA99-3548]
          Length = 770

 Score =  281 bits (720), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 201/313 (64%), Gaps = 13/313 (4%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDI 70
           ++ N Y GKVR+ YF +D   I I+TDR SAFD+++  IP+KG++L Q + +WF  T+ I
Sbjct: 21  DIKNKYIGKVRDMYF-TDDKSILISTDRQSAFDRSLGFIPFKGQILAQSSVWWFKETAHI 79

Query: 71  CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNM 130
             NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R+    +LP+ +
Sbjct: 80  VKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSREYCGNILPEGL 139

Query: 131 SDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCK 190
             NQKLP  ++TPTTK  +     D+PIS  +I+  G LT+ QW+  S  AL LFE G K
Sbjct: 140 KKNQKLPQNILTPTTKEQDH----DRPISAEDIVKEGWLTQQQWDFASQKALELFEFGQK 195

Query: 191 LALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
            ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  G  P  +DK
Sbjct: 196 KALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFENGEEPENIDK 255

Query: 250 DFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP-PLERI 307
           +F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     E+P  LE I
Sbjct: 256 EFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKF-----EVPRDLENI 310

Query: 308 RNNLRKYTHRHLS 320
              + K    +L+
Sbjct: 311 NQRIVKNVTDYLN 323


>gi|118497027|ref|YP_898077.1| SAICAR synthetase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. novicida U112]
 gi|194324262|ref|ZP_03058036.1| phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Francisella tularensis subsp. novicida FTE]
 gi|118422933|gb|ABK89323.1| SAICAR synthetase/phosphoribosylamine-glycine ligase [Francisella
           novicida U112]
 gi|194321709|gb|EDX19193.1| phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Francisella tularensis subsp. novicida FTE]
          Length = 770

 Score =  281 bits (719), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 200/313 (63%), Gaps = 13/313 (4%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDI 70
           ++ N Y GKVR+ YF +D   I I+TDR SAFD+++  IP+KG++L Q + +WF  T+ I
Sbjct: 21  DIKNKYIGKVRDMYF-TDDKSILISTDRQSAFDRSLGFIPFKGQILAQSSVWWFKETAHI 79

Query: 71  CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNM 130
             NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R     +LP+ +
Sbjct: 80  VKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDYCGNILPEGL 139

Query: 131 SDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCK 190
             NQKLP  ++TPTTK  +     D+PIS  +I+  G LT+ QW+  S  AL LFE G K
Sbjct: 140 KKNQKLPQNILTPTTKEQDH----DRPISAEDIVKEGWLTQQQWDFASQKALELFEFGQK 195

Query: 191 LALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
            ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  G  P  +DK
Sbjct: 196 KALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFENGEEPENIDK 255

Query: 250 DFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP-PLERI 307
           +F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     E+P  LE I
Sbjct: 256 EFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKF-----EVPRDLENI 310

Query: 308 RNNLRKYTHRHLS 320
              + K    +L+
Sbjct: 311 NQRIVKNVTDYLN 323


>gi|254372387|ref|ZP_04987877.1| hypothetical protein FTCG_01611 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151570115|gb|EDN35769.1| hypothetical protein FTCG_01611 [Francisella novicida GA99-3549]
          Length = 770

 Score =  281 bits (719), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 200/313 (63%), Gaps = 13/313 (4%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDI 70
           ++ N Y GKVR+ YF +D   I I+TDR SAFD+++  IP+KG++L Q + +WF  T+ I
Sbjct: 21  DIKNKYIGKVRDMYF-TDDKSILISTDRQSAFDRSLGFIPFKGQILAQSSVWWFKETAHI 79

Query: 71  CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNM 130
             NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R     +LP+ +
Sbjct: 80  VKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDYCGNILPEGL 139

Query: 131 SDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCK 190
             NQKLP  ++TPTTK  +     D+PIS  +I+  G LT+ QW+  S  AL LFE G K
Sbjct: 140 KKNQKLPQNILTPTTKEQDH----DRPISAEDIVKEGWLTQQQWDFASQKALELFEFGQK 195

Query: 191 LALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
            ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  G  P  +DK
Sbjct: 196 KALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFENGEEPENIDK 255

Query: 250 DFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP-PLERI 307
           +F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     E+P  LE I
Sbjct: 256 EFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKF-----EVPRDLENI 310

Query: 308 RNNLRKYTHRHLS 320
              + K    +L+
Sbjct: 311 NQRIVKNVTDYLN 323


>gi|254368656|ref|ZP_04984670.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Francisella tularensis subsp. holarctica FSC022]
 gi|157121571|gb|EDO65748.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Francisella tularensis subsp. holarctica FSC022]
          Length = 770

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 200/313 (63%), Gaps = 13/313 (4%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDI 70
           ++ N Y GKVR+ YF +D   I I+TDR SAFD+++  IP+KG++L Q + +WF  T+ I
Sbjct: 21  DIKNKYIGKVRDMYF-TDDKSILISTDRQSAFDRSLGFIPFKGQILAQSSVWWFKETAHI 79

Query: 71  CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNM 130
             NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R     +LP+ +
Sbjct: 80  VKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDYCGNILPEGL 139

Query: 131 SDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCK 190
             NQKLP  ++TPTTK  +     D+PIS  +I+  G LT+ QW+  S  AL LFE G K
Sbjct: 140 KKNQKLPQNILTPTTKEQDH----DRPISAEDIVKEGWLTQQQWDFASQKALELFEFGQK 195

Query: 191 LALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
            ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  G  P  +DK
Sbjct: 196 KALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFENGEEPENIDK 255

Query: 250 DFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP-PLERI 307
           +F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     E+P  LE I
Sbjct: 256 EFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKF-----EVPRDLENI 310

Query: 308 RNNLRKYTHRHLS 320
              + K    +L+
Sbjct: 311 NQRIVKNVTDYLN 323


>gi|187931295|ref|YP_001891279.1| saicar synthetase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. mediasiatica FSC147]
 gi|187712204|gb|ACD30501.1| saicar synthetase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. mediasiatica FSC147]
          Length = 770

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 145/312 (46%), Positives = 199/312 (63%), Gaps = 13/312 (4%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDIC 71
           + N Y GKVR+ YF +D   I I+TDR SAFD+++  IP+KG++L Q + +WF  T+ I 
Sbjct: 22  IKNKYIGKVRDMYF-TDDKSILISTDRQSAFDRSLGFIPFKGQILAQSSVWWFKETAHIV 80

Query: 72  SNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMS 131
            NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R     +LP+ + 
Sbjct: 81  KNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDYCGNILPEGLK 140

Query: 132 DNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKL 191
            NQKLP  ++TPTTK  +     D+PIS  +I+  G LT+ QW+  S  AL LFE G K 
Sbjct: 141 KNQKLPQNILTPTTKEQDH----DRPISAEDIVKEGWLTQQQWDFASQKALELFEFGQKK 196

Query: 192 ALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKD 250
           ALE+GLIL D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  G  P  +DK+
Sbjct: 197 ALEHGLILADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFENGEEPENIDKE 256

Query: 251 FIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP-PLERIR 308
           F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     E+P  LE I 
Sbjct: 257 FFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKF-----EVPRDLENIN 311

Query: 309 NNLRKYTHRHLS 320
             + K    +L+
Sbjct: 312 QRIVKNVTDYLN 323


>gi|89255807|ref|YP_513169.1| fusion protein PurC/PurD [Francisella tularensis subsp. holarctica
           LVS]
 gi|115314299|ref|YP_763022.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Francisella tularensis subsp. holarctica OSU18]
 gi|156501787|ref|YP_001427852.1| phosphoribosylaminoimidazole-succinocarboxamide
           synthase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|167009608|ref|ZP_02274539.1| fusion protein PurC/PurD [Francisella tularensis subsp. holarctica
           FSC200]
 gi|290952947|ref|ZP_06557568.1| phosphoribosylaminoimidazole-succinocarboxamide
           synthase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. holarctica URFT1]
 gi|295313858|ref|ZP_06804428.1| phosphoribosylaminoimidazole-succinocarboxamide
           synthase/phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. holarctica URFT1]
 gi|89143638|emb|CAJ78836.1| Fusion protein PurC/PurD [Francisella tularensis subsp. holarctica
           LVS]
 gi|115129198|gb|ABI82385.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Francisella tularensis subsp. holarctica OSU18]
 gi|156252390|gb|ABU60896.1| Phosphoribosylaminoimidazole-succinocarboxamide
           synthase/Phosphoribosylamine-glycine ligase [Francisella
           tularensis subsp. holarctica FTNF002-00]
          Length = 770

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 144/313 (46%), Positives = 199/313 (63%), Gaps = 13/313 (4%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDI 70
           ++ N Y GKVR+ YF +D   I I+TDR SAFD+++  IP+KG++L Q + +WF  T+ I
Sbjct: 21  DIKNKYIGKVRDMYF-TDDKSILISTDRQSAFDRSLGFIPFKGQILAQSSVWWFKETAHI 79

Query: 71  CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNM 130
             NH +D PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R     +LP+ +
Sbjct: 80  VKNHFIDSPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDYCGNILPEGL 139

Query: 131 SDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCK 190
             NQKLP  ++TPTTK  +     D+PIS  +I+  G LT+ QW+  S  AL LFE G K
Sbjct: 140 KKNQKLPQNILTPTTKEQDH----DRPISAEDIVKEGWLTQQQWDFASQKALELFEFGQK 195

Query: 191 LALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
            ALE+GL L D+KYEFGID++   IIL DEIHTPDSSR+W  ++Y   F  G  P  +DK
Sbjct: 196 KALEHGLFLADTKYEFGIDEQTGEIILIDEIHTPDSSRFWLKDSYATRFENGEEPENIDK 255

Query: 250 DFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP-PLERI 307
           +F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     E+P  LE I
Sbjct: 256 EFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKF-----EVPRDLENI 310

Query: 308 RNNLRKYTHRHLS 320
              + K    +L+
Sbjct: 311 NQRIVKNVTDYLN 323


>gi|328675566|gb|AEB28241.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase /
           Phosphoribosylamine--glycine ligase [Francisella cf.
           novicida 3523]
          Length = 770

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 200/313 (63%), Gaps = 13/313 (4%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDI 70
           ++ N Y+GKVR+ YF +D   I I+TDR SAFD+++  IP+KG++L Q + +WF  T+ I
Sbjct: 21  DIKNKYTGKVRDMYF-TDDKSILISTDRQSAFDRSLGFIPFKGQILAQSSVWWFKETAHI 79

Query: 71  CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNM 130
             NH +  PDPNV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R     +LP+ +
Sbjct: 80  VKNHFIASPDPNVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDYCGNILPEGL 139

Query: 131 SDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCK 190
             NQKLP  ++TPTTK  +     D+PIS  +I+  G LT+ QW+  S  AL LFE G +
Sbjct: 140 KKNQKLPQNILTPTTKEQDH----DRPISAEDIVKEGWLTQQQWDFASQKALELFEFGQQ 195

Query: 191 LALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
            ALE+GLIL D+KYEFG+D+K   IIL DE+HTPDSSR+W  ++Y   F  G  P  +DK
Sbjct: 196 KALEHGLILADTKYEFGVDEKTGEIILIDELHTPDSSRFWLKDSYATRFENGEEPENIDK 255

Query: 250 DFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP-PLERI 307
           +F R W    C+PY D + P  P+ +++  SQ YI  +E ITG KF     E+P  LE I
Sbjct: 256 EFFRLWFAKNCDPYNDEVLPQAPQELVVELSQKYITLFEMITGQKF-----EVPRDLENI 310

Query: 308 RNNLRKYTHRHLS 320
              + K    +L+
Sbjct: 311 NQRIVKNVTDYLN 323


>gi|330836825|ref|YP_004411466.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Spirochaeta coccoides DSM 17374]
 gi|329748728|gb|AEC02084.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Spirochaeta coccoides DSM 17374]
          Length = 336

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 144/303 (47%), Positives = 187/303 (61%), Gaps = 8/303 (2%)

Query: 13  PNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICS 72
           PN   GKVR+ Y L +G  + + TDR SAFD+ +A IP+KG+VLN ++ +WF  T DI  
Sbjct: 28  PNRKVGKVRDRYDLGNGRLLFVTTDRQSAFDRVLASIPFKGQVLNMVSAWWFARTKDIIG 87

Query: 73  NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSD 132
           NH L  PDP V + +   + PIE +VRGY+ G+T TSL T YK G+R       PD +  
Sbjct: 88  NHLLSTPDPCVTISRACTVLPIEFVVRGYITGSTDTSLWTHYKKGERTYCGVNFPDGLKK 147

Query: 133 NQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLA 192
           NQKL  PVITPTTK        D+PISP EII  G L++N W+  S+ AL+LF  G + A
Sbjct: 148 NQKLEQPVITPTTKE----DAHDRPISPAEIIEEGWLSQNDWDEASAAALALFRFGTEEA 203

Query: 193 LENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFI 252
            + GLILVD+KYEFG D    + L DEIHTPDSSRYW  ++YE  F  G  P  +DK+F+
Sbjct: 204 AKKGLILVDTKYEFGRDADGILRLIDEIHTPDSSRYWLGDSYENRFATGHEPENIDKEFL 263

Query: 253 RNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFI---ADNSELPPLERIR 308
           R W    C+PY+D + P  P +++   S  YI  YE ITG KFI    D+ +  P ER+ 
Sbjct: 264 RLWFTKVCDPYKDEVLPPAPMDLVAELSTRYIRLYEMITGEKFIFPDEDSMKESPYERLT 323

Query: 309 NNL 311
            NL
Sbjct: 324 RNL 326


>gi|302854742|ref|XP_002958876.1| hypothetical protein VOLCADRAFT_84670 [Volvox carteri f.
           nagariensis]
 gi|300255778|gb|EFJ40064.1| hypothetical protein VOLCADRAFT_84670 [Volvox carteri f.
           nagariensis]
          Length = 368

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 136/303 (44%), Positives = 190/303 (62%), Gaps = 6/303 (1%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDIC 71
           LPN   GKVR+ Y L D   + + TDR SAFD+ +A +P+KG+VLNQ   +WF  TS I 
Sbjct: 67  LPNRRQGKVRDTYDLGDRV-VIVTTDRQSAFDRLLASVPFKGQVLNQTAAWWFSATSHIV 125

Query: 72  SNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMS 131
            +  L  PDPNV V ++ ++FP+E + RG++ G+T TSL T YK G R+      PD M 
Sbjct: 126 PSALLTLPDPNVAVMKKCRVFPVEFVCRGFMTGSTDTSLWTHYKAGARQYCGNSFPDGMR 185

Query: 132 DNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKL 191
            N +L   VITPTTK+ +     D PISP EI+ +G++T+ +W+T+S+ AL +F+ G + 
Sbjct: 186 KNDRLVANVITPTTKAEDH----DVPISPKEIVEQGLMTQEEWDTVSAAALRIFQFGQEE 241

Query: 192 ALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDF 251
           A   GL+LVD+KYEFG D    I + DE+HTPDSSRYW  +TY      G+ P  +DK+F
Sbjct: 242 AARRGLLLVDTKYEFGKDADGTIRIIDEVHTPDSSRYWLADTYAARHAAGLEPENIDKEF 301

Query: 252 IRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNN 310
           +R W   RC+PY+D + P+ P  ++   S+ Y+  YE+ITG  F   +   P  ERI  N
Sbjct: 302 LRLWFRQRCDPYKDAVLPEAPAELVCELSKRYVYLYERITGQPFQVPDLATPVNERIVAN 361

Query: 311 LRK 313
           LRK
Sbjct: 362 LRK 364


>gi|159482653|ref|XP_001699382.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158272833|gb|EDO98628.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 372

 Score =  275 bits (703), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 139/311 (44%), Positives = 193/311 (62%), Gaps = 7/311 (2%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L+  ++P LPN   GKVR+ Y L D T + + TDR SAFD+ +A +P+KG VLNQ   +W
Sbjct: 63  LTATHLP-LPNRRQGKVRDTYDLGD-TVVIVTTDRQSAFDRLLASVPFKGAVLNQTAAWW 120

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T+ I  +  L  PDPNV V ++  +FP+E + RG++ G+T TSL T YK G R    
Sbjct: 121 LGATAHIAPSALLSCPDPNVAVMKKCAVFPVEFVCRGFMTGSTDTSLWTHYKAGARSYCG 180

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
              PD M  N +L   VITPTTK+ +     D PISP EI+ +G++T+ +W+T+SS AL 
Sbjct: 181 NDFPDGMRKNDRLASNVITPTTKAEDH----DVPISPAEIVAQGLMTQQEWDTVSSAALR 236

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           +FE G   A + GL+LVD+KYEFG D    I + DE+HTPDSSRYW  +TYE     G  
Sbjct: 237 IFEFGQAEAAKRGLLLVDTKYEFGKDANGVIHIIDEVHTPDSSRYWLADTYEARHAAGQE 296

Query: 244 PIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
           P  +DK+F+R W   RC+PY+D + P+ P  ++   S+ Y+  YEKITG  F   + + P
Sbjct: 297 PQNIDKEFLRLWFRERCDPYKDAVLPEAPAELVCELSKRYVYLYEKITGQPFAVPDLDTP 356

Query: 303 PLERIRNNLRK 313
             +RI  NL+K
Sbjct: 357 INDRILANLQK 367


>gi|167626637|ref|YP_001677137.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase,
           phosphoribosylamine--glycine ligase [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
 gi|167596638|gb|ABZ86636.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase,
           Phosphoribosylamine--glycine ligase [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
          Length = 769

 Score =  274 bits (701), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 136/291 (46%), Positives = 191/291 (65%), Gaps = 7/291 (2%)

Query: 6   KAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFH 65
           KA   ++ + Y GKVR+ YF +D   I I+TDR SAFD+++  IP+KG++L Q + +WF 
Sbjct: 16  KATDLDIKDKYIGKVRDMYF-TDDKSILISTDRQSAFDRSLGFIPFKGQILAQSSVWWFK 74

Query: 66  HTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYL 125
            T+ I  NH +  PD NV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R     +
Sbjct: 75  ETAHIVKNHFIASPDANVVIARKAKVLPIEFVVRGYITGSTSTSLWTHYKNGSRDYCGNI 134

Query: 126 LPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLF 185
           LP+ +  NQKLP  ++TPTTK  +     D+PIS  +I+  G LT+ QW+  S  AL LF
Sbjct: 135 LPEGLKKNQKLPQNILTPTTKEQDH----DRPISAEDIVKEGWLTQEQWDFASQKALELF 190

Query: 186 ERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITP 244
           E G + ALE+GLIL D+KYEFG+D+K   IIL DEIHTPDSSR+W  ++Y + F  G  P
Sbjct: 191 EFGQQKALEHGLILADTKYEFGVDEKTGEIILIDEIHTPDSSRFWLKDSYAERFENGEEP 250

Query: 245 IGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKF 294
             +DK+F R W    C+PY D++ P  P+ +++  SQ YI  +E ITG KF
Sbjct: 251 ENIDKEFFRLWFAKNCDPYNDDVLPQAPQELVVDLSQKYITLFEMITGQKF 301


>gi|241667194|ref|ZP_04754772.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase,
           phosphoribosylamine--glycine ligase [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254875746|ref|ZP_05248456.1| saicar synthetase/phosphoribosylamine-glycine ligase [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254841767|gb|EET20181.1| saicar synthetase/phosphoribosylamine-glycine ligase [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
          Length = 769

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 134/285 (47%), Positives = 189/285 (66%), Gaps = 7/285 (2%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDIC 71
           + + Y GKVR+ YF +D   I I+TDR SAFD+++  IP+KG++L Q + +WF  T+ I 
Sbjct: 22  IKDKYIGKVRDMYF-TDDKSILISTDRQSAFDRSLGFIPFKGQILAQSSVWWFKETAHIV 80

Query: 72  SNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMS 131
            NH +  PD NV++ ++ ++ PIE +VRGY+ G+T TSL T YKNG R     +LP+ + 
Sbjct: 81  KNHFIASPDANVVIARKARVLPIEFVVRGYITGSTSTSLWTHYKNGSRDYCGNILPEGLK 140

Query: 132 DNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKL 191
            NQKLP  ++TPTTK  +     D+PIS  +I+  G LT+ QW+  S  AL LFE G + 
Sbjct: 141 KNQKLPQNILTPTTKEQDH----DRPISAEDIVKEGWLTQEQWDFASQKALELFEFGQQK 196

Query: 192 ALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKD 250
           ALE+GLIL D+KYEFG+D+K   IIL DEIHTPDSSR+W  ++Y + F  G  P  +DK+
Sbjct: 197 ALEHGLILADTKYEFGVDEKTGEIILIDEIHTPDSSRFWLKDSYVERFENGEEPENIDKE 256

Query: 251 FIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKF 294
           F R W    C+PY D++ P  P+++++  SQ YI  +E ITG KF
Sbjct: 257 FFRLWFAKNCDPYNDDVLPQAPQDLVVDLSQKYITLFEMITGQKF 301


>gi|225459162|ref|XP_002285714.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|302142022|emb|CBI19225.3| unnamed protein product [Vitis vinifera]
          Length = 388

 Score =  272 bits (696), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 191/304 (62%), Gaps = 6/304 (1%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTS 68
           +P L +   GKVR+ Y   D   + + TDR SAFD+ +A IP+KG+VLN+ + +WF  T 
Sbjct: 82  VPALKSKTRGKVRDVYDGGD-YLVLVTTDRQSAFDRVLASIPFKGQVLNETSLWWFDKTQ 140

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            I  N  +  PD NV + ++  +FP+E +VRGY+ G+T TSL T YKNG R      LPD
Sbjct: 141 HIAPNAVVSAPDKNVTIAKKCSVFPVEFVVRGYVTGSTDTSLWTVYKNGVRNYCGNALPD 200

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M  NQKLP  ++TPTTK+++     D PI+P+EI+  G++T+  ++ +S  ALSLFE G
Sbjct: 201 GMVKNQKLPANILTPTTKAADH----DVPIAPDEIVKLGLMTQADYDEVSRKALSLFEYG 256

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
             +ALE+GLILVD+KYEFG      ++L DE+HTPDSSRYW   +YE+ FR GI P  +D
Sbjct: 257 QHVALEHGLILVDTKYEFGKGSDGTVLLIDEVHTPDSSRYWIANSYEERFRNGIEPENVD 316

Query: 249 KDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERI 307
           K+F+R W    CNPY D + PD P  ++   +  Y+  YE IT  KF     E P  +RI
Sbjct: 317 KEFLRLWFREHCNPYEDEVLPDAPTELVSELAWRYVFLYETITNSKFEIPLMEEPIHDRI 376

Query: 308 RNNL 311
             N+
Sbjct: 377 SRNV 380


>gi|270158588|ref|ZP_06187245.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella longbeachae D-4968]
 gi|289166583|ref|YP_003456721.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Legionella longbeachae NSW150]
 gi|269990613|gb|EEZ96867.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Legionella longbeachae D-4968]
 gi|288859756|emb|CBJ13737.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Legionella longbeachae NSW150]
          Length = 329

 Score =  272 bits (695), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 132/300 (44%), Positives = 190/300 (63%), Gaps = 6/300 (2%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           Y GKVR+ Y L D   + + TDRLSAFD+++A IPYKG VLN  + +WF  T ++  NH 
Sbjct: 33  YQGKVRDAYDLGDAIML-VTTDRLSAFDRHLALIPYKGAVLNLTSAWWFEQTKNLVPNHI 91

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
           +  PDPNV++ ++  +FPIE +VRGY++G T TSL T Y+NG R       P+ +  NQK
Sbjct: 92  IAVPDPNVVIAKKCTVFPIEFVVRGYISGTTSTSLWTQYQNGTRDYCGITFPEGLRKNQK 151

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           L   V+TPTTK        D+PISP+EII  G ++   W  +S+ AL L++RG ++A ++
Sbjct: 152 LEQAVLTPTTKEKIH----DRPISPDEIISEGWMSEEDWLEVSALALKLYQRGAEIARDH 207

Query: 196 GLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNW 255
           GLILVD+KYEFG D +  I + DEIHTPDSSRYW  ++Y+     G+ P  +DK+F+R W
Sbjct: 208 GLILVDTKYEFGRDAEGTIRVVDEIHTPDSSRYWLADSYQSRIAAGLEPENIDKEFLRLW 267

Query: 256 ILTRCNPYRD-NIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRKY 314
                +PY D  +P+ P+ +++  S  YI  YE+ITG  F  +  + P  +RI  ++  Y
Sbjct: 268 FAKNSDPYHDEKLPEAPQELVVELSARYIQLYERITGKDFNFNAHKEPAEQRILRHIANY 327


>gi|17978592|gb|AAL48317.1| succinoaminoimidazolecarboximide ribonucleotide synthetase [Vigna
           unguiculata]
          Length = 402

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 136/304 (44%), Positives = 194/304 (63%), Gaps = 6/304 (1%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTS 68
           +P L +   GKVR+ Y   D   + + TDR SAFD+ +A IP+KG+VLN+ + +WF  T 
Sbjct: 96  VPGLVSKTRGKVRDIYDAGD-YLVLVTTDRQSAFDRILASIPFKGQVLNETSLWWFERTK 154

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            I  N  +  PD NV + ++  +FP+E + RG++ G+T TSL T Y  G R     +LPD
Sbjct: 155 QIVPNAVVSAPDKNVTIAKKCSVFPVEFVARGFVTGSTDTSLWTVYNKGSRNYCGNVLPD 214

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M  NQKL   ++TPTTK+++     D P++P+EII RG++TR+ +E +S  ALSLFE G
Sbjct: 215 GMVKNQKLSENILTPTTKAADH----DVPVTPDEIIERGLMTRSDYEAVSEKALSLFEYG 270

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A E+GLILVD+KYEFG     +I+L DE+HTPDSSRYW   +Y + F+ G+ P  +D
Sbjct: 271 QQVASEHGLILVDTKYEFGKANDGSIMLIDEVHTPDSSRYWIANSYLERFQNGLEPENID 330

Query: 249 KDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERI 307
           K+F+R W  + CNPY D + PD PE+++   S  YI  YE IT  KF    +E P  +RI
Sbjct: 331 KEFLRLWFKSHCNPYEDEVLPDAPEDLVCELSWRYIFLYETITNSKFEMPLTEEPIHDRI 390

Query: 308 RNNL 311
             N+
Sbjct: 391 SRNV 394


>gi|307109403|gb|EFN57641.1| hypothetical protein CHLNCDRAFT_21048 [Chlorella variabilis]
          Length = 380

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 187/297 (62%), Gaps = 6/297 (2%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           Y GKVR+ Y L D   + + TDR SAFD+ +A IP+KG+VLNQ + +W   T  I  N  
Sbjct: 82  YKGKVRDTYDLGDKL-VIVTTDRQSAFDRLLAAIPFKGQVLNQTSAWWMQQTQHIVKNAL 140

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
           L  PD N  + ++  +FP+E + RG++ G+T TSL T YKNG R+      PD M  N++
Sbjct: 141 LSVPDANACIMKKCGVFPVEFVCRGFMTGSTDTSLWTHYKNGAREYCGNTFPDGMRKNER 200

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           L   VITPTTK+ +     D+PISP +I+ +G++++  W+ +S+ AL LF  G + A + 
Sbjct: 201 LAQNVITPTTKAEDH----DEPISPADIVRQGLMSQEDWDAVSTAALQLFAFGQQQAAQR 256

Query: 196 GLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNW 255
           GL+LVD+KYEFG D+  NI+L DEIHTPDSSRYW  +TYE+   +G  P  +DK+F+R W
Sbjct: 257 GLLLVDTKYEFGKDEAGNILLIDEIHTPDSSRYWLADTYEQRHAQGEEPQNIDKEFLRLW 316

Query: 256 ILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNL 311
               C+PY D + P+ P  +    S+ Y+  YEKITG +F     +  P +R+R ++
Sbjct: 317 FRANCDPYNDAVLPEAPAELRCELSRRYVLLYEKITGQQFQPAPLDEEPAQRMRRSV 373


>gi|297835076|ref|XP_002885420.1| hypothetical protein ARALYDRAFT_898545 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297331260|gb|EFH61679.1| hypothetical protein ARALYDRAFT_898545 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 411

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 142/316 (44%), Positives = 199/316 (62%), Gaps = 10/316 (3%)

Query: 7   AYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHH 66
           A +P L +   GKVR+ Y   D   I I TDRLSAFD+N+A IP+KG+VLN+ + +WF++
Sbjct: 101 ATVPGLKSRIKGKVRDIYDAGD-YLILITTDRLSAFDRNLASIPFKGQVLNETSLWWFNN 159

Query: 67  TSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLL 126
           T  I  N  +  PD NV++ ++  +FPIE +VRGY+ G+T TSL T Y  G R      L
Sbjct: 160 TQHITPNAIVSSPDRNVVIAKKCSVFPIEFVVRGYVTGSTDTSLWTVYNKGVRNYCGNEL 219

Query: 127 PDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFE 186
            D +  NQKLP  ++TPTTK+++     D PISPNEI+ RG +T+ +++  S  ALSLFE
Sbjct: 220 SDGLVKNQKLPANILTPTTKAADH----DVPISPNEIVERGFMTQAEFDEASMKALSLFE 275

Query: 187 RGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
            G ++A E+GLILVD+KYEFG     +I+L DEIHTPDSSRYW   +YE+ F++G+ P  
Sbjct: 276 FGQRVAKEHGLILVDTKYEFGRSSDGSILLIDEIHTPDSSRYWLAGSYEERFQKGLEPEN 335

Query: 247 LDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
           +DK+F+R W     NPY D + P  P  ++   +  YI  YE ITG +       +P  E
Sbjct: 336 VDKEFLRLWFKENSNPYEDEVLPAAPAELVTELAWRYIFLYETITGSRI----DIIPTQE 391

Query: 306 RIRNNLRKYTHRHLSS 321
            I + + + T + LSS
Sbjct: 392 PIHDRISRNTSQALSS 407


>gi|299137860|ref|ZP_07031041.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acidobacterium sp. MP5ACTX8]
 gi|298600501|gb|EFI56658.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Acidobacterium sp. MP5ACTX8]
          Length = 317

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 135/303 (44%), Positives = 189/303 (62%), Gaps = 9/303 (2%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L++  +P L + Y GKVR+ Y L DG  + + TDR S FD+ +  IP+KG+VLN+ + +W
Sbjct: 14  LTETNLPLL-DKYPGKVRDTYDLGDGRLLLVTTDRQSGFDRMLGAIPFKGQVLNRTSLHW 72

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F  T  I  NH L  P  N L+ ++ ++ PIE +VRGYL G+T TS+ T Y  G R+   
Sbjct: 73  FAATKHIVGNHVLRSPHANALLARKCRVLPIEFVVRGYLTGSTDTSIWTQYAKGVRQYCG 132

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
           + LP+ M  N+KL   ++TPTTK +      D+PI+  EI+  G +T  QWE  S+ AL+
Sbjct: 133 HALPEGMRKNEKLQQNIVTPTTKETAH----DRPITAQEIVAEGWMTAEQWEFCSAKALA 188

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF  G K+A E+GLILVD+KYEFG+     I+L DEIHTPDSSRYW  ++Y +    G  
Sbjct: 189 LFAFGQKIAAEHGLILVDTKYEFGVGDDGEILLIDEIHTPDSSRYWLADSYAERLAVGQE 248

Query: 244 PIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
           P  +DK+F R W   RC+PY+D I P  P+++I   +  YI  +EKITG  F+ D   L 
Sbjct: 249 PDMIDKEFFRLWFRERCDPYKDAILPVPPDDLIAELASRYIQLFEKITGTAFVPD---LR 305

Query: 303 PLE 305
           PL+
Sbjct: 306 PLD 308


>gi|15232462|ref|NP_188748.1| PUR7 (PURIN 7); phosphoribosylaminoimidazolesuccinocarboxamide
           synthase [Arabidopsis thaliana]
 gi|79313319|ref|NP_001030739.1| PUR7 (PURIN 7); phosphoribosylaminoimidazolesuccinocarboxamide
           synthase [Arabidopsis thaliana]
 gi|26454658|sp|P38025|PUR7_ARATH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase, chloroplastic; AltName: Full=SAICAR
           synthetase; Flags: Precursor
 gi|11994271|dbj|BAB01454.1| 5'-phosphoribosyl-4-(N-succinocarboxamide)-5- ami noimidazole
           synthetase [Arabidopsis thaliana]
 gi|27754219|gb|AAO22563.1| putative phosphoribosyamidoimidazole-succinocarboxamide synthase
           [Arabidopsis thaliana]
 gi|332642941|gb|AEE76462.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arabidopsis thaliana]
 gi|332642942|gb|AEE76463.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arabidopsis thaliana]
          Length = 411

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 198/316 (62%), Gaps = 10/316 (3%)

Query: 7   AYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHH 66
           A +P L +   GKVR+ Y   D   + I TDRLSAFD+N+A IP+KG+VLN+ + +WF++
Sbjct: 101 ATVPGLKSRIKGKVRDIYDAGD-YLVLITTDRLSAFDRNLASIPFKGQVLNETSLWWFNN 159

Query: 67  TSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLL 126
           T  I  N  +  PD NV++ ++  +FPIE +VRGY+ G+T TSL T Y  G R      L
Sbjct: 160 TQHITPNAIVSSPDRNVVIAKKCSVFPIEFVVRGYVTGSTDTSLWTVYNKGVRNYCGNEL 219

Query: 127 PDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFE 186
            D +  NQKLP  ++TPTTK+++     D PISPNEI+  G +T+ +++  S  ALSLFE
Sbjct: 220 SDGLVKNQKLPANILTPTTKAADH----DVPISPNEIVEGGFMTQAEFDEASMKALSLFE 275

Query: 187 RGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
            G  +A ++GLILVD+KYEFG     +I+L DEIHTPDSSRYW   +YE+ F++G+ P  
Sbjct: 276 FGQGVAKKHGLILVDTKYEFGRSSDGSILLIDEIHTPDSSRYWLAGSYEERFQKGLEPEN 335

Query: 247 LDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
           +DK+F+R W    CNPY D + P  P  ++   +  YI  YE ITG +       +P  E
Sbjct: 336 VDKEFLRLWFKENCNPYEDEVLPAAPAELVTELAWRYIFLYETITGSRI----DIIPTQE 391

Query: 306 RIRNNLRKYTHRHLSS 321
            I + + + T + LSS
Sbjct: 392 PIHDRISRNTSQALSS 407


>gi|453384|gb|AAA16231.1| SAICAR synthetase [Arabidopsis thaliana]
          Length = 411

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 141/316 (44%), Positives = 198/316 (62%), Gaps = 10/316 (3%)

Query: 7   AYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHH 66
           A +P L +   GKVR+ Y   D   + I TDRLSAFD+N+A IP+KG+VLN+ + +WF++
Sbjct: 101 ATVPGLKSRIKGKVRDIYDAGD-YLVLITTDRLSAFDRNLASIPFKGQVLNETSLWWFNN 159

Query: 67  TSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLL 126
           T  I  N  L  PD NV++ ++  +FPIE +VRGY+ G+T TSL T Y  G R      L
Sbjct: 160 TQHITPNAMLYSPDRNVVIAKKCSVFPIEFVVRGYVTGSTDTSLWTVYNKGVRNYCGNEL 219

Query: 127 PDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFE 186
            D +  NQKLP  ++TPTTK+++     D PISPNEI+  G +T+ +++  S  ALSLFE
Sbjct: 220 SDGLVKNQKLPANILTPTTKAADH----DVPISPNEIVEGGFMTQAEFDEASMKALSLFE 275

Query: 187 RGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
            G  +A ++GLILVD+KYEFG     +I+L DEIHTPDSSRYW   +YE+ F++G+ P  
Sbjct: 276 FGQGVAKKHGLILVDTKYEFGRSSDGSILLIDEIHTPDSSRYWLAGSYEERFQKGLEPEN 335

Query: 247 LDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
           +DK+F+R W    CNPY D + P  P  ++   +  YI  YE ITG +       +P  E
Sbjct: 336 VDKEFLRLWFKENCNPYEDEVLPAAPAELVTELAWRYIFLYETITGSRI----DIIPTQE 391

Query: 306 RIRNNLRKYTHRHLSS 321
            I + + + T + LSS
Sbjct: 392 PIHDRISRNTSQALSS 407


>gi|19347902|gb|AAL85973.1| putative phosphoribosyamidoimidazole-succinocarboxamide synthase
           [Arabidopsis thaliana]
          Length = 374

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 198/316 (62%), Gaps = 10/316 (3%)

Query: 7   AYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHH 66
           A +P L +   GKVR+ Y   D   + I TDRLSAFD+N+A IP+KG+VLN+ + +WF++
Sbjct: 64  ATVPGLKSRIKGKVRDIYDAGD-YLVLITTDRLSAFDRNLASIPFKGQVLNETSLWWFNN 122

Query: 67  TSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLL 126
           T  I  N  +  PD NV++ ++  +FPIE +VRGY+ G+T TSL T Y  G R      L
Sbjct: 123 TQHITPNAIVSSPDRNVVIAKKCSVFPIEFVVRGYVTGSTDTSLWTVYNKGVRNYCGNEL 182

Query: 127 PDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFE 186
            D +  NQKLP  ++TPTTK+++     D PISPNEI+  G +T+ +++  S  ALSLFE
Sbjct: 183 SDGLVKNQKLPANILTPTTKAADH----DVPISPNEIVEGGFMTQAEFDEASMKALSLFE 238

Query: 187 RGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
            G  +A ++GLILVD+KYEFG     +I+L DEIHTPDSSRYW   +YE+ F++G+ P  
Sbjct: 239 FGQGVAKKHGLILVDTKYEFGRSSDGSILLIDEIHTPDSSRYWLAGSYEERFQKGLEPEN 298

Query: 247 LDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
           +DK+F+R W    CNPY D + P  P  ++   +  YI  YE ITG +       +P  E
Sbjct: 299 VDKEFLRLWFKENCNPYEDEVLPAAPAELVTELAWRYIFLYETITGSRI----DIIPTQE 354

Query: 306 RIRNNLRKYTHRHLSS 321
            I + + + T + LSS
Sbjct: 355 PIHDRISRNTSQALSS 370


>gi|298715710|emb|CBJ28207.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 366

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 185/304 (60%), Gaps = 8/304 (2%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLD 77
           GKVR+ Y   D   + + TDR SAFD+ +A +P+KG VLNQ + +WF  T  I  NH L 
Sbjct: 65  GKVRDTYICDDAI-VLVTTDRQSAFDRQLARVPFKGAVLNQTSAWWFEKTRHIAPNHLLG 123

Query: 78  YPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLP 137
            P PNV VG++ ++FPIE ++RGYL G+T TS+   Y+ G R    + LP+ MS NQ LP
Sbjct: 124 SPHPNVCVGKKCKVFPIEFVMRGYLTGSTSTSIWKNYEKGTRAYCGHTLPEGMSKNQALP 183

Query: 138 YP-VITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENG 196
              ++TPTTK        D+ IS  EI+    +++  W+  S  A +LF  G + A E G
Sbjct: 184 MGNILTPTTKDDLH----DELISAQEIVSSNRMSQQDWDECSRLAHALFRFGQEAAAERG 239

Query: 197 LILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWI 256
           LILVD+KYE G D   NIIL DEIHTPDSSRYW  ETYE +  +G  P  +DK+F+R W 
Sbjct: 240 LILVDTKYELGKDADGNIILVDEIHTPDSSRYWVKETYEGNISQGREPENIDKEFLRRWY 299

Query: 257 LTRCNPYRD-NIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPL-ERIRNNLRKY 314
              C+PY+D  +PD P  ++   S+ Y+  YE ITG  F+  + + PP+ ER+ +++  +
Sbjct: 300 TQHCDPYKDETVPDAPRELVAELSRRYVMLYEIITGQDFVFPSEDGPPVDERMSSSVSNF 359

Query: 315 THRH 318
              H
Sbjct: 360 LKSH 363


>gi|308811086|ref|XP_003082851.1| phosphoribosylimida (ISS) [Ostreococcus tauri]
 gi|116054729|emb|CAL56806.1| phosphoribosylimida (ISS) [Ostreococcus tauri]
          Length = 354

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 138/303 (45%), Positives = 185/303 (61%), Gaps = 16/303 (5%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           Y+GKVR+ Y   D T I + TDR SAFD+++A IP+KG VLNQ +Q+WF  T+DI  N  
Sbjct: 59  YAGKVRDTYVSGD-TMIAVTTDRQSAFDRHLAFIPFKGAVLNQTSQWWFRQTADIVPNAV 117

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
           L  PDPNV V ++ ++FPIE +VRGYL G+T TSL T YK G R      L D M  NQK
Sbjct: 118 LATPDPNVTVMRRCEVFPIEFVVRGYLTGSTSTSLWTHYKKGGRNYCGNELADGMVKNQK 177

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           LP  ++TPTTK  E     D+PIS  +I+  G + +   +   +  L +FE    +A   
Sbjct: 178 LPMNIVTPTTKEKEH----DRPISLEDIVKEGWMKQEDLDYCVAKTLEVFEYAQGIAATR 233

Query: 196 GLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNW 255
           GLILVD+KYEFG D    I L DEI+TPDSSRYW  ++Y +    G  P  +DK+F+R W
Sbjct: 234 GLILVDTKYEFGRDSDGTIRLIDEINTPDSSRYWLNDSYAERHAAGKEPDMIDKEFLRLW 293

Query: 256 ILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPL-----ERIRN 309
              RC+PY+D + P+ P +++   S  Y+  YE ITG  F     E+PP      ER+RN
Sbjct: 294 FAERCDPYKDEVLPEAPADLVAELSSRYVKLYEMITGETF-----EVPPTSVDVNERMRN 348

Query: 310 NLR 312
           +L+
Sbjct: 349 SLK 351


>gi|242044994|ref|XP_002460368.1| hypothetical protein SORBIDRAFT_02g027070 [Sorghum bicolor]
 gi|241923745|gb|EER96889.1| hypothetical protein SORBIDRAFT_02g027070 [Sorghum bicolor]
          Length = 400

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 133/306 (43%), Positives = 188/306 (61%), Gaps = 6/306 (1%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTS 68
           +P L     GKVR+ Y  S    + + TDR SAFD+ +A IP+KG+VLN+ + +WF+ T 
Sbjct: 95  VPGLRLAAKGKVRDVY-ESGEHLVLVTTDRQSAFDRVLASIPFKGQVLNETSLWWFNQTR 153

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            I  N  +  PD NV + ++  +FP+E +VRG++ G+T TSL T Y  G R      LPD
Sbjct: 154 HITPNAVVSSPDKNVTIAKRCTVFPVEFVVRGFVTGSTDTSLWTVYNKGVRNYCGNALPD 213

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M  NQKL   ++TPTTK+++     D P++P+EII  G++++  +    S ALSLF  G
Sbjct: 214 GMVKNQKLSANILTPTTKAADH----DVPVTPDEIIKSGLMSKEDFHEAGSKALSLFAYG 269

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            K+ALENGLILVD+KYEFG      I+L DE+HTPDSSRYW   +YE  F+ G+ P  +D
Sbjct: 270 QKVALENGLILVDTKYEFGKTADGTIVLIDEVHTPDSSRYWIANSYEDRFKSGLEPENVD 329

Query: 249 KDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERI 307
           K+F+R W    CNPY D + P+ PE ++   +  YI  +E IT  KF    ++ P  ERI
Sbjct: 330 KEFLRLWFKNNCNPYEDAVLPEAPEELVCELAWRYIFLFETITKTKFEILETQEPIHERI 389

Query: 308 RNNLRK 313
             N+ +
Sbjct: 390 SRNVAQ 395


>gi|300175735|emb|CBK21278.2| unnamed protein product [Blastocystis hominis]
          Length = 475

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 135/301 (44%), Positives = 185/301 (61%), Gaps = 6/301 (1%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDIC 71
           + N Y GKVR+ +  +D   + I TDR+S FD+ +  +P+KG+VLN  + +WF  T  I 
Sbjct: 176 VQNLYIGKVRDRFECNDKV-VLITTDRMSGFDRQLCTVPFKGQVLNLTSAWWFKQTEHIV 234

Query: 72  SNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMS 131
            NH L  PD NV +G++   FPIE ++RGY+ G+T TSL T Y+NG RK     LP+ + 
Sbjct: 235 PNHVLAIPDANVTIGRKCTPFPIEFVMRGYITGSTSTSLWTNYQNGVRKYCGIDLPEGLK 294

Query: 132 DNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKL 191
            NQKL   +ITPTTKS E     D+ ISP +++ RG +++  W+  +  A  LF  G K+
Sbjct: 295 KNQKLWENLITPTTKSDEH----DELISPEDVVKRGFMSQEDWDYCAQKARELFAFGQKV 350

Query: 192 ALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDF 251
           A E+GLILVD+KYEFG D+   I L DEIHTPDSSRYW   TYE  F  G  P  +DK+F
Sbjct: 351 ADEHGLILVDTKYEFGKDENGMIRLIDEIHTPDSSRYWISSTYEARFAAGENPDNIDKEF 410

Query: 252 IRNWILTRCNPYRDN-IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNN 310
           +R W  T C+PY+D  IP+ P +++   S+ YI  YE ITG  F          +RI +N
Sbjct: 411 LRTWYRTHCDPYKDEVIPEAPADLVNELSRRYIQLYELITGEDFRFPEDGRNAADRIHDN 470

Query: 311 L 311
           +
Sbjct: 471 V 471


>gi|37983622|gb|AAR06292.1| SAICAR synthetase [Nicotiana tabacum]
          Length = 399

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 130/308 (42%), Positives = 194/308 (62%), Gaps = 10/308 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTR--ITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHH 66
           +P L +   GKVR+ Y   DG    + + TDR SAFD+ +A IP+KG+VLN+ + +WF+ 
Sbjct: 93  VPALKSKIRGKVRDIY---DGGDYLVMVTTDRQSAFDRILASIPFKGQVLNETSLWWFNK 149

Query: 67  TSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLL 126
           T  I  N  +  PD NV + ++  +FP+E +VRGY+ G+T TSL T Y  G R      L
Sbjct: 150 TQHITPNAVVSVPDRNVTIARKCSVFPVEFVVRGYVTGSTDTSLWTVYNKGLRNYCGNSL 209

Query: 127 PDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFE 186
           PD +  NQKL   ++TPTTK+++     D P++P+EI+ RG++T+  ++ +S  A+SLFE
Sbjct: 210 PDGLVKNQKLQENILTPTTKAADH----DVPVTPDEIVQRGLMTQADYDEVSRKAISLFE 265

Query: 187 RGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
            G ++AL++GLILVD+KYEFG      I L DE+HTPDSSRYW   +Y++ F+ G+ P  
Sbjct: 266 FGQRVALDHGLILVDTKYEFGKGADGKIYLIDEVHTPDSSRYWIAHSYQERFQSGLEPEN 325

Query: 247 LDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
           +DK+F+R W    CNPY D + PD PE ++   +  YI  +E IT  +F    ++ P  +
Sbjct: 326 IDKEFLRLWFKNHCNPYEDEVLPDAPEELVSELAWRYIFLFETITNSRFEMPGTKEPVHD 385

Query: 306 RIRNNLRK 313
           RI  N+ +
Sbjct: 386 RISRNVSQ 393


>gi|194705918|gb|ACF87043.1| unknown [Zea mays]
          Length = 397

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 130/297 (43%), Positives = 186/297 (62%), Gaps = 6/297 (2%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLD 77
           GKVR+ Y  S    + + TDR SAFD+ +A IP+KG+VLN+ + +WF+ T  I  N  + 
Sbjct: 101 GKVRDVY-ESGQHLVLVTTDRQSAFDRVLASIPFKGQVLNETSLWWFNQTRHITPNAVVS 159

Query: 78  YPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLP 137
            PD NV + ++  +FP+E +VRG++ G+T TSL T Y  G R     +LPD M  N+KL 
Sbjct: 160 SPDKNVTIAKRCTVFPVEFVVRGFVTGSTDTSLWTVYNKGVRNYCGNVLPDGMVKNEKLS 219

Query: 138 YPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGL 197
             ++TPTTK+++     D P++P+EII  G++++  +    S ALSLF  G K+ALENGL
Sbjct: 220 SNILTPTTKAADH----DVPVTPDEIIESGLMSKEDFHEAGSKALSLFAYGQKVALENGL 275

Query: 198 ILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWIL 257
           ILVD+KYEFG      I+L DE+HTPDSSRYW   +YE  F+ G+ P  +DK+F+R W  
Sbjct: 276 ILVDTKYEFGKTPDGTIVLIDEVHTPDSSRYWIANSYEDRFKSGLEPENVDKEFLRLWFK 335

Query: 258 TRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRK 313
             CNPY D + P+ PE ++   +  YI  +E IT  KF    ++ P  ERI  N+ +
Sbjct: 336 NNCNPYEDAVLPEAPEELVCELAWRYIFLFETITKTKFEILEAQEPIHERISRNVAQ 392


>gi|194701314|gb|ACF84741.1| unknown [Zea mays]
          Length = 351

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 130/297 (43%), Positives = 186/297 (62%), Gaps = 6/297 (2%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLD 77
           GKVR+ Y  S    + + TDR SAFD+ +A IP+KG+VLN+ + +WF+ T  I  N  + 
Sbjct: 55  GKVRDVY-ESGQHLVLVTTDRQSAFDRVLASIPFKGQVLNETSLWWFNQTRHITPNAVVS 113

Query: 78  YPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLP 137
            PD NV + ++  +FP+E +VRG++ G+T TSL T Y  G R     +LPD M  N+KL 
Sbjct: 114 SPDKNVTIAKRCTVFPVEFVVRGFVTGSTDTSLWTVYNKGVRNYCGNVLPDGMVKNEKLS 173

Query: 138 YPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGL 197
             ++TPTTK+++     D P++P+EII  G++++  +    S ALSLF  G K+ALENGL
Sbjct: 174 SNILTPTTKAADH----DVPVTPDEIIESGLMSKEDFHEAGSKALSLFAYGQKVALENGL 229

Query: 198 ILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWIL 257
           ILVD+KYEFG      I+L DE+HTPDSSRYW   +YE  F+ G+ P  +DK+F+R W  
Sbjct: 230 ILVDTKYEFGKTPDGTIVLIDEVHTPDSSRYWIANSYEDRFKSGLEPENVDKEFLRLWFK 289

Query: 258 TRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRK 313
             CNPY D + P+ PE ++   +  YI  +E IT  KF    ++ P  ERI  N+ +
Sbjct: 290 NNCNPYEDAVLPEAPEELVCELAWRYIFLFETITKTKFEILEAQEPIHERISRNVAQ 346


>gi|115479657|ref|NP_001063422.1| Os09g0467100 [Oryza sativa Japonica Group]
 gi|46806330|dbj|BAD17522.1| putative succinoaminoimidazolecarboximide ribonucleotide synthetase
           [Oryza sativa Japonica Group]
 gi|113631655|dbj|BAF25336.1| Os09g0467100 [Oryza sativa Japonica Group]
 gi|215693325|dbj|BAG88707.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 403

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 189/306 (61%), Gaps = 6/306 (1%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTS 68
           +P L     GKVR+ Y  S    + + TDR SAFD+ +A IP+KG+VLN+ + +WF  T 
Sbjct: 98  VPGLRLAAKGKVRDVY-ESGEHLVLVTTDRQSAFDRVLASIPFKGQVLNETSLWWFDRTR 156

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            I  N  +  PD NV + ++  +FP+E +VRGY+ G+T TSL T Y  G R     +L D
Sbjct: 157 HITPNAVVSSPDKNVTIAKRCSVFPVEFVVRGYVTGSTDTSLWTVYNKGARNYCGNVLRD 216

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M  NQKL   ++TPTTK+++     D P++P EII+ G++++  ++   S ALSLF  G
Sbjct: 217 GMVKNQKLSANILTPTTKAADH----DVPVTPEEIINSGLMSKEDFDEARSKALSLFAYG 272

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++ALENGLILVD+KYEFG      I+L DE+HTPDSSRYW  ++YE+ F  G+ P  +D
Sbjct: 273 QEVALENGLILVDTKYEFGKTADGTIMLIDEVHTPDSSRYWIADSYEERFSSGLEPENVD 332

Query: 249 KDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERI 307
           K+F+R W    CNPY D + P+ PE ++   +  YI  +E IT  KF    ++ P  ERI
Sbjct: 333 KEFLRLWFKNNCNPYEDAVLPEAPEELVCELAWRYIFLFETITNTKFEIPKTQEPIHERI 392

Query: 308 RNNLRK 313
             N+ +
Sbjct: 393 SRNVAQ 398


>gi|323451545|gb|EGB07422.1| hypothetical protein AURANDRAFT_27954 [Aureococcus anophagefferens]
          Length = 344

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 126/282 (44%), Positives = 176/282 (62%), Gaps = 7/282 (2%)

Query: 16  YSGKVRENYFLSDGTR--ITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSN 73
           Y+GKVR+ Y  +   R  +  AT R SAFD+ +A +P+KG VLNQ++ +WF  T  I  N
Sbjct: 44  YNGKVRDVYSPACAPRHVVLCATGRQSAFDRALAVVPFKGSVLNQVSAWWFAETRSITPN 103

Query: 74  HTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDN 133
           H +  P P+ +V ++ + FPIE +VRGY+ G+T TS+ T YK G R      LPD +  N
Sbjct: 104 HVVAAPLPDCVVAKKCRAFPIEFVVRGYITGSTSTSMWTHYKGGARVYCGIELPDGLEKN 163

Query: 134 QKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLAL 193
            KL  P+ TPTTK  E     D PISP +I+  G +T+ +W+  S+ AL++F RG  +A 
Sbjct: 164 AKLAKPLCTPTTKDVEH----DVPISPADIVASGRMTQAEWDHCSATALAVFARGQAVAA 219

Query: 194 ENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIR 253
             GLILVD+KYEFG+D    I+L DE+ TPDSSRYW   +YE        P  +DK+F+R
Sbjct: 220 SRGLILVDTKYEFGVDDDGTILLIDEVQTPDSSRYWLAASYEARVAAKQEPENIDKEFLR 279

Query: 254 NWILTRCNPYRDN-IPDIPENIILRTSQTYIAAYEKITGLKF 294
            W   RC+PY+D  IPD P++++   S+ YI  +E ITG +F
Sbjct: 280 LWYRERCDPYKDAVIPDAPDDLVCELSRRYILLFELITGQRF 321


>gi|226505168|ref|NP_001149086.1| LOC100282707 [Zea mays]
 gi|195624604|gb|ACG34132.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Zea mays]
          Length = 319

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 130/297 (43%), Positives = 185/297 (62%), Gaps = 6/297 (2%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLD 77
           GKVR+ Y  S    + + TDR SAFD+ +A IP+KG+VLN+ + +WF+ T  I  N  + 
Sbjct: 23  GKVRDVY-ESGQHLVLVTTDRQSAFDRVLASIPFKGQVLNETSLWWFNQTRHITPNAVVS 81

Query: 78  YPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLP 137
            PD NV + ++  +FP+E +VRG++ G+T TSL T Y  G R      LPD M  N+KL 
Sbjct: 82  SPDKNVTIAKRCTVFPVEFVVRGFVTGSTDTSLWTVYNKGVRNYCGNALPDGMVKNEKLS 141

Query: 138 YPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGL 197
             ++TPTTK+++     D P++P+EII  G++++  +    S ALSLF  G K+ALENGL
Sbjct: 142 SNILTPTTKAADH----DVPVTPDEIIESGLMSKEDFHEAGSKALSLFAYGQKVALENGL 197

Query: 198 ILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWIL 257
           ILVD+KYEFG      I+L DE+HTPDSSRYW   +YE  F+ G+ P  +DK+F+R W  
Sbjct: 198 ILVDTKYEFGKTPDGTIVLIDEVHTPDSSRYWIANSYEDRFKSGLEPENVDKEFLRLWFK 257

Query: 258 TRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRK 313
             CNPY D + P+ PE ++   +  YI  +E IT  KF    ++ P  ERI  N+ +
Sbjct: 258 DNCNPYEDAVLPEAPEELVCELAWRYIFLFETITKTKFEILEAQEPIHERISRNVAQ 314


>gi|222641738|gb|EEE69870.1| hypothetical protein OsJ_29683 [Oryza sativa Japonica Group]
          Length = 403

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 130/297 (43%), Positives = 186/297 (62%), Gaps = 6/297 (2%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLD 77
           GKVR+ Y  S    + + TDR SAFD+ +A IP+KG+VLN+ + +WF  T  I  N  + 
Sbjct: 107 GKVRDVY-ESGEHLVLVTTDRQSAFDRVLASIPFKGQVLNETSLWWFDRTRHITPNAVVS 165

Query: 78  YPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLP 137
            PD NV + ++  +FP+E +VRGY+ G+T TSL T Y  G R     +L D M  NQKL 
Sbjct: 166 SPDKNVTIAKRCSVFPVEFVVRGYVTGSTDTSLWTVYNKGARNYCGNVLRDGMVKNQKLS 225

Query: 138 YPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGL 197
             ++TPTTK+++     D P++P EII+ G++++  ++   S ALSLF  G ++ALENGL
Sbjct: 226 ANILTPTTKAADH----DVPVTPEEIINSGLMSKEDFDEARSKALSLFAYGQEVALENGL 281

Query: 198 ILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWIL 257
           ILVD+KYEFG      I+L DE+HTPDSSRYW  ++YE+ F  G+ P  +DK+F+R W  
Sbjct: 282 ILVDTKYEFGKTADGTIMLIDEVHTPDSSRYWIADSYEERFSSGLEPENVDKEFLRLWFK 341

Query: 258 TRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRK 313
             CNPY D + P+ PE ++   +  YI  +E IT  KF    ++ P  ERI  N+ +
Sbjct: 342 NNCNPYEDAVLPEAPEELVCELAWRYIFLFETITNTKFEIPKTQEPIHERISRNVAQ 398


>gi|218202296|gb|EEC84723.1| hypothetical protein OsI_31696 [Oryza sativa Indica Group]
          Length = 403

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 131/306 (42%), Positives = 189/306 (61%), Gaps = 6/306 (1%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTS 68
           +P L     GKVR+ Y  S    + + TDR SAFD+ +A IP+KG+VLN+ + +WF  T 
Sbjct: 98  VPGLRLAAKGKVRDVY-ESGEHLVLVTTDRQSAFDRVLASIPFKGQVLNETSLWWFDRTR 156

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            I  N  +  PD NV + ++  +FP+E +VRGY+ G+T TSL T Y  G R     +L D
Sbjct: 157 HITPNAVVSSPDKNVTIAKRCSVFPVEFVVRGYVTGSTDTSLWTVYNKGARNYCGNVLRD 216

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            +  NQKL   ++TPTTK+++     D P++P EII+ G++++  ++   S ALSLF  G
Sbjct: 217 GLVKNQKLSANILTPTTKAADH----DVPVTPEEIINSGLMSKEDFDEARSKALSLFAYG 272

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++ALENGLILVD+KYEFG      I+L DE+HTPDSSRYW  ++YE+ F  G+ P  +D
Sbjct: 273 QEVALENGLILVDTKYEFGKTADGTIMLIDEVHTPDSSRYWIADSYEERFSSGLEPENVD 332

Query: 249 KDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERI 307
           K+F+R W    CNPY D + P+ PE ++   +  YI  +E IT  KF    ++ P  ERI
Sbjct: 333 KEFLRLWFKNNCNPYEDAVLPEAPEELVCELAWRYIFLFETITNTKFEIPKTQEPIHERI 392

Query: 308 RNNLRK 313
             N+ +
Sbjct: 393 SRNVAQ 398


>gi|162449321|ref|YP_001611688.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Sorangium
           cellulosum 'So ce 56']
 gi|161159903|emb|CAN91208.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Sorangium
           cellulosum 'So ce 56']
          Length = 323

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 185/314 (58%), Gaps = 4/314 (1%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQ 61
           R+L +  +      Y GKVR+ Y   DG R+ + TDR+SAFD+ +  +P KG+VLN+++ 
Sbjct: 13  RVLERTSLAGPFARYEGKVRDCYTTPDGRRLLVVTDRISAFDRVLGTLPLKGQVLNRLSA 72

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +WF  T  +  NH +  PDPNVL   +    P+E++VR Y+ G T TS+ T Y  G+R  
Sbjct: 73  FWFERTRSVAPNHMISQPDPNVLEAIECVPLPVEMVVRAYVTGVTSTSIWTHYARGERVF 132

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
             + LP+ +  N++LP P++TP+TK+ +   G D   S  EI+  G +    ++  +  A
Sbjct: 133 CGHRLPEGLRKNERLPRPILTPSTKAPK--GGHDLSASREEILALGTIDARDFDAAAEMA 190

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L+LF+ G +   E GLILVD+KYEFG D+  NI++ DEIHTPDSSR+W   +Y + F  G
Sbjct: 191 LALFDHGARACAEQGLILVDTKYEFGKDRDGNIVVIDEIHTPDSSRFWFASSYGERFAAG 250

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
             P   DK+++R W+  R       IP IP+ + +  S+ YI A+E+ITG  F+ D  + 
Sbjct: 251 EDPESFDKEYVRRWLAARGFQGDGPIPSIPDEVRIEASRRYIEAFERITGAAFVPDLED- 309

Query: 302 PPLERIRNNLRKYT 315
            P  RI  NL  + 
Sbjct: 310 -PAVRIPRNLGAFA 322


>gi|302821881|ref|XP_002992601.1| hypothetical protein SELMODRAFT_135614 [Selaginella moellendorffii]
 gi|300139565|gb|EFJ06303.1| hypothetical protein SELMODRAFT_135614 [Selaginella moellendorffii]
          Length = 365

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 130/305 (42%), Positives = 194/305 (63%), Gaps = 7/305 (2%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTS 68
           +P L     GKVR+ Y   D   + + TDR+SAFD+ +A IP+KG+VLNQ + +WF++T 
Sbjct: 62  VPGLGPKRRGKVRDVYETKDHL-VIVTTDRMSAFDRVLASIPFKGQVLNQTSVWWFNNTR 120

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            I  N  +  PDPNV + ++  +FP+E +VRGY+ G+T TSL T Y  G R      LP+
Sbjct: 121 HITPNAFVSAPDPNVTIARKCAVFPVEFVVRGYITGSTSTSLWTVYNQGIRYYCGNDLPE 180

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            +  NQ+L Y ++TPTTKS +     D+PIS  EI+ +G+++   ++++SS AL+LF  G
Sbjct: 181 GLIKNQRLDYLMLTPTTKSDDH----DRPISGEEIVEQGLMSEADYKSVSSKALALFAYG 236

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++AL++GL+LVD+KYEFG     +I L DE+HTPDSSRYW   +YE+  ++G+ P  +D
Sbjct: 237 QEVALKHGLLLVDTKYEFGKMADGSICLIDEVHTPDSSRYWIAGSYEERMKQGLEPENID 296

Query: 249 KDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA-DNSELPPLER 306
           K+F+R W    CNPY+D + PD P  ++   +  YI  YE IT  K I  + +E    ER
Sbjct: 297 KEFLRLWFKDNCNPYKDKVLPDAPVELVTELAWRYIHLYETITSEKMIVPEKAEEDAHER 356

Query: 307 IRNNL 311
           I  ++
Sbjct: 357 ITRSV 361


>gi|302769239|ref|XP_002968039.1| hypothetical protein SELMODRAFT_409077 [Selaginella moellendorffii]
 gi|300164777|gb|EFJ31386.1| hypothetical protein SELMODRAFT_409077 [Selaginella moellendorffii]
          Length = 365

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 130/305 (42%), Positives = 193/305 (63%), Gaps = 7/305 (2%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTS 68
           +P L     GKVR+ Y   D   + + TDR+SAFD+ +A IP+KG+VLNQ + +WF++T 
Sbjct: 62  VPGLGPKRRGKVRDVYETKDHL-VIVTTDRMSAFDRVLASIPFKGQVLNQTSVWWFNNTR 120

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            I  N  +  PDPNV + ++  +FP+E +VRGY+ G+T TSL T Y  G R      LP+
Sbjct: 121 HITPNAFVSAPDPNVTIARKCAVFPVEFVVRGYITGSTSTSLWTVYNQGIRYYCGNDLPE 180

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            +  NQ+L Y ++TPTTKS +     D+PIS  EI+ +G+++   ++++SS AL+LF  G
Sbjct: 181 GLIKNQRLDYLMLTPTTKSDDH----DRPISGEEIVEQGLMSEADYKSVSSKALALFAYG 236

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++AL++GL+LVD+KYEFG     +I L DE+HTPDSSRYW   +YE+  ++G+ P  +D
Sbjct: 237 QEVALKHGLLLVDTKYEFGKMADGSICLIDEVHTPDSSRYWIAGSYEERMKQGLEPENID 296

Query: 249 KDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA-DNSELPPLER 306
           K+F+R W    CNPY D + PD P  ++   +  YI  YE IT  K I  + +E    ER
Sbjct: 297 KEFLRLWFKDNCNPYEDKVLPDAPVELVTELAWRYIHLYETITSEKMIVPEKAEEDAHER 356

Query: 307 IRNNL 311
           I  ++
Sbjct: 357 ITRSV 361


>gi|1709932|sp|Q07463|PUR7_VIGAC RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase, chloroplastic; AltName: Full=SAICAR
           synthetase; Flags: Precursor
          Length = 341

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 122/268 (45%), Positives = 177/268 (66%), Gaps = 6/268 (2%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTS 68
           +P L +   GKVR+ Y   D   + + TDR SAFD+ +A IP+KG+VLN+ + +WF  T 
Sbjct: 79  VPGLVSKTRGKVRDIYDAGD-YLVLVTTDRQSAFDRILASIPFKGQVLNETSLWWFERTK 137

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            I  N  +  PD NV + ++  +FP+E + RG++ G+T TSL T Y  G R     +LPD
Sbjct: 138 QIVPNAVVSAPDKNVTIAKKCSVFPVEFVARGFVTGSTDTSLWTVYNKGARNYCGNVLPD 197

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M  NQKL   ++TPTTK+++     D P++P+EII RG++TR+ +E +S  ALSLFE G
Sbjct: 198 GMVKNQKLSENILTPTTKAADH----DVPVTPDEIIERGLMTRSDYEEVSEKALSLFEYG 253

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A E+GLILVD+KYEFG     +I+L DE+HTPDSSRYW   +Y + F+ G+ P  +D
Sbjct: 254 QQVASEHGLILVDTKYEFGKANDGSIMLIDEVHTPDSSRYWIASSYPERFQNGLEPENID 313

Query: 249 KDFIRNWILTRCNPYRDNI-PDIPENII 275
           K+F+R W  + CNPY D + PD PE+++
Sbjct: 314 KEFLRLWFKSHCNPYEDEVLPDAPEDLL 341


>gi|170644|gb|AAC37399.1| 5'-phosphoribosyl-4-(N-succinocarboxamide)-5-ami noimidazole
           synthetase [Vigna aconitifolia]
          Length = 308

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 122/268 (45%), Positives = 177/268 (66%), Gaps = 6/268 (2%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTS 68
           +P L +   GKVR+ Y   D   + + TDR SAFD+ +A IP+KG+VLN+ + +WF  T 
Sbjct: 46  VPGLVSKTRGKVRDIYDAGD-YLVLVTTDRQSAFDRILASIPFKGQVLNETSLWWFERTK 104

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            I  N  +  PD NV + ++  +FP+E + RG++ G+T TSL T Y  G R     +LPD
Sbjct: 105 QIVPNAVVSAPDKNVTIAKKCSVFPVEFVARGFVTGSTDTSLWTVYNKGARNYCGNVLPD 164

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M  NQKL   ++TPTTK+++     D P++P+EII RG++TR+ +E +S  ALSLFE G
Sbjct: 165 GMVKNQKLSENILTPTTKAADH----DVPVTPDEIIERGLMTRSDYEEVSEKALSLFEYG 220

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A E+GLILVD+KYEFG     +I+L DE+HTPDSSRYW   +Y + F+ G+ P  +D
Sbjct: 221 QQVASEHGLILVDTKYEFGKANDGSIMLIDEVHTPDSSRYWIASSYPERFQNGLEPENID 280

Query: 249 KDFIRNWILTRCNPYRDNI-PDIPENII 275
           K+F+R W  + CNPY D + PD PE+++
Sbjct: 281 KEFLRLWFKSHCNPYEDEVLPDAPEDLL 308


>gi|255087808|ref|XP_002505827.1| predicted protein [Micromonas sp. RCC299]
 gi|226521097|gb|ACO67085.1| predicted protein [Micromonas sp. RCC299]
          Length = 375

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/291 (45%), Positives = 179/291 (61%), Gaps = 11/291 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           Y GKVR+ Y + D   I + TDR SAFD+++A IP+KG VLN+ + +WF+ T DI  N  
Sbjct: 78  YEGKVRDTY-VDDELMIAVTTDRQSAFDRHLASIPFKGAVLNRTSAWWFNQTKDIVPNAW 136

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
           +  PDPNV V ++  +FPIE +VRGYL G+T TSL T Y  G R      L D M  NQK
Sbjct: 137 ISSPDPNVTVMKKCTVFPIEFVVRGYLTGSTSTSLWTHYSKGGRDYCGNPLADGMVKNQK 196

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           LP  ++TPTTK  E     D+PIS  +I+  G + ++  +   +  L +FE   ++A E 
Sbjct: 197 LPKNIVTPTTKEKEH----DRPISLADIVSEGWMEKDDLDYCVAKTLEVFEFAQRVAAER 252

Query: 196 GLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNW 255
           GLILVD+KYEFG D    I L DEI+TPDSSRYW  ++Y +    G+ P  +DK+F+R W
Sbjct: 253 GLILVDTKYEFGRDADGVIRLIDEINTPDSSRYWLADSYAERHAAGLEPDMIDKEFLRLW 312

Query: 256 ILTRCNPYRD-NIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
              RC+PY D  +P  P+ +++  SQ YI  YE ITG  F     E+PPL+
Sbjct: 313 FAERCDPYNDETLPAAPDELVVELSQRYIKLYEMITGETF-----EVPPLD 358


>gi|255545878|ref|XP_002513999.1| purine biosynthesis protein 7, pur7, putative [Ricinus communis]
 gi|223547085|gb|EEF48582.1| purine biosynthesis protein 7, pur7, putative [Ricinus communis]
          Length = 324

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 176/268 (65%), Gaps = 6/268 (2%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTS 68
           +P L +   GKVR+ Y   D   + + TDR SAFD+ +A IP+KG+VLN+ + +WF  T 
Sbjct: 44  VPGLKSKTRGKVRDIYDGGD-YLVLVTTDRQSAFDRILASIPFKGQVLNETSLWWFDQTQ 102

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            +  N  +  PD NV + ++  +FP+E +VRGY+ G+T TSL T YK G R      LPD
Sbjct: 103 HLTQNAVVSAPDKNVTIAKKCSVFPVEFVVRGYVTGSTDTSLWTVYKKGVRNYCGNALPD 162

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            +  NQKL   ++TPTTK+++     D P++P+EII RG++TR  ++  S  AL LFE G
Sbjct: 163 GLVKNQKLATNILTPTTKAADH----DVPVTPSEIIERGLMTRADYDEASRKALKLFEYG 218

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++ALE+GL+LVD+KYEFG     +++L DE+HTPDSSRYW   +YE+ F++G+ P  +D
Sbjct: 219 QRVALEHGLVLVDTKYEFGKGADGSVLLIDEVHTPDSSRYWIGHSYEERFQKGLEPENID 278

Query: 249 KDFIRNWILTRCNPYRDNI-PDIPENII 275
           K+F+R W    CNPY D + PD PE ++
Sbjct: 279 KEFLRLWFKDHCNPYEDEVLPDAPEELV 306


>gi|145356524|ref|XP_001422478.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144582721|gb|ABP00795.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 367

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 130/298 (43%), Positives = 180/298 (60%), Gaps = 6/298 (2%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           Y GKVR+ Y   D T I + TDR SAFD+++A IP+KG VLNQ +Q+WF  T  I  N  
Sbjct: 72  YEGKVRDTYVTGD-TMIAVTTDRQSAFDRHLAYIPFKGAVLNQTSQWWFKQTEHIVPNAV 130

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
           +  PDPNV V ++ ++FPIE +VRGYL G+T TSL T YK G R      L D M  NQK
Sbjct: 131 VATPDPNVTVMRRCEVFPIEFVVRGYLTGSTSTSLWTHYKTGGRNYCGNALDDGMVKNQK 190

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           LP  ++TPTTK  E     D+PIS  +I+  G + ++  +   +  L +F    ++A   
Sbjct: 191 LPANIVTPTTKEKEH----DRPISLEDIVKEGWMKQDDLDYCVAKTLEVFAYAQEVAATR 246

Query: 196 GLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNW 255
           GLILVD+KYEFG D    I L DEI+TPDSSRYW   +Y +    G+ P  +DK+F+R W
Sbjct: 247 GLILVDTKYEFGRDADGTIRLIDEINTPDSSRYWLSNSYVERHAAGMEPDMIDKEFLRLW 306

Query: 256 ILTRCNPYRD-NIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
              RC+PY+D  +P+ P +++   S  Y+  YE ITG  F    + +   +R+R+ L+
Sbjct: 307 FAERCDPYKDETLPEAPADLVAELSSRYVKLYEMITGETFDVPPAGVDVNKRMRDALK 364


>gi|168001844|ref|XP_001753624.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162695031|gb|EDQ81376.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 342

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 193/305 (63%), Gaps = 6/305 (1%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTS 68
           IP L     GKVR+ Y   D   + + TDR SAFD+ +A +P+KG+VLNQ + +WF++T 
Sbjct: 36  IPSLGPKIRGKVRDIYDAGD-YMVLVTTDRQSAFDRILASVPFKGQVLNQTSIWWFNNTK 94

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            I  N  +  PDPNV + ++  +FP+E +VRG++ G+T TSL T Y  G R      L +
Sbjct: 95  HITDNAIVSAPDPNVTIAKKCTVFPVEFVVRGFVTGSTSTSLWTVYNQGVRNYCGNELKE 154

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M  N+KL   ++TPTTK+++     D PIS +EI  +G+++R  +E + S AL+LF+ G
Sbjct: 155 GMKKNEKLEANILTPTTKAADH----DLPISGDEIAEQGLMSREDYEEVKSRALALFKFG 210

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A ++GL+LVD+KYEFG      I+L DE+HTPDSSRYW   +YE+  R+G+ P  +D
Sbjct: 211 QEVARKHGLLLVDTKYEFGKTSDGTIVLIDEVHTPDSSRYWIAASYEERQRQGLEPENID 270

Query: 249 KDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERI 307
           K+F+R W  ++C+PY   + P+ P+ ++   S  YI  YE ITG KF+  + +    +RI
Sbjct: 271 KEFLRLWFKSQCDPYTAEVLPEAPKELVSELSWRYIVLYETITGTKFVLPDVKENLHDRI 330

Query: 308 RNNLR 312
             N++
Sbjct: 331 IRNVQ 335


>gi|301108181|ref|XP_002903172.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Phytophthora infestans T30-4]
 gi|262097544|gb|EEY55596.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Phytophthora infestans T30-4]
          Length = 342

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/311 (41%), Positives = 188/311 (60%), Gaps = 9/311 (2%)

Query: 7   AYIPELPNY--YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWF 64
           A   ELP +   +GKVR+ Y   D   + ++TDR SAFD+ +A +P+K  VL   + +WF
Sbjct: 32  ALSKELPAFKQITGKVRDVYVFEDRV-LLVSTDRQSAFDRALASVPFKSRVLTLTSVWWF 90

Query: 65  HHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
           + T  I +NH L  P P+ ++ ++  +FP+E +VRGY+ G+T TS+ T YKNG R    +
Sbjct: 91  NQTKHIVANHLLGVPHPSAMLCKKCTVFPVEFVVRGYITGSTSTSMWTNYKNGSRDFCGH 150

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            L D    +QKLP  ++TPTTK  E     D+ IS  EI+  G +T+ QW+      L L
Sbjct: 151 KLQDGYKQHQKLPQNLVTPTTKDDEH----DELISGVEIVSSGRMTQEQWDYCEKKTLEL 206

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGIT 243
           F  G + A + GLILVD+KYEFG D+    I+L DEIHTPDSSRYW  ++YE+   EG +
Sbjct: 207 FAFGQEQAAKRGLILVDTKYEFGYDEATGEILLIDEIHTPDSSRYWLADSYEQRMAEGKS 266

Query: 244 PIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
           P  +DK+F+R W   RC+PY D + P+ P+ ++   S+ YI  YE ITG +F     E+ 
Sbjct: 267 PENIDKEFLRLWFKERCDPYNDAVLPEAPKELVSELSRRYILLYELITGSEFEFPAVEIK 326

Query: 303 PLERIRNNLRK 313
           P + +   +RK
Sbjct: 327 PEDELVEGVRK 337


>gi|223997142|ref|XP_002288244.1| succinoaminoimidazolecarboximide ribonucleotide synthetase
           [Thalassiosira pseudonana CCMP1335]
 gi|220975352|gb|EED93680.1| succinoaminoimidazolecarboximide ribonucleotide synthetase
           [Thalassiosira pseudonana CCMP1335]
          Length = 330

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 184/300 (61%), Gaps = 7/300 (2%)

Query: 13  PNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICS 72
           P   +GKVR+ Y L+    + + TDR S FD+ +A +P+KG+VLN  + YWF  T DI  
Sbjct: 35  PTRLTGKVRDRYDLNSKLAL-VTTDRQSGFDRMLALVPFKGQVLNLTSAYWFEVTKDIVP 93

Query: 73  NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSD 132
           NH L  P PNV V ++   FPIE +VR Y+ G+T TS+   Y++G R    + LPD M  
Sbjct: 94  NHLLSVPHPNVSVVKKCTPFPIEFVVRSYMTGSTSTSIWKNYQDGVRNYCGHDLPDGMKK 153

Query: 133 NQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLA 192
           NQKL   ++TPTTK  E     D+PIS  +II  G + +  ++  +  AL++F +G ++A
Sbjct: 154 NQKLEMTILTPTTKEEEH----DRPISEADIISEGWMKQEDFDVCAKAALAVFAKGQEIA 209

Query: 193 LENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFI 252
            E GLILVD+KYEFG D+   I L DE++TPDSSRYW  ++Y+    EG  P  +DK+F+
Sbjct: 210 AERGLILVDTKYEFGKDENGVINLIDEVNTPDSSRYWLADSYQTMIAEGKEPENIDKEFL 269

Query: 253 RNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKF-IADNSELPPLERIRNN 310
           R W    C+PY+D + P+ P+++++  S+ YI  YE ITG  F   D +E    E I+ +
Sbjct: 270 RLWFRDNCDPYKDEVLPEAPKDLVVELSRRYIKLYETITGKSFEFQDGAEGAIAEAIQKS 329


>gi|223997140|ref|XP_002288243.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220975351|gb|EED93679.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 377

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 184/300 (61%), Gaps = 7/300 (2%)

Query: 13  PNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICS 72
           P   +GKVR+ Y L+    + + TDR S FD+ +A +P+KG+VLN  + YWF  T DI  
Sbjct: 82  PTRLTGKVRDRYDLNSKLAL-VTTDRQSGFDRMLALVPFKGQVLNLTSAYWFEVTKDIVP 140

Query: 73  NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSD 132
           NH L  P PNV V ++   FPIE +VR Y+ G+T TS+   Y++G R    + LPD M  
Sbjct: 141 NHLLSVPHPNVSVVKKCTPFPIEFVVRSYMTGSTSTSIWKNYQDGVRNYCGHDLPDGMKK 200

Query: 133 NQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLA 192
           NQKL   ++TPTTK  E     D+PIS  +II  G + +  ++  +  AL++F +G ++A
Sbjct: 201 NQKLEMTILTPTTKEEEH----DRPISEADIISEGWMKQEDFDVCAKAALAVFAKGQEIA 256

Query: 193 LENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFI 252
            E GLILVD+KYEFG D+   I L DE++TPDSSRYW  ++Y+    EG  P  +DK+F+
Sbjct: 257 AERGLILVDTKYEFGKDENGVINLIDEVNTPDSSRYWLADSYQTMIAEGKEPENIDKEFL 316

Query: 253 RNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKF-IADNSELPPLERIRNN 310
           R W    C+PY+D + P+ P+++++  S+ YI  YE ITG  F   D +E    E I+ +
Sbjct: 317 RLWFRDNCDPYKDEVLPEAPKDLVVELSRRYIKLYETITGKSFEFQDGAEGAIAEAIQKS 376


>gi|268316892|ref|YP_003290611.1| Phosphoribosylaminoimidazolesuccinocarboxamidesy nthase
           [Rhodothermus marinus DSM 4252]
 gi|262334426|gb|ACY48223.1| Phosphoribosylaminoimidazolesuccinocarboxamidesy nthase
           [Rhodothermus marinus DSM 4252]
          Length = 328

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 188/304 (61%), Gaps = 12/304 (3%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
           EL   Y GKVR+ Y + DG  + + TDR+SAFD  +   IP+KG+VLNQ+  Y+F HT+D
Sbjct: 22  ELGTPYRGKVRDVYTV-DGHLVIVTTDRISAFDHILRQTIPFKGQVLNQLAAYFFRHTAD 80

Query: 70  ICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDN 129
           +  NH    PDPNV V ++ +  PIE +VRGYLAG+        Y++G+R++    LP+ 
Sbjct: 81  LVPNHVEAVPDPNVTVARRCRPIPIEFVVRGYLAGHA----WRVYRSGRRELCGKKLPEG 136

Query: 130 MSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGC 189
           +  N +LP P++TP TK+ E   G D+ IS  EII RG+L    ++ I    L+L+ RG 
Sbjct: 137 LVQNARLPEPILTPATKAKE---GHDEDISREEIIARGLLDAETFDRIEVMTLALYRRGA 193

Query: 190 KLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
           ++A   GLILVD+KYEFGID +  I L DE+HTPDSSRY+  + YE+  R+G+    L K
Sbjct: 194 EMAARRGLILVDTKYEFGIDDEGMIRLIDEVHTPDSSRYFYADEYEERLRKGLPQRQLSK 253

Query: 250 DFIRNWILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERI 307
           +F+R W++           +PD+P+++ +  ++ YI  YE++TG  F  D     P +RI
Sbjct: 254 EFVREWLMEHGFMGQPGQQLPDLPDDVRVEIARRYIEVYEQLTGEPFQPDTHP-DPEQRI 312

Query: 308 RNNL 311
           R NL
Sbjct: 313 RENL 316


>gi|325297312|ref|YP_004257229.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides salanitronis DSM 18170]
 gi|324316865|gb|ADY34756.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides salanitronis DSM 18170]
          Length = 315

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 139/311 (44%), Positives = 190/311 (61%), Gaps = 13/311 (4%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
           + P L + Y GKVR+ Y ++D   I +ATDR+SAFD  +   IPYKG++LNQI   +   
Sbjct: 11  HFPGLKSVYHGKVRDVYNINDEKLIMVATDRISAFDVVLPEGIPYKGQMLNQIAAKFLDA 70

Query: 67  TSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLL 126
           T+DIC N  L  PDP V VG   Q FP+E+IVRGYL G+   +    YK+G R+I    L
Sbjct: 71  TADICPNWKLATPDPMVTVGVLCQGFPVEMIVRGYLCGSAWRA----YKSGVREICGVRL 126

Query: 127 PDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFE 186
           PDNM +N+K P+P+ITPTTK+       D+ IS  EI+ RG+ T  ++E +  Y L+LFE
Sbjct: 127 PDNMRENEKFPHPIITPTTKAEMGMH--DEDISKEEILARGLATPEEYEILERYTLALFE 184

Query: 187 RGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
           RG ++A E GLILVD+KYEFG    Q I L DEIHTPDSSRY+  E Y++ F + +    
Sbjct: 185 RGTQIAAERGLILVDTKYEFGKHNGQ-IYLMDEIHTPDSSRYFYSEGYQERFEKELPQKQ 243

Query: 247 LDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPP 303
           L K+F+R W++      ++   +P++   I+   S  YI  +E ITG  F+ AD   L  
Sbjct: 244 LSKEFVREWLMANGFQGKEGQQVPEMTPEIVNSISDRYIELFEHITGEPFVKADTDHLA- 302

Query: 304 LERIRNNLRKY 314
            ERI  N+  Y
Sbjct: 303 -ERIEKNVMDY 312


>gi|189461839|ref|ZP_03010624.1| hypothetical protein BACCOP_02505 [Bacteroides coprocola DSM 17136]
 gi|189431433|gb|EDV00418.1| hypothetical protein BACCOP_02505 [Bacteroides coprocola DSM 17136]
          Length = 314

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 136/311 (43%), Positives = 187/311 (60%), Gaps = 13/311 (4%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
           + P   + Y GKVR+ Y + D   + +ATDR+SAFD  +   IPYKG++LNQI   +   
Sbjct: 11  HFPGQKSVYHGKVRDVYNIKDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKFLDA 70

Query: 67  TSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLL 126
           T+DIC N  L  PDP V VG   + FP+E+IVRGYL G    S    YK+G R+I    L
Sbjct: 71  TTDICPNWKLATPDPMVTVGVMCEGFPVEMIVRGYLCG----SAWRAYKSGVREICGVRL 126

Query: 127 PDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFE 186
           P+ M +N+K P+P+ITPTTK+       D+ IS  EI+ +G+ T  ++ET+  Y L+LFE
Sbjct: 127 PEGMRENEKFPHPIITPTTKAEMGMH--DEDISKEEILAKGLATPEEYETLERYTLALFE 184

Query: 187 RGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
           RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ F  G     
Sbjct: 185 RGTQMAAERGLILVDTKYEFG-KHNGEIYLMDEIHTPDSSRYFYSEGYQERFENGEPQKQ 243

Query: 247 LDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPP 303
           L K+F+R W++      ++   +P++   I+   S  YI  YE ITG  F+ AD  +L  
Sbjct: 244 LSKEFVREWLMANGFQGKEGQKVPEMTPAIVSSISDRYIELYEHITGETFVKADTDQLA- 302

Query: 304 LERIRNNLRKY 314
            ERI  N+ +Y
Sbjct: 303 -ERIEKNVTEY 312


>gi|255039216|ref|YP_003089837.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dyadobacter fermentans DSM 18053]
 gi|254951972|gb|ACT96672.1| Phosphoribosylaminoimidazolesuccinocarboxamidesy nthase
           [Dyadobacter fermentans DSM 18053]
          Length = 311

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 194/306 (63%), Gaps = 13/306 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
            P    +Y GKVR+ Y   +   + IATDR+SAFD  +   IPYKG+VLNQI  ++ + T
Sbjct: 11  FPGQTGFYKGKVRDVYSF-EKRLVMIATDRISAFDVILPRAIPYKGQVLNQIAAHFLNAT 69

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           SDI  N   + PDPNV +G + Q +P+E++VRGYLAG+        YK GKR++    LP
Sbjct: 70  SDIVPNWLEEVPDPNVSIGLKCQAYPVEMVVRGYLAGHAWRE----YKAGKREVCGVALP 125

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + + +N KLP P+ITPTTK+ E   G D+ IS  +I+ +G+++ +++E +  Y L+LF R
Sbjct: 126 EGLKENDKLPQPIITPTTKAHE---GHDEDISREQILAQGLVSEDEYEHLERYTLALFAR 182

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A + GLILVD+KYEFG      I L DEIHTPDSSRY+  +TYE++ R G+    L
Sbjct: 183 GTEMAADQGLILVDTKYEFG-QLDGTIYLIDEIHTPDSSRYFYKDTYEENQRAGVAQKQL 241

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++      +D   +P++ +  +   S+ YI  +EK+TG++F  +N +  PLE
Sbjct: 242 SKEFVREWLIENGFQGKDGQTVPEMTDEKVTSISERYIELFEKVTGMQFQKNNLD-HPLE 300

Query: 306 RIRNNL 311
           RI   +
Sbjct: 301 RIEKAI 306


>gi|149924685|ref|ZP_01913035.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Plesiocystis pacifica SIR-1]
 gi|149814442|gb|EDM74033.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Plesiocystis pacifica SIR-1]
          Length = 323

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 122/307 (39%), Positives = 183/307 (59%), Gaps = 9/307 (2%)

Query: 9   IPE----LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWF 64
           IPE    L   YSGKVREN+   D  R+ I +DR+SAFD  +  IP+KG+VLN + ++WF
Sbjct: 21  IPEAFDVLGTRYSGKVRENFTRGD-ERVIIVSDRVSAFDHVLGTIPFKGQVLNGLARHWF 79

Query: 65  HHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
             T+D   NH    PD  V V  + +   +E++VRGYL G++ TS+   Y++G R    +
Sbjct: 80  AQTADQFPNHLRSVPDAQVTVASECEPIKVEMVVRGYLTGSSSTSIWRAYESGSRSFCGH 139

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            LP+ ++ +QKLP  ++TP TK+++     DQ  S  E++  G++T   ++ +    L+L
Sbjct: 140 TLPEGLARHQKLPTNLVTPATKAAKGEH--DQNASKAELVEMGLITAELFDELEQRCLAL 197

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITP 244
           F RG +LA E GLILVD+KYE G      I+L DEIHTPDSSRYW ++ Y+ S   G  P
Sbjct: 198 FARGQELAAERGLILVDTKYELGRRPDGEIVLIDEIHTPDSSRYWYIDGYDASMAAGEDP 257

Query: 245 IGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPL 304
             LDK+++R W++ +        P + + + +  +  YI  +E++TG  F+ D    PPL
Sbjct: 258 RSLDKEYVRRWLVEQGFRGEGTPPALSDEVRIEAAARYIETFEQVTGTDFVPDLR--PPL 315

Query: 305 ERIRNNL 311
           ER+R  L
Sbjct: 316 ERLRAAL 322


>gi|303289162|ref|XP_003063869.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226454937|gb|EEH52242.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 285

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 170/282 (60%), Gaps = 5/282 (1%)

Query: 32  ITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQM 91
           + + TDR SAFD+++A IP+KG VLNQ + +WF +T  I  N  L  PDPNV + ++ ++
Sbjct: 2   LAVTTDRQSAFDRHLASIPFKGAVLNQTSAWWFDNTKHIVPNAWLSSPDPNVTIMKKCEV 61

Query: 92  FPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESA 151
           FPIE +VRGY+ G+T TSL T Y  G R      L D M  NQKLP  ++TPTTK  E  
Sbjct: 62  FPIEFVVRGYMTGSTSTSLWTHYNAGGRDYCGNALADGMVKNQKLPANIVTPTTKEKEH- 120

Query: 152 SGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKK 211
              D+PIS  +I+  G + +   +      L++F     +A   GLILVD+KYEFG D  
Sbjct: 121 ---DRPISLEDIVKEGWMRKEDLDYCVEKTLAVFSHAQGVAANRGLILVDTKYEFGRDAD 177

Query: 212 QNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRD-NIPDI 270
             I L DEI+TPDSSRYW  ++Y +    G  P  +DK+F+R W   RC+PY+D  IP+ 
Sbjct: 178 GVIRLIDEINTPDSSRYWLADSYAERHAAGREPAMIDKEFLRLWFSERCDPYKDETIPEA 237

Query: 271 PENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           P  +++  SQ YI  YE ITG  F+   +++   ERI  N++
Sbjct: 238 PAELVVELSQRYIKLYEMITGETFVPPPTDVDVGERIAKNVK 279


>gi|237711193|ref|ZP_04541674.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 9_1_42FAA]
 gi|237727558|ref|ZP_04558039.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D4]
 gi|265750785|ref|ZP_06086848.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 3_1_33FAA]
 gi|229434414|gb|EEO44491.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides dorei 5_1_36/D4]
 gi|229455037|gb|EEO60758.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 9_1_42FAA]
 gi|263237681|gb|EEZ23131.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 3_1_33FAA]
          Length = 314

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 187/309 (60%), Gaps = 11/309 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +   T
Sbjct: 12  FPGQKSVYHGKVRDVYNINDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKFLDAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  +  PDP V VG   Q FP+E+IVRGYL G    S    YKNG R+I    LP
Sbjct: 72  TDICPNWKMATPDPMVTVGVMCQGFPVEMIVRGYLCG----SAWRAYKNGVREICGVQLP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+       D+ IS  EI+ +G+ T  ++E +  Y L+LF+R
Sbjct: 128 EGMKENQKFPEPIITPTTKAEMGLH--DEDISKEEILKQGLATPEEYEILEKYTLALFKR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+ +E YE+ F +G     L
Sbjct: 186 GTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYLEGYEERFAKGEPQKQL 244

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++      ++   +P++   I+   S+ Y+  +E ITG KF+  ++E     
Sbjct: 245 SKEFVREWLMENGFQGKEGQQVPEMTPEIVNSISERYMELFEHITGEKFVKADTE-NIAA 303

Query: 306 RIRNNLRKY 314
           RI  N+ +Y
Sbjct: 304 RIEKNVTEY 312


>gi|150005078|ref|YP_001299822.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides vulgatus ATCC 8482]
 gi|149933502|gb|ABR40200.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Bacteroides vulgatus ATCC 8482]
          Length = 314

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 187/309 (60%), Gaps = 11/309 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +   T
Sbjct: 12  FPGQKSVYHGKVRDVYNINDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKFLDAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  +  PDP V VG   Q FP+E+IVRGYL G    S    YKNG R+I    LP
Sbjct: 72  TDICPNWKMATPDPMVTVGVMCQGFPVEMIVRGYLCG----SAWRAYKNGVREICGVKLP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+       D+ IS  EI+ +G+ T  ++E +  Y L+LF+R
Sbjct: 128 EGMKENQKFPEPIITPTTKAEMGLH--DEDISKEEILKQGLATPEEYEILEKYTLALFKR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+ +E YE+ F +G     L
Sbjct: 186 GTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYLEGYEERFAKGEPQKQL 244

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++      ++   +P++   I+   S+ Y+  +E ITG KF+  ++E     
Sbjct: 245 SKEFVREWLMENGFQGKEGQQVPEMTPEIVNSISERYMELFEHITGEKFVKADTE-NIAA 303

Query: 306 RIRNNLRKY 314
           RI  N+ +Y
Sbjct: 304 RIEKNVTEY 312


>gi|212694468|ref|ZP_03302596.1| hypothetical protein BACDOR_03996 [Bacteroides dorei DSM 17855]
 gi|212662969|gb|EEB23543.1| hypothetical protein BACDOR_03996 [Bacteroides dorei DSM 17855]
          Length = 322

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 187/309 (60%), Gaps = 11/309 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +   T
Sbjct: 20  FPGQKSVYHGKVRDVYNINDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKFLDAT 79

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  +  PDP V VG   Q FP+E+IVRGYL G    S    YKNG R+I    LP
Sbjct: 80  TDICPNWKMATPDPMVTVGVMCQGFPVEMIVRGYLCG----SAWRAYKNGVREICGVQLP 135

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+       D+ IS  EI+ +G+ T  ++E +  Y L+LF+R
Sbjct: 136 EGMKENQKFPEPIITPTTKAEMGLH--DEDISKEEILKQGLATPEEYEILEKYTLALFKR 193

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+ +E YE+ F +G     L
Sbjct: 194 GTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYLEGYEERFAKGEPQKQL 252

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++      ++   +P++   I+   S+ Y+  +E ITG KF+  ++E     
Sbjct: 253 SKEFVREWLMENGFQGKEGQQVPEMTPEIVNSISERYMELFEHITGEKFVKADTE-NIAA 311

Query: 306 RIRNNLRKY 314
           RI  N+ +Y
Sbjct: 312 RIEKNVTEY 320


>gi|254883212|ref|ZP_05255922.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 4_3_47FAA]
 gi|319642586|ref|ZP_07997233.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 3_1_40A]
 gi|254836005|gb|EET16314.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 4_3_47FAA]
 gi|317385820|gb|EFV66752.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 3_1_40A]
          Length = 314

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 187/309 (60%), Gaps = 11/309 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +   T
Sbjct: 12  FPGQKSVYHGKVRDVYNINDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKFLDAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  +  PDP V VG   Q FP+E+IVRGYL G    S    YKNG R+I    LP
Sbjct: 72  TDICPNWKMATPDPMVTVGVMCQGFPVEMIVRGYLCG----SAWRAYKNGVREICGVKLP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+       D+ IS  EI+ +G+ T  ++E +  Y L+LF+R
Sbjct: 128 EGMKENQKFPEPIITPTTKAEMGLH--DEDISKEEILKQGLATPEEYEILEKYTLALFKR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+ +E YE+ F +G     L
Sbjct: 186 GTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYLEGYEERFAKGEPQKQL 244

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++      ++   +P++   I+   S+ Y+  +E ITG KF+  ++E     
Sbjct: 245 SKEFVREWLMENGFQGKEGQQVPEMTPEIVNSISERYMELFEHITGEKFVKADTE-NIAA 303

Query: 306 RIRNNLRKY 314
           RI  N+ +Y
Sbjct: 304 RIEKNVTEY 312


>gi|262197026|ref|YP_003268235.1| phosphoribosylaminoimidazolesuccinocarboxamidesy nthase [Haliangium
           ochraceum DSM 14365]
 gi|262080373|gb|ACY16342.1| Phosphoribosylaminoimidazolesuccinocarboxamidesy nthase [Haliangium
           ochraceum DSM 14365]
          Length = 331

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 121/294 (41%), Positives = 173/294 (58%), Gaps = 10/294 (3%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L +   P L   + GKVR++Y   D  R  + TDRLSAFD+ +  IPYKG+VLNQ+  YW
Sbjct: 18  LERTDFPALGEKHPGKVRDSYVRGD-QRTIVVTDRLSAFDRVLGTIPYKGQVLNQLAAYW 76

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F  T+DI  NH +  PDPNV+V +++     E +VR YL G T TS+   Y++G R    
Sbjct: 77  FEETADIAPNHVVRVPDPNVMVVREVTPLRAEFVVRSYLTGVTSTSIWRAYESGARTFCG 136

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
           + LP+ M  NQ LP P++TP+TK+ +     D  +S  E++  G++T   ++     A+ 
Sbjct: 137 HALPEGMHKNQPLPEPILTPSTKAPQGEH--DISVSREELLASGVITEEHFDRAGEIAMK 194

Query: 184 LFERGCKLALENGLILVDSKYEFGIDK----KQNIILADEIHTPDSSRYWEVETYEKSFR 239
           LF  G + A E GLIL D+KYE G+ K    +  I++ DEIHTPDSSRYW  E +E   +
Sbjct: 195 LFAFGQQRAAERGLILADTKYEMGVAKNAAGEDEILVIDEIHTPDSSRYWHAEDFETRVK 254

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITG 291
            G  P  LDK+++R W L     YR +   P +P+ + L  ++ YIA YE +TG
Sbjct: 255 AGQEPRSLDKEYVRRW-LAEERDYRGDGEPPTLPDEVRLEAARRYIATYELVTG 307


>gi|224024794|ref|ZP_03643160.1| hypothetical protein BACCOPRO_01522 [Bacteroides coprophilus DSM
           18228]
 gi|224018021|gb|EEF76028.1| hypothetical protein BACCOPRO_01522 [Bacteroides coprophilus DSM
           18228]
          Length = 327

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 134/311 (43%), Positives = 186/311 (59%), Gaps = 13/311 (4%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
           + P   + Y GKVR+ Y + D   + +ATDR+SAFD  +   IPYKG++LNQI   +   
Sbjct: 23  HFPGQKSVYHGKVRDVYNIGDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKFLDA 82

Query: 67  TSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLL 126
           T+DIC N  L  PDP V VG   Q FP+E+IVRGYL G    S    YK+G R+I    L
Sbjct: 83  TTDICPNWKLATPDPMVTVGVMCQGFPVEMIVRGYLCG----SAWRAYKSGVREICGVRL 138

Query: 127 PDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFE 186
           P+ M +N+K P+P+ITPTTK+       D+ IS  EI+ + + T  ++ET+  Y L+LFE
Sbjct: 139 PEGMRENEKFPHPIITPTTKAEMGMH--DEDISKEEILAKELATPEEYETLEKYTLALFE 196

Query: 187 RGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
           RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+ +E Y++ F +      
Sbjct: 197 RGTQMAAERGLILVDTKYEFG-KHNGEIYLMDEIHTPDSSRYFYLEGYQERFEKEEPQKQ 255

Query: 247 LDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPP 303
           L K+F+R W++      ++   +P++   I+   S  YI  YE ITG  F+ AD + +  
Sbjct: 256 LSKEFVREWLMANGFQGKEGQQVPEMTPEIVSSISDRYIELYEHITGETFVKADTANIA- 314

Query: 304 LERIRNNLRKY 314
            ERI  N+  Y
Sbjct: 315 -ERIEKNVTDY 324


>gi|313679578|ref|YP_004057317.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Oceanithermus profundus DSM 14977]
 gi|313152293|gb|ADR36144.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Oceanithermus profundus DSM 14977]
          Length = 323

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/297 (37%), Positives = 182/297 (61%), Gaps = 11/297 (3%)

Query: 17  SGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           +GKVR+ Y   D  R+ +ATDR+SAFD+ +  +P++G+VLNQ++ +WF  T D+ +NH +
Sbjct: 28  AGKVRDMYRAGD-LRVLVATDRISAFDRVLGAVPFRGQVLNQLSAWWFEATRDLVANHVV 86

Query: 77  DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKL 136
             PDPNV + ++ +  P+E+IVRGY+ G+T TSL   Y+ G+R  Y   LP+ ++ N  L
Sbjct: 87  SVPDPNVTIAREAEPLPVEVIVRGYITGSTTTSLWYLYEQGERAPYGVPLPEGLAKNDPL 146

Query: 137 PYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENG 196
           P P+ITPTTK++      D+ ++  E+  RG++    WE +   AL+LF RG ++A   G
Sbjct: 147 PEPIITPTTKAAPGEH--DERLTAAEVTERGLVEPALWERVQEVALALFARGQEVARRGG 204

Query: 197 LILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWI 256
           L+LVD+KYEFG+   + ++L DE+HTPDSSRYW++  YE+        +  DK+ +R W 
Sbjct: 205 LVLVDTKYEFGLADGE-LVLIDEVHTPDSSRYWDLAAYERG-----EIVHYDKEHLRLWY 258

Query: 257 LTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLRK 313
             R        P +   +    ++ Y++ +E++TG +F  +    P   RI+ N+ +
Sbjct: 259 AARGFRGEGEPPPLAPELARELAELYVSVFERLTGARF--EPGAQPAGPRIQENVER 313


>gi|294778886|ref|ZP_06744302.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides vulgatus PC510]
 gi|294447195|gb|EFG15779.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides vulgatus PC510]
          Length = 322

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 132/309 (42%), Positives = 187/309 (60%), Gaps = 11/309 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +   T
Sbjct: 20  FPGQKSVYHGKVRDVYNINDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKFLDAT 79

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  +  PDP V VG   Q FP+E+IVRGYL G    S    YKNG R+I    LP
Sbjct: 80  TDICPNWKMATPDPMVTVGVMCQGFPVEMIVRGYLCG----SAWRAYKNGVREICGVKLP 135

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+       D+ IS  EI+ +G+ T  ++E +  Y L+LF+R
Sbjct: 136 EGMKENQKFPEPIITPTTKAEMGLH--DEDISKEEILKQGLATPEEYEILEKYTLALFKR 193

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A + GLILVD+KYEFG      I L DEIHTPDSSRY+ +E YE+ F +G     L
Sbjct: 194 GTEIAAKRGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYLEGYEERFAKGEPQKQL 252

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++      ++   +P++   I+   S+ Y+  +E ITG KF+  ++E     
Sbjct: 253 SKEFVREWLMENGFQGKEGQQVPEMTPEIVNSISERYMELFEHITGEKFVKADTE-NIAT 311

Query: 306 RIRNNLRKY 314
           RI  N+ +Y
Sbjct: 312 RIEKNVTEY 320


>gi|108761229|ref|YP_630309.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Myxococcus xanthus DK 1622]
 gi|108465109|gb|ABF90294.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Myxococcus xanthus DK 1622]
          Length = 319

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 131/311 (42%), Positives = 176/311 (56%), Gaps = 11/311 (3%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYW 63
           L +  +P L  +Y GKVRE Y   D   I + TDRLSAFD  +  IP+KGEVLN+++ +W
Sbjct: 14  LQQTDLPALGQHYRGKVRETY-RQDDQLILVTTDRLSAFDHILTTIPFKGEVLNRLSAFW 72

Query: 64  FHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           F  T  I  NH LD PD NV V +  Q F +E++VRGYL G    SL   Y+ G    Y 
Sbjct: 73  FERTKHIVPNHVLDVPDANVTVARACQPFAVEVVVRGYLTG----SLWRDYQKGTHTAYG 128

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
              PD +  ++  P P+ITP+TK+       D+PIS  E++ RG+ T   W  IS  AL 
Sbjct: 129 LPFPDGLRKDEAFPAPLITPSTKAEYGLH--DEPISEKELLARGLATPGDWARISEAALG 186

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           LF  G K A   GLILVD+KYEFG      + + DE+HTPDSSRYW  + YE  F +G  
Sbjct: 187 LFAEGQKWARSRGLILVDTKYEFG-KVGDTLYVIDEMHTPDSSRYWMADEYEARFAKGED 245

Query: 244 PIGLDKDFIRNWILTRCN-PYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
              LDK+ IR W++   N   +   P IP+++ +  +  Y+AAYE ITG     +  ++ 
Sbjct: 246 QRMLDKENIRQWLIRERNFSGQGTPPPIPDDVRVDLAAKYVAAYEHITGTTLTLEPGDVK 305

Query: 303 PLERIRNNLRK 313
              RI  NLR+
Sbjct: 306 --TRIERNLRE 314


>gi|302854738|ref|XP_002958874.1| hypothetical protein VOLCADRAFT_100186 [Volvox carteri f.
           nagariensis]
 gi|300255776|gb|EFJ40062.1| hypothetical protein VOLCADRAFT_100186 [Volvox carteri f.
           nagariensis]
          Length = 298

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 162/261 (62%), Gaps = 5/261 (1%)

Query: 54  EVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTF 113
           EVLNQ   +WF  TS I  +  L  PDPNV V ++ ++FP+E + RG++ G+T TSL T 
Sbjct: 38  EVLNQTAAWWFSATSHIVPSALLTLPDPNVAVMKKCRVFPVEFVCRGFMTGSTDTSLWTH 97

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
           YK G R+      PD M  N +L   VITPTTK+ +     D PISP EI+ +G++T+ +
Sbjct: 98  YKAGARQYCGNSFPDGMRKNDRLVANVITPTTKAEDH----DVPISPKEIVEQGLMTQEE 153

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
           W+T+S+ AL +F+ G + A   GL+LVD+KYEFG D    I + DE+HTPDSSRYW  +T
Sbjct: 154 WDTVSAAALRIFQFGQEEAARRGLLLVDTKYEFGKDADGTIRIIDEVHTPDSSRYWLADT 213

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGL 292
           Y      G+ P  +DK+F+R W   RC+PY+D + P+ P  ++   S+ Y+  YE+ITG 
Sbjct: 214 YAARHAAGLEPENIDKEFLRLWFRQRCDPYKDAVLPEAPAELVCELSKRYVYLYERITGQ 273

Query: 293 KFIADNSELPPLERIRNNLRK 313
            F   +   P  ERI  NLRK
Sbjct: 274 PFQVPDLATPVNERIVANLRK 294


>gi|153807538|ref|ZP_01960206.1| hypothetical protein BACCAC_01818 [Bacteroides caccae ATCC 43185]
 gi|149129900|gb|EDM21112.1| hypothetical protein BACCAC_01818 [Bacteroides caccae ATCC 43185]
          Length = 314

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 136/320 (42%), Positives = 189/320 (59%), Gaps = 15/320 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG   + FP+E+IVRGYL G    S    YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKLATPDPMVTVGVLCEGFPVEMIVRGYLCG----SAWRAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +NQK P P++TPTTK+       D+ IS  EI+ +G+ T  ++E +
Sbjct: 117 VREICGVKLPDGMRENQKFPEPIVTPTTKAEMGLH--DEDISKEEILKQGLATPEEYEIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYAEGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +D   +P++   I+   S  YI  +E ITG KF+
Sbjct: 234 FEKGEAQKQLSKEFVREWLMENGFQGKDGQKVPEMTPAIVQSISDRYIELFENITGEKFV 293

Query: 296 A-DNSELPPLERIRNNLRKY 314
             D S +   ERI  N+  +
Sbjct: 294 KEDTSNIA--ERIEKNVMDF 311


>gi|150008601|ref|YP_001303344.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Parabacteroides distasonis ATCC 8503]
 gi|255014399|ref|ZP_05286525.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_7]
 gi|262383451|ref|ZP_06076587.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_33B]
 gi|298376133|ref|ZP_06986089.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 3_1_19]
 gi|301309499|ref|ZP_07215441.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 20_3]
 gi|149937025|gb|ABR43722.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Parabacteroides distasonis ATCC 8503]
 gi|262294349|gb|EEY82281.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_33B]
 gi|298267170|gb|EFI08827.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 3_1_19]
 gi|300832588|gb|EFK63216.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 20_3]
          Length = 316

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 185/309 (59%), Gaps = 11/309 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +   T
Sbjct: 12  FPRQKSVYHGKVRDVYNINDEVLVMVATDRISAFDVILPEGIPYKGQMLNQIAAKFLDAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  +  PDP V VG Q Q FP+E+IVRGYL G    S    YK+G R+I    LP
Sbjct: 72  TDICPNWKMATPDPMVTVGVQCQGFPVEMIVRGYLCG----SAWRAYKSGVREICGVKLP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQ+ P P+ITPTTK+       DQ IS  EI+ +G++++  +E +  Y ++LF+R
Sbjct: 128 EGMRENQRFPEPIITPTTKAEIGEH--DQDISKEEILAKGLVSKEDYEVLEKYTMALFKR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG  +   I L DEIHTPDSSRY+  E YE  F +G     L
Sbjct: 186 GTEIAKERGLILVDTKYEFG-HRDGKIYLIDEIHTPDSSRYFYSEGYEDRFAKGEPQKQL 244

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++      +    +P++   I+   S  YI  +E ITG  F+   ++   L 
Sbjct: 245 SKEFVREWLMENGFQGKSGQKVPEMTPEIVEGISNRYIELFEHITGETFVKGETD-NLLN 303

Query: 306 RIRNNLRKY 314
           RI  N+ +Y
Sbjct: 304 RIEKNVTEY 312


>gi|295086801|emb|CBK68324.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides xylanisolvens XB1A]
          Length = 331

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 134/322 (41%), Positives = 191/322 (59%), Gaps = 13/322 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 18  MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPEGIPYKGQMLN 77

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G    S    YK+G
Sbjct: 78  QIAAKFLDATTDICPNWKMATPDPMVTVGVLCEGFPVEMIVRGYLCG----SAWRAYKSG 133

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +NQK P P++TPTTK+       D+ IS  EI+ +G+ T  ++E +
Sbjct: 134 VREICGVKLPDGMRENQKFPEPIVTPTTKAEMGLH--DEDISKEEILKQGLATPEEYEIL 191

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 192 EKYTLALFKRGTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYAEGYQER 250

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +D   +P++   I+   S  YI  +E ITG KF+
Sbjct: 251 FEKGEPQKQLSKEFVREWLMENGFQGKDGQKVPEMTPAIVQSISDRYIELFENITGEKFV 310

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++     ERI  N+  + +R
Sbjct: 311 KEDT-TNIAERIFKNVETFLNR 331


>gi|237715536|ref|ZP_04546017.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D1]
 gi|262408544|ref|ZP_06085090.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_22]
 gi|294646495|ref|ZP_06724132.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides ovatus SD CC 2a]
 gi|294807523|ref|ZP_06766320.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides xylanisolvens SD CC 1b]
 gi|298482191|ref|ZP_07000379.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. D22]
 gi|229444245|gb|EEO50036.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D1]
 gi|262353409|gb|EEZ02503.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_22]
 gi|292638114|gb|EFF56495.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides ovatus SD CC 2a]
 gi|294445224|gb|EFG13894.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides xylanisolvens SD CC 1b]
 gi|298271748|gb|EFI13321.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. D22]
          Length = 314

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 134/322 (41%), Positives = 191/322 (59%), Gaps = 13/322 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G    S    YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKMATPDPMVTVGVLCEGFPVEMIVRGYLCG----SAWRAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +NQK P P++TPTTK+       D+ IS  EI+ +G+ T  ++E +
Sbjct: 117 VREICGVKLPDGMRENQKFPEPIVTPTTKAEMGLH--DEDISKEEILKQGLATPEEYEIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYAEGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +D   +P++   I+   S  YI  +E ITG KF+
Sbjct: 234 FEKGEPQKQLSKEFVREWLMENGFQGKDGQKVPEMTPAIVQSISDRYIELFENITGEKFV 293

Query: 296 ADNSELPPLERIRNNLRKYTHR 317
            +++     ERI  N+  + +R
Sbjct: 294 KEDT-TNIAERIFKNVETFLNR 314


>gi|198276470|ref|ZP_03209001.1| hypothetical protein BACPLE_02665 [Bacteroides plebeius DSM 17135]
 gi|198270558|gb|EDY94828.1| hypothetical protein BACPLE_02665 [Bacteroides plebeius DSM 17135]
          Length = 315

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 132/310 (42%), Positives = 184/310 (59%), Gaps = 11/310 (3%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
           + P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +   
Sbjct: 11  HFPGQKSVYHGKVRDVYNINDEKLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKFLDA 70

Query: 67  TSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLL 126
           T+DIC N  L  PDP V VG   Q FP+E+IVRGYL G    S    YK+G R+I    L
Sbjct: 71  TTDICPNWKLATPDPMVTVGVMCQGFPVEMIVRGYLCG----SAWRAYKSGVREICGVRL 126

Query: 127 PDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFE 186
           P+ M +N+K P+P+ITPTTK+       D+ IS  EI+ +G+ T  ++ T+  Y L+LFE
Sbjct: 127 PEGMRENEKFPHPIITPTTKAEMGLH--DEDISKEEILAKGLATPEEYATLEKYTLALFE 184

Query: 187 RGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
           RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ F +      
Sbjct: 185 RGTQMAAERGLILVDTKYEFG-KHNGEIYLMDEIHTPDSSRYFYSEGYQERFEKEEPQKQ 243

Query: 247 LDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPL 304
           L K+F+R W++      ++   +P++   I+   S  YI  YE ITG  F+   +E    
Sbjct: 244 LSKEFVREWLMANGFQGKEGQQVPEMTPAIVESISDRYIELYEHITGESFVKGETE-DLT 302

Query: 305 ERIRNNLRKY 314
           +RI  N+  Y
Sbjct: 303 KRIEKNVTDY 312


>gi|256841382|ref|ZP_05546889.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Parabacteroides sp. D13]
 gi|256737225|gb|EEU50552.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Parabacteroides sp. D13]
          Length = 316

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 132/309 (42%), Positives = 184/309 (59%), Gaps = 11/309 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +   T
Sbjct: 12  FPRQKSVYHGKVRDVYNINDEVLVMVATDRISAFDVILPEGIPYKGQMLNQIAAKFLDAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  L  PDP V VG Q Q FP+E+IVRGYL G    S    YK+G R+I    LP
Sbjct: 72  TDICPNWKLATPDPMVTVGVQCQGFPVEMIVRGYLCG----SAWRAYKSGVREICGVKLP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQ  P P+ITPTTK+       DQ IS  EI+ +G++++  +E +  Y ++LF+R
Sbjct: 128 EGMRENQHFPEPIITPTTKAEIGEH--DQDISKEEILAKGLVSKEDYEVLEKYTMALFKR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG  +   I L DEIHTPDSSRY+  E YE  F +G     L
Sbjct: 186 GTEIAKERGLILVDTKYEFG-HRDGKIYLIDEIHTPDSSRYFYSEGYEDRFAKGEPQKQL 244

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++      +    +P++   I+   S  YI  +E ITG  F+   ++   L 
Sbjct: 245 SKEFVREWLMENGFQGKSGQKVPEMTPEIVEGISNRYIELFEHITGETFVKGETD-NLLN 303

Query: 306 RIRNNLRKY 314
           RI  N+ +Y
Sbjct: 304 RIEKNVTEY 312


>gi|329957124|ref|ZP_08297691.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides clarus YIT 12056]
 gi|328523392|gb|EGF50491.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides clarus YIT 12056]
          Length = 314

 Score =  235 bits (599), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 131/313 (41%), Positives = 186/313 (59%), Gaps = 13/313 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LNQI   +   T
Sbjct: 11  FPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLNQIAAKFLDAT 70

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  +  PDP V VG   + FP+E+IVRGYL G    S    YK+G R+I    LP
Sbjct: 71  TDICPNWKMATPDPMVTVGVMCEGFPVEMIVRGYLCG----SAWRAYKSGVREICGVKLP 126

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +  Y ++LF+R
Sbjct: 127 EGMKENQKFPEPIITPTTKAEIGEHDAD--ISKEEILAKGLATPEEYAVLEKYTMALFKR 184

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ F +G     L
Sbjct: 185 GTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYSEGYEERFAKGEPQKQL 243

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA-DNSELPPL 304
            K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG KF+  D S +   
Sbjct: 244 SKEFVREWLMDNGFQGKEGQQVPEMTDEIVTSISERYIELYEHITGEKFVKEDTSNIA-- 301

Query: 305 ERIRNNLRKYTHR 317
           ERI  N+ +Y  +
Sbjct: 302 ERIEKNVTEYLKK 314


>gi|218129342|ref|ZP_03458146.1| hypothetical protein BACEGG_00919 [Bacteroides eggerthii DSM 20697]
 gi|317475311|ref|ZP_07934577.1| saicar synthetase [Bacteroides eggerthii 1_2_48FAA]
 gi|217988519|gb|EEC54840.1| hypothetical protein BACEGG_00919 [Bacteroides eggerthii DSM 20697]
 gi|316908565|gb|EFV30253.1| saicar synthetase [Bacteroides eggerthii 1_2_48FAA]
          Length = 314

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 131/313 (41%), Positives = 186/313 (59%), Gaps = 13/313 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LNQI   +   T
Sbjct: 11  FPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLNQIAAKFLDAT 70

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  +  PDP V VG   + FP+E+IVRGYL G    S    YK+G R+I    LP
Sbjct: 71  TDICPNWKMATPDPMVTVGVMCEGFPVEMIVRGYLCG----SAWRAYKSGVREICGVKLP 126

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +  Y ++LF+R
Sbjct: 127 EGMKENQKFPEPIITPTTKAEIGEHDAD--ISKEEILAKGLATPEEYAILEKYTMALFKR 184

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ F +G     L
Sbjct: 185 GTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYSEGYEERFAKGEPQKQL 243

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA-DNSELPPL 304
            K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG KF+  D S +   
Sbjct: 244 SKEFVREWLMDNGFQGKEGQQVPEMTDEIVTSISERYIELYEHITGEKFVKEDTSNIA-- 301

Query: 305 ERIRNNLRKYTHR 317
           ERI  N+ +Y  +
Sbjct: 302 ERIEKNVTEYLKK 314


>gi|53712211|ref|YP_098203.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides fragilis YCH46]
 gi|60680391|ref|YP_210535.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides fragilis NCTC 9343]
 gi|253563750|ref|ZP_04841207.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 3_2_5]
 gi|265765544|ref|ZP_06093819.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_16]
 gi|81316539|sp|Q5LH03|PUR7_BACFN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|81383425|sp|Q64XV7|PUR7_BACFR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|52215076|dbj|BAD47669.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Bacteroides fragilis YCH46]
 gi|60491825|emb|CAH06583.1| putative succinoaminoimidazolecarboximide ribonucleotide (SAICAR)
           synthetase [Bacteroides fragilis NCTC 9343]
 gi|251947526|gb|EES87808.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 3_2_5]
 gi|263254928|gb|EEZ26362.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_1_16]
 gi|301161925|emb|CBW21469.1| putative succinoaminoimidazolecarboximide ribonucleotide (SAICAR)
           synthetase [Bacteroides fragilis 638R]
          Length = 314

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 134/323 (41%), Positives = 190/323 (58%), Gaps = 15/323 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEQLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG   + FP+E+IVRGYL G    S    YKNG
Sbjct: 61  QIAAKFLDATTDICPNWKLATPDPMVTVGVLCEGFPVEMIVRGYLCG----SAWRAYKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P++TPTTK+       D+ IS  EI+ +G+ T  ++  +
Sbjct: 117 VREICGVKLPEGMKENQKFPEPIVTPTTKAEMGLH--DEDISKEEILAQGLATPEEYAIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYAEGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++   I+   S+ YI  +E ITG KF+
Sbjct: 234 FEKGEAQKQLSKEFVREWLMENGFQGKEGQKVPEMTPAIVESISERYIELFENITGEKFV 293

Query: 296 A-DNSELPPLERIRNNLRKYTHR 317
             D S +   ERI  N+  +  +
Sbjct: 294 KEDTSNIA--ERIEKNVMAFLAK 314


>gi|154490942|ref|ZP_02030883.1| hypothetical protein PARMER_00859 [Parabacteroides merdae ATCC
           43184]
 gi|154088690|gb|EDN87734.1| hypothetical protein PARMER_00859 [Parabacteroides merdae ATCC
           43184]
          Length = 315

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 135/315 (42%), Positives = 187/315 (59%), Gaps = 17/315 (5%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +   T
Sbjct: 12  FPGQKSVYHGKVRDVYNINDDVLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKFLDAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  L  PDP V VG   Q FP+E+IVRGYL G    S    YK+G R+I    LP
Sbjct: 72  TDICPNWKLATPDPMVTVGVMCQGFPVEMIVRGYLCG----SAWRAYKSGVREICGVKLP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +N++ P P++TPTTK+       D  IS  EI+ +G+ T  ++E +  Y L+LF+R
Sbjct: 128 EGMRENERFPEPIVTPTTKAEIGEHDAD--ISKEEILAKGLATPEEYELLEKYTLALFKR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ F +G     L
Sbjct: 186 GTEIAAERGLILVDTKYEFG-KHGGKIYLMDEIHTPDSSRYFYSEGYEERFAKGEPQKQL 244

Query: 248 DKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKF-IADNSELP 302
            K+F+R W++   N ++      +P++   I+   S+ YI  YE ITG KF   D   L 
Sbjct: 245 SKEFVREWLME--NDFQGKAGQKVPEMTPAIVDGISERYIELYEHITGEKFEKGDTDNL- 301

Query: 303 PLERIRNNLRKYTHR 317
            L RI  N+ +Y ++
Sbjct: 302 -LSRIEKNVTEYLNK 315


>gi|218261471|ref|ZP_03476282.1| hypothetical protein PRABACTJOHN_01948 [Parabacteroides johnsonii
           DSM 18315]
 gi|218223989|gb|EEC96639.1| hypothetical protein PRABACTJOHN_01948 [Parabacteroides johnsonii
           DSM 18315]
          Length = 315

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 184/313 (58%), Gaps = 13/313 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IPYKG++LNQI   +   T
Sbjct: 12  FPGQKSVYHGKVRDVYNINDDVLVMVATDRISAFDVVLPEGIPYKGQMLNQIAAKFLDAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  L  PDP V VG   Q FP+E+IVRGYL G    S    YK+G R+I    LP
Sbjct: 72  TDICPNWKLATPDPMVTVGVMCQGFPVEMIVRGYLCG----SAWRAYKSGVREICGIKLP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +N++ P P++TPTTK+       D  IS  EI+ +G+ T  ++E +  Y L+LF+R
Sbjct: 128 EGMRENERFPEPIVTPTTKAEIGEHDAD--ISKEEILAQGLATPEEYELLEKYTLALFKR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ F +G     L
Sbjct: 186 GTEIAAERGLILVDTKYEFG-KHGGKIYLMDEIHTPDSSRYFYSEGYEERFAKGEPQKQL 244

Query: 248 DKDFIRNWILTRC--NPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF-IADNSELPPL 304
            K+F+R W++           +P++   I+   S+ YI  YE ITG KF   D   L  L
Sbjct: 245 SKEFVREWLMENGFQGKAGQKVPEMTPAIVDGISERYIELYEHITGEKFEKGDTDNL--L 302

Query: 305 ERIRNNLRKYTHR 317
            RI  N+ +Y ++
Sbjct: 303 SRIEKNVTEYLNK 315


>gi|29349625|ref|NP_813128.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides thetaiotaomicron VPI-5482]
 gi|253570006|ref|ZP_04847415.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 1_1_6]
 gi|298383886|ref|ZP_06993447.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 1_1_14]
 gi|39931940|sp|Q8A004|PUR7_BACTN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|29341535|gb|AAO79322.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Bacteroides thetaiotaomicron VPI-5482]
 gi|251840387|gb|EES68469.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 1_1_6]
 gi|298263490|gb|EFI06353.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 1_1_14]
          Length = 314

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 134/323 (41%), Positives = 191/323 (59%), Gaps = 15/323 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G    S    YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKMATPDPMVTVGVLCEGFPVEMIVRGYLCG----SAWRTYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +N+K P P++TPTTK+       D+ IS  EI+ +G+ T  ++ET+
Sbjct: 117 VREICGVKLPDGMRENEKFPEPIVTPTTKAEMGLH--DEDISKEEILKQGLATPEEYETL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  + Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYSDGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +D   +P++   I+   S  YI  +E ITG KF+
Sbjct: 234 FEKGEPQKQLSKEFVREWLMENGFQGKDGQKVPEMTPAIVQSISDRYIELFENITGEKFV 293

Query: 296 A-DNSELPPLERIRNNLRKYTHR 317
             D S +   ERI  N+  +  +
Sbjct: 294 KEDTSNIA--ERIEKNVMNFLSK 314


>gi|160891018|ref|ZP_02072021.1| hypothetical protein BACUNI_03465 [Bacteroides uniformis ATCC 8492]
 gi|317480962|ref|ZP_07940042.1| saicar synthetase [Bacteroides sp. 4_1_36]
 gi|156859239|gb|EDO52670.1| hypothetical protein BACUNI_03465 [Bacteroides uniformis ATCC 8492]
 gi|316902855|gb|EFV24729.1| saicar synthetase [Bacteroides sp. 4_1_36]
          Length = 313

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 184/310 (59%), Gaps = 13/310 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LNQI   +   T
Sbjct: 11  FPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLNQIAAKFLDAT 70

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  +  PDP V VG   + FP+E+IVRGYL G    S    YK+G R+I    LP
Sbjct: 71  TDICPNWKMATPDPMVTVGVMCEGFPVEMIVRGYLCG----SAWRAYKSGVREICGVKLP 126

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +  Y ++LF+R
Sbjct: 127 EGMKENQKFPEPIITPTTKAEIGEHDAD--ISKEEILAQGLATPEEYAVLEQYTMALFKR 184

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ F  G     L
Sbjct: 185 GTEIAAERGLILVDTKYEFG-KHDGKIYLMDEIHTPDSSRYFYSEGYEERFANGEPQKQL 243

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA-DNSELPPL 304
            K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG KF+  D S +   
Sbjct: 244 SKEFVREWLMDNGFQGKEGQQVPEMTDEIVTSISERYIELYEHITGEKFVKEDTSNIA-- 301

Query: 305 ERIRNNLRKY 314
           ERI  N+ +Y
Sbjct: 302 ERIEKNVTEY 311


>gi|160887054|ref|ZP_02068057.1| hypothetical protein BACOVA_05068 [Bacteroides ovatus ATCC 8483]
 gi|237721325|ref|ZP_04551806.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_2_4]
 gi|260171634|ref|ZP_05758046.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D2]
 gi|293369407|ref|ZP_06615992.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides ovatus SD CMC 3f]
 gi|299148553|ref|ZP_07041615.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 3_1_23]
 gi|315919948|ref|ZP_07916188.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D2]
 gi|156107465|gb|EDO09210.1| hypothetical protein BACOVA_05068 [Bacteroides ovatus ATCC 8483]
 gi|229449121|gb|EEO54912.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. 2_2_4]
 gi|292635574|gb|EFF54081.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides ovatus SD CMC 3f]
 gi|298513314|gb|EFI37201.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides sp. 3_1_23]
 gi|313693823|gb|EFS30658.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D2]
          Length = 314

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 189/320 (59%), Gaps = 15/320 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G    S    YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKMATPDPMVTVGVLCEGFPVEMIVRGYLCG----SAWRTYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +NQK P P++TPTTK+       D+ IS  EI+ +G+ T  ++E +
Sbjct: 117 VREICGVKLPDGMRENQKFPEPIVTPTTKAEMGLH--DEDISKEEILKQGLATPEEYEIL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYSEGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      +D   +P++   I+   S  YI  +E ITG KF+
Sbjct: 234 FEKGEPQKQLSKEFVREWLMENGFQGKDGQKVPEMTPAIVQSISDRYIELFENITGEKFV 293

Query: 296 A-DNSELPPLERIRNNLRKY 314
             D S +   ERI  N+  +
Sbjct: 294 KEDTSNIA--ERIFKNVETF 311


>gi|270294356|ref|ZP_06200558.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D20]
 gi|270275823|gb|EFA21683.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides sp. D20]
          Length = 313

 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 129/309 (41%), Positives = 184/309 (59%), Gaps = 11/309 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LNQI   +   T
Sbjct: 11  FPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLNQIAAKFLDAT 70

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  +  PDP V VG   + FP+E+IVRGYL G    S    YK+G R+I    LP
Sbjct: 71  TDICPNWKMATPDPMVTVGVMCEGFPVEMIVRGYLCG----SAWRAYKSGVREICGVKLP 126

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +  Y ++LF+R
Sbjct: 127 EGMKENQKFPEPIITPTTKAEIGEHDAD--ISKEEILAQGLATPEEYAVLEQYTMALFKR 184

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ F  G     L
Sbjct: 185 GTEIAAERGLILVDTKYEFG-KHDGKIYLMDEIHTPDSSRYFYSEGYEERFANGEPQKQL 243

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG KF+ +++     E
Sbjct: 244 SKEFVREWLMDNGFQGKEGQQVPEMTDEIVTSISERYIELYEHITGEKFVKEDTG-NIAE 302

Query: 306 RIRNNLRKY 314
           RI  N+ +Y
Sbjct: 303 RIEKNVTEY 311


>gi|319901279|ref|YP_004161007.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides helcogenes P 36-108]
 gi|319416310|gb|ADV43421.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides helcogenes P 36-108]
          Length = 315

 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 132/310 (42%), Positives = 182/310 (58%), Gaps = 13/310 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LNQI   +   T
Sbjct: 13  FPGQQSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLNQIAAKFLDAT 72

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  +  PDP V VG   + FP+E+IVRGYL G    S    YK G R+I    LP
Sbjct: 73  TDICPNWKMATPDPMVTVGVMCEGFPVEMIVRGYLCG----SAWRAYKGGVREICGVKLP 128

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++ T+  Y L+LF+R
Sbjct: 129 EGMKENQKFPEPIITPTTKAEIGEHDAD--ISKEEILAKGLATPEEYATLEKYTLALFKR 186

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ F +G     L
Sbjct: 187 GTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYSEGYEERFLKGEPQKQL 245

Query: 248 DKDFIRNWILTRC--NPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIA-DNSELPPL 304
            K+F+R W++           +P++ + I+   S+ YI  YE ITG KF+  D S +   
Sbjct: 246 SKEFVREWLMDNGFQGQAGQQVPEMTDEIVTGISERYIELYEHITGEKFVKEDTSNITA- 304

Query: 305 ERIRNNLRKY 314
            RI  N+ +Y
Sbjct: 305 -RIEKNVTEY 313


>gi|255693614|ref|ZP_05417289.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides finegoldii DSM 17565]
 gi|260620590|gb|EEX43461.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides finegoldii DSM 17565]
          Length = 314

 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 189/320 (59%), Gaps = 15/320 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG   + FP+E+IVRGYL G    S    YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKLATPDPMVTVGVLCEGFPVEMIVRGYLCG----SAWRAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +N+K P P+ITPTTK+       D+ IS  EI+ +G+ T  ++E +
Sbjct: 117 VREICGVKLPDGMRENEKFPEPIITPTTKAEMGLH--DEDISKEEILKQGLATPEEYEVL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYSEGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++   I+   S  YI  +E ITG KF+
Sbjct: 234 FEKGEPQKQLSKEFVREWLMENGFQGKEGQKVPEMTPAIVQSISDRYIELFENITGEKFV 293

Query: 296 A-DNSELPPLERIRNNLRKY 314
             D S +   ERI  N+  +
Sbjct: 294 KEDTSNIA--ERIEKNVMNF 311


>gi|332827678|gb|EGK00417.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dysgonomonas gadei ATCC BAA-286]
          Length = 316

 Score =  232 bits (592), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 129/310 (41%), Positives = 187/310 (60%), Gaps = 14/310 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   N Y GKVR+ Y + D   + IATDR+SAFD  +   IPYKG+VLNQI   +   T
Sbjct: 12  FPGQTNVYHGKVRDVYSIGDDLLVMIATDRISAFDVVLPQGIPYKGQVLNQIAAKFLDAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DI  N  LD PDP V VG + + + +E+++RGYL G    S    YK G R +    LP
Sbjct: 72  ADIVPNWKLDTPDPMVTVGLRCEQYKVEMVIRGYLTG----SAWREYKAGARTLCGVPLP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +N+K P P+ITPTTK      G D+ IS  EII +G++++ ++E +  Y  +LF+R
Sbjct: 128 EGMKENEKFPTPIITPTTKED---VGHDENISKEEIIAQGLVSKEEYEQLEKYTYALFQR 184

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A +  LILVD+KYEFG  K+  I L DEIHTPDSSRY+  +TY++ F +G     L
Sbjct: 185 GTEMAAQKNLILVDTKYEFG-KKEGKIYLIDEIHTPDSSRYFYADTYQELFDKGEEQRQL 243

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPL 304
            K+F+R W++      +D   +P++ E      S+ YI  YEKI G KF+ A+ +++   
Sbjct: 244 SKEFVRKWLMDNGFQGKDGQKVPEMTEEYCNSVSERYIELYEKIVGEKFVKAEAADVAV- 302

Query: 305 ERIRNNLRKY 314
            R+  N+ +Y
Sbjct: 303 -RLEKNINEY 311


>gi|312130319|ref|YP_003997659.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leadbetterella byssophila DSM 17132]
 gi|311906865|gb|ADQ17306.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leadbetterella byssophila DSM 17132]
          Length = 313

 Score =  232 bits (592), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 132/307 (42%), Positives = 188/307 (61%), Gaps = 13/307 (4%)

Query: 14  NYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICS 72
           ++Y GKVR+ Y L     + IATDR+SAFD  +   IPYKG+VLNQI       T DI  
Sbjct: 16  SFYRGKVRDVYGLGKYV-LMIATDRISAFDVVLPRPIPYKGQVLNQIAARNLEATRDIVP 74

Query: 73  NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSD 132
           N  +  PDPN  +G +   FP+E++VRGYLAG+        YK G+R++    LP+ + +
Sbjct: 75  NWLIAVPDPNAALGIKCDTFPVEMVVRGYLAGHAWRE----YKAGRRQVCGVTLPEGLKE 130

Query: 133 NQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLA 192
           N KLP+P+ITPTTK+ E   G DQ IS  EI+  G++   ++  +  YAL+LFE+G ++A
Sbjct: 131 NDKLPHPIITPTTKAHE---GHDQDISREEILSSGLVQEEKYLMLEKYALALFEKGTQMA 187

Query: 193 LENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFI 252
            ENGLILVD+KYEFG +    I L DEIHTPDSSRY+ ++ YE++   G+    L K+F+
Sbjct: 188 RENGLILVDTKYEFG-EVGDTIYLIDEIHTPDSSRYFYLDKYEENQAAGLPQKQLSKEFV 246

Query: 253 RNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNN 310
           R W++      +D   +P++ +  I   S  YI  YEK TG KF    SE   L+R+ +N
Sbjct: 247 REWLIENGFQGQDGQKVPEMTDEKIEEISNRYIELYEKFTGEKFKKKPSE-NILKRVHDN 305

Query: 311 LRKYTHR 317
           + K+  +
Sbjct: 306 VEKFLKK 312


>gi|255007730|ref|ZP_05279856.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides fragilis 3_1_12]
 gi|313145430|ref|ZP_07807623.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides fragilis 3_1_12]
 gi|313134197|gb|EFR51557.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Bacteroides fragilis 3_1_12]
          Length = 313

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 190/320 (59%), Gaps = 15/320 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IPYKG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEQLVMVATDRISAFDVVLPEGIPYKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG   + FP+E+IVRGYL G    S    YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKVATPDPMVTVGVLCEGFPVEMIVRGYLCG----SAWRAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P++TPTTK+       D+ IS  EI+ +G+ T  ++ T+
Sbjct: 117 VREICGVKLPEGMKENQKFPEPIVTPTTKAEMGLH--DEDISKEEILAQGLATPEEYATL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y L+LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  + Y++ 
Sbjct: 175 EKYTLALFKRGTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYADGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++   I+   S+ YI  +E ITG KF+
Sbjct: 234 FEKGEAQKQLSKEFVREWLMENGFQGKEGQKVPEMTPAIVESISERYIELFENITGEKFV 293

Query: 296 A-DNSELPPLERIRNNLRKY 314
             D S +   ERI  N+  +
Sbjct: 294 KEDTSNIA--ERIEKNVMAF 311


>gi|333029902|ref|ZP_08457963.1| Phosphoribosylaminoimidazole-succinocarboxamides synthase
           [Bacteroides coprosuis DSM 18011]
 gi|332740499|gb|EGJ70981.1| Phosphoribosylaminoimidazole-succinocarboxamides synthase
           [Bacteroides coprosuis DSM 18011]
          Length = 317

 Score =  232 bits (591), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 134/320 (41%), Positives = 187/320 (58%), Gaps = 18/320 (5%)

Query: 4   LSKAYI------PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVL 56
           +SKA +      P   N Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VL
Sbjct: 1   MSKALVKTNFNFPGQKNVYHGKVRDVYNINDDLLVMVATDRISAFDVVLPKGIPFKGQVL 60

Query: 57  NQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           NQI   + + T+ I  N  +  PDP V VG   + F +E+I+R YL G    S    YK 
Sbjct: 61  NQIAAQFLNATAHIVPNWLIATPDPMVTVGLLCEGFRVEMIIRAYLTG----SAWREYKK 116

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G R +    LP+ M +NQK P P+ITPTTK+ E   G D+ IS  EII +G++++  +E 
Sbjct: 117 GARTLCGVQLPEGMKENQKFPTPIITPTTKADE---GHDENISKEEIIAQGLVSKEDYEQ 173

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +  Y  +LFERG K+A E GLILVD+KYEFG  K   I L DEIHTPDSSRY+  E Y++
Sbjct: 174 LEKYTYALFERGSKMAKEKGLILVDTKYEFG-KKDGKIYLIDEIHTPDSSRYFYAEGYKE 232

Query: 237 SFREGITPIGLDKDFIRNWILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
           +F +G+    L K+F+R W++           +P++ E  +   S+ YI  YE I G  F
Sbjct: 233 NFEKGLPQKQLSKEFVRQWLIEHNFMGEPGQQVPEMTEEYVNSVSERYIELYEHIVGKPF 292

Query: 295 IADNSELPPLERIRNNLRKY 314
              NSE    ERI  N++ +
Sbjct: 293 EKANSEHLN-ERIEKNVKAF 311


>gi|258647802|ref|ZP_05735271.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           tannerae ATCC 51259]
 gi|260851616|gb|EEX71485.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           tannerae ATCC 51259]
          Length = 314

 Score =  232 bits (591), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 129/305 (42%), Positives = 185/305 (60%), Gaps = 11/305 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y+GKVR+ Y +     I +A+DR+SAFD  +   IP+KG+VLNQI   +   T+DIC N 
Sbjct: 18  YNGKVRDVYSIEGDKLIMVASDRISAFDVILPKGIPFKGQVLNQIAAKFLDATTDICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG   + FP+E+IVRGYL G    S    YKNG R+I    LPD M +N+
Sbjct: 78  KLATPDPMVTVGITCKGFPVEMIVRGYLCG----SAWRAYKNGVREICGIKLPDGMRENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           K P P++TPTTK+       D  IS  EI+ +G  T  ++  +  Y L LF+RG ++A +
Sbjct: 134 KFPEPIVTPTTKAEIGEH--DAEISKEEILAQGFATPEEYALLEKYTLQLFKRGTEIAAQ 191

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG+   + I L DEIHTPDSSRY+  + Y++ F +G     L K+F+R 
Sbjct: 192 RGLILVDTKYEFGLHDGK-IYLMDEIHTPDSSRYFYSDGYQERFEKGEPQRQLSKEFVRE 250

Query: 255 WILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++      ++   +P++ + I+   S  YI  YE ITG KF+A++S+    ERI  N+ 
Sbjct: 251 WLMDNGFQGKEGQQVPEMTDEIVKSISDRYIELYEHITGEKFVAEDSDKLE-ERIERNVL 309

Query: 313 KYTHR 317
           ++  +
Sbjct: 310 QFLQQ 314


>gi|310823408|ref|YP_003955766.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stigmatella aurantiaca DW4/3-1]
 gi|309396480|gb|ADO73939.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stigmatella aurantiaca DW4/3-1]
          Length = 318

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 129/311 (41%), Positives = 177/311 (56%), Gaps = 13/311 (4%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRIT-IATDRLSAFDQNIACIPYKGEVLNQITQY 62
           L K ++P L ++Y GKVR+ Y   D  R+T + TDRLSAFD  +  IP+KGEVLN++  +
Sbjct: 14  LRKTHLPALGSHYQGKVRDTYRKED--RLTLVTTDRLSAFDHVLTTIPFKGEVLNRLATF 71

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF  T  I  NH LD PD NV V +  Q F +E++VRGYL G    SL   Y+ G    Y
Sbjct: 72  WFERTRHIVPNHVLDVPDANVTVARACQPFALEMVVRGYLTG----SLWRDYQKGTHTAY 127

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
               P  +  +++ P P+ITP+TK+       D PIS  EI+ RG+ +   W  +S  AL
Sbjct: 128 GLPFPAGLRKDERFPMPLITPSTKAEYGQH--DAPISEAEILARGLASPRDWSRLSEAAL 185

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            LF  G + A E GLILVD+KYEFG      + + DE+HTPDSSRYW  E YE  F +G 
Sbjct: 186 GLFAEGQRQARERGLILVDTKYEFG-KVGNELYVIDEMHTPDSSRYWVAEEYEARFAKGE 244

Query: 243 TPIGLDKDFIRNWIL-TRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
               LDK+ IR W++  R        P IP+ + +  +  Y++AYE++TG     +  ++
Sbjct: 245 DQQMLDKENIRQWLIRERGFSGEGTPPPIPDEVRVELAVKYLSAYERLTGNSLRLEPGDV 304

Query: 302 PPLERIRNNLR 312
               RI  NLR
Sbjct: 305 H--ARIEKNLR 313


>gi|189467978|ref|ZP_03016763.1| hypothetical protein BACINT_04372 [Bacteroides intestinalis DSM
           17393]
 gi|189436242|gb|EDV05227.1| hypothetical protein BACINT_04372 [Bacteroides intestinalis DSM
           17393]
          Length = 314

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 132/323 (40%), Positives = 188/323 (58%), Gaps = 15/323 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LN
Sbjct: 1   MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N     PDP V VG   + FPIE+IVRGYL G    S    YK+G
Sbjct: 61  QIAAKFLDATTDICPNWKTATPDPMVTVGVMCEGFPIEMIVRGYLCG----SAWRAYKSG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +
Sbjct: 117 VREICGVKLPEGMKENQKFPEPIITPTTKAEIGEHDAD--ISKEEILAKGLATPEEYAVL 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y ++LF+RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 175 EKYTMALFKRGTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYSEGYQER 233

Query: 238 FREGITPIGLDKDFIRNWILTRC--NPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++           +P++ + I+   S+ YI  YE ITG +F+
Sbjct: 234 FEKGEAQKQLSKEFVREWLMDNSFQGKAGQQVPEMTDEIVASISERYIELYEHITGEQFV 293

Query: 296 A-DNSELPPLERIRNNLRKYTHR 317
             D S +    RI  N+ +Y ++
Sbjct: 294 KEDTSNIAS--RIEKNVTEYLNK 314


>gi|329965267|ref|ZP_08302197.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides fluxus YIT 12057]
 gi|328523287|gb|EGF50387.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroides fluxus YIT 12057]
          Length = 314

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 131/313 (41%), Positives = 185/313 (59%), Gaps = 13/313 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LNQI   +   T
Sbjct: 11  FPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLNQIAAKFLDAT 70

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N  +  PDP V VG   + FP+E+IVRGYL G    S    YK+G R+I    LP
Sbjct: 71  TDICPNWKIATPDPMVTVGVMCEGFPVEMIVRGYLCG----SAWRAYKSGVREICGVKLP 126

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +  Y ++LF R
Sbjct: 127 EGMKENQKFPEPIITPTTKAEIGEHDAD--ISKEEILAKGLATPEEYAILEKYTMALFNR 184

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ F +G     L
Sbjct: 185 GSEIAAERGLILVDTKYEFG-KHDGKIYLMDEIHTPDSSRYFYSEGYEERFAKGEPQKQL 243

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA-DNSELPPL 304
            K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG KFI  D S +   
Sbjct: 244 SKEFVREWLMDNGFQGKEGQQVPEMTDEIVNSISERYIELYEHITGEKFIKEDTSNIA-- 301

Query: 305 ERIRNNLRKYTHR 317
           ERI  N+  + ++
Sbjct: 302 ERIGKNVEAFLNK 314


>gi|326336374|ref|ZP_08202545.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325691548|gb|EGD33516.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 317

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 131/308 (42%), Positives = 179/308 (58%), Gaps = 12/308 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y + D   + +ATDRLSAFD  +   IPYKG++LNQI       T  I  N 
Sbjct: 18  YKGKVRDVYTIGDDLLVMVATDRLSAFDVILPKGIPYKGQILNQIASECMEQTKYIVPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDPNV VG     F +E+++RGYLAG+        YK GKR +   +LP+ + +N 
Sbjct: 78  LLATPDPNVSVGMLCTPFKVEMVIRGYLAGHAARE----YKAGKRTLCGVVLPEGLQENA 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
            LP P+ITP+TK+       D+ IS  EI+ +GI+T + +  I  Y  +LF+RG +LA E
Sbjct: 134 PLPSPIITPSTKADNGLH--DEDISREEILKKGIITADDYAIIEQYTHALFKRGSELAKE 191

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  K   I+L DE+HTPDSSRY+ VE Y +  ++G     L K+F+R 
Sbjct: 192 KGLILVDTKYEFGKTKNGTIVLIDEVHTPDSSRYFYVEGYGERLKKGEPQKQLSKEFVRQ 251

Query: 255 WILTRC--NPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPLERIRNNL 311
           W++         + IP++    I   S+ YI  YE + G KFI AD   +   ERI  N+
Sbjct: 252 WLIENGFQGKAGEKIPEMTHAHIAAISERYIELYEHLLGKKFIKADTHNIK--ERIYTNV 309

Query: 312 RKYTHRHL 319
            +Y H  L
Sbjct: 310 SEYLHSLL 317


>gi|325192643|emb|CCA27066.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase putative
           [Albugo laibachii Nc14]
          Length = 338

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 117/280 (41%), Positives = 172/280 (61%), Gaps = 6/280 (2%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           +SGKVR+ Y   D   + IATDR SAFD+ +A IPYKG VL   + +WF  T  I  NH 
Sbjct: 36  HSGKVRDIYRFPDRI-LLIATDRQSAFDRVLASIPYKGRVLTLTSLWWFDQTKHIVPNHV 94

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
           +  P P+ +VG+  ++FP+E +VRGY+ G+T TS+ T Y +G R+   + L D    +QK
Sbjct: 95  IASPHPSAIVGKICRVFPVEFVVRGYITGSTSTSMWTHYASGCREYCGHRLVDGYVQHQK 154

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           L   ++TPTTK        D+ IS  EI+   ++ +++W+     AL LF  G + A E 
Sbjct: 155 LHENLVTPTTKGETH----DELISGREIVASNLMKQSEWDYCCEKALELFAYGQQRAQER 210

Query: 196 GLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNW 255
           GLILVD+KYEFG+D+   I++ DE+HTPDSSR+W  ++Y++  +    P  +DK+F+R W
Sbjct: 211 GLILVDTKYEFGVDETGTILIVDEMHTPDSSRFWLQKSYKERMQLRQAPESIDKEFLRVW 270

Query: 256 ILTRCNPYR-DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
              RC+PY  + +P+ P  ++   S  YI  +E ITG KF
Sbjct: 271 FKERCDPYSVETLPEAPSELVTELSSRYILLFELITGQKF 310


>gi|224538322|ref|ZP_03678861.1| hypothetical protein BACCELL_03213 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224520065|gb|EEF89170.1| hypothetical protein BACCELL_03213 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 329

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 132/323 (40%), Positives = 189/323 (58%), Gaps = 15/323 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K     P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LN
Sbjct: 16  MKALTKTDFNFPGQKSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLN 75

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N     PDP V VG   + FPIE+IVRGYL G    S    YK+G
Sbjct: 76  QIAAKFLDATTDICPNWKTATPDPMVTVGVMCEGFPIEMIVRGYLCG----SAWRTYKSG 131

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +
Sbjct: 132 VREICGVKLPEGMKENQKFPEPIITPTTKAEIGEHDAD--ISKEEILAKGLATPEEYAIL 189

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y ++LF RG ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  E Y++ 
Sbjct: 190 EKYTMALFNRGTEIAAERGLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYSEGYQER 248

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG +F+
Sbjct: 249 FEKGEAQKQLSKEFVREWLMDNGFQGKEGQQVPEMTDEIVASISERYIELYEHITGEQFV 308

Query: 296 A-DNSELPPLERIRNNLRKYTHR 317
             D S +    RI  N+ +Y ++
Sbjct: 309 KEDTSNIAS--RIEKNVTEYLNK 329


>gi|332886266|gb|EGK06510.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dysgonomonas mossii DSM 22836]
          Length = 316

 Score =  229 bits (585), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 184/309 (59%), Gaps = 14/309 (4%)

Query: 14  NYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICS 72
           N Y GKVR+ Y + +   + IATDR+SAFD  +   IPYKG+VLNQI   +   T+DI  
Sbjct: 17  NVYHGKVRDVYSVGNDLLVMIATDRISAFDVVLPKGIPYKGQVLNQIAAKFLDATADIVP 76

Query: 73  NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSD 132
           N  L  PDP V  G + + + +E+++RGYL G    S    YK G R +    LP+ M +
Sbjct: 77  NWKLATPDPMVTTGLRCEPYKVEMVIRGYLTG----SAWREYKAGARTLCGVSLPEGMKE 132

Query: 133 NQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLA 192
           NQK P P+ITPTTK+ E   G D+ IS  EII +G+++R ++E +  Y  +LF+RG ++A
Sbjct: 133 NQKFPTPIITPTTKADE---GHDENISKEEIIAQGLVSREEYEQLEKYTYALFQRGTEMA 189

Query: 193 LENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFI 252
            +  LILVD+KYEFG  K   I L DEIHTPDSSRY+  +TY+  F +G     L K+F+
Sbjct: 190 AQKNLILVDTKYEFG-KKDGKIYLIDEIHTPDSSRYFYTDTYQDLFEKGEEQRQLSKEFV 248

Query: 253 RNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPLERIRN 309
           R W++      ++   +P++ E      S+ YI  YEKI G  FI AD S +   ERI  
Sbjct: 249 RKWLMDNGFQGKEGQTVPEMTEEYCNSVSERYIELYEKIVGEPFIKADVSNVS--ERIEE 306

Query: 310 NLRKYTHRH 318
           N+ +Y  + 
Sbjct: 307 NISRYLKKR 315


>gi|188994840|ref|YP_001929092.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Porphyromonas gingivalis ATCC 33277]
 gi|188594520|dbj|BAG33495.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Porphyromonas gingivalis ATCC 33277]
          Length = 313

 Score =  229 bits (584), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 185/312 (59%), Gaps = 18/312 (5%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
           +P     Y GKVR+ Y L +   + IATDR+SAFD  + A IPYKG+VLNQI  ++   T
Sbjct: 12  LPGQKAVYHGKVRDVYTLENDLLVMIATDRISAFDVVLPAGIPYKGQVLNQIAAHYLDAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
            DI  N  +  PDP V +G + + F +E+++RGY+ G    S    Y  G+R +    LP
Sbjct: 72  RDIVPNWKIATPDPMVTIGHRCEPFKVEMVIRGYITG----SAWRAYAAGERVLCGLPLP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQ+  +P+ITPTTK+ E   G D+ IS  EII +G++++  +E I  Y  +LFER
Sbjct: 128 EGMRENQRFEHPIITPTTKADE---GHDENISREEIIAQGLVSKEDYEQIERYTYALFER 184

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG  K   I L DEIHTPDSSRY+  E Y++ F  G     L
Sbjct: 185 GTQMAAEKGLILVDTKYEFG-KKDGKIYLIDEIHTPDSSRYFYAEGYQERFERGEAQKQL 243

Query: 248 DKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKF-IADNSELP 302
            K+F+R W++   N ++      IP++ E      S+ YI  YE++ G  F  AD S L 
Sbjct: 244 SKEFVRQWLIE--NGFQGKPGQQIPEMTEAYCDSVSERYIELYERVVGKPFEKADLSNLA 301

Query: 303 PLERIRNNLRKY 314
             ERI  N+ +Y
Sbjct: 302 --ERIEKNITEY 311


>gi|167765214|ref|ZP_02437327.1| hypothetical protein BACSTE_03602 [Bacteroides stercoris ATCC
           43183]
 gi|167696842|gb|EDS13421.1| hypothetical protein BACSTE_03602 [Bacteroides stercoris ATCC
           43183]
          Length = 313

 Score =  229 bits (584), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 130/310 (41%), Positives = 183/310 (59%), Gaps = 13/310 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++    + +ATDR+SAFD  +   IP+KG++LNQI   +   T
Sbjct: 11  FPGQQSVYHGKVRDVYNINGEKLVMVATDRISAFDVVLPKGIPFKGQMLNQIAAKFLDAT 70

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DIC N     PDP V VG   + FP+E+IVRGYL G    S    YK+G R+I    LP
Sbjct: 71  TDICPNWKTATPDPMVTVGVMCEGFPVEMIVRGYLCG----SAWRAYKSGVREICGVKLP 126

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+       D  IS  EI+ +G+ T  ++  +  Y ++LF+R
Sbjct: 127 EGMKENQKFPEPIITPTTKAEIGEHDAD--ISKEEILAKGLATPEEYAILEKYTMALFKR 184

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E  LILVD+KYEFG      I L DEIHTPDSSRY+  E YE+ F +G     L
Sbjct: 185 GTEIAAERDLILVDTKYEFG-KHNGTIYLMDEIHTPDSSRYFYSEGYEERFAKGEPQKQL 243

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA-DNSELPPL 304
            K+F+R W++      ++   +P++ + I+   S+ YI  YE ITG KF+  D S +   
Sbjct: 244 SKEFVREWLMDNGFQGKEGQQVPEMTDEIVTSISERYIELYEHITGEKFVKEDTSNIA-- 301

Query: 305 ERIRNNLRKY 314
           ERI  N+ +Y
Sbjct: 302 ERIEKNVTEY 311


>gi|330995519|ref|ZP_08319423.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Paraprevotella xylaniphila YIT 11841]
 gi|329575431|gb|EGG56973.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Paraprevotella xylaniphila YIT 11841]
          Length = 315

 Score =  229 bits (583), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 182/312 (58%), Gaps = 11/312 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   T
Sbjct: 11  FPGQQSVYHGKVRDVYNINDELMVMVATDRISAFDVILPKGIPFKGQVLNQIAATFLDAT 70

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           SDI  N  L  PDP V VG + + F +E+I+RGYL G    S    Y+NG R++    LP
Sbjct: 71  SDIVPNWKLATPDPMVTVGLKCEGFRVEMIIRGYLTG----SAWREYQNGCRELCGVKLP 126

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+    +G D+ IS  EII +G++++  +E +  Y  +LF R
Sbjct: 127 EGMKENQKFPTPIITPTTKAD---AGHDENISKEEIIAQGLVSKEDYELMEKYTYALFAR 183

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG  K   + L DEIHTPDSSRY+  + Y++ F +G     L
Sbjct: 184 GTEMAAEKGLILVDTKYEFG-KKDGKVYLIDEIHTPDSSRYFYADGYQEKFEKGEAQKQL 242

Query: 248 DKDFIRNWILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++           +P++ +  +   S  YI  YE I G KF   +       
Sbjct: 243 SKEFVRQWLIDHNFMGKEGQQVPEMTDEYVNSVSDRYIELYEHIVGQKFNKADDHDDLAA 302

Query: 306 RIRNNLRKYTHR 317
           RI  N+ +Y ++
Sbjct: 303 RIEKNVTEYLNQ 314


>gi|325278982|ref|YP_004251524.1| Phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Odoribacter splanchnicus DSM 20712]
 gi|324310791|gb|ADY31344.1| Phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Odoribacter splanchnicus DSM 20712]
          Length = 314

 Score =  228 bits (582), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 188/307 (61%), Gaps = 14/307 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++D   + + +DR+SAFD  +   +PYKG+VLNQI   +   T
Sbjct: 11  FPGQKSVYKGKVRDVYDINDEYLVMVVSDRISAFDVILPEGVPYKGQVLNQIASKFLDAT 70

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DI  N  +  PDP V VG + + F +E+++RGYL G++  +    YK+G+R +    LP
Sbjct: 71  ADIVPNWKIATPDPMVTVGHKCEPFKVEMVIRGYLTGSSWRA----YKSGERTLCGLPLP 126

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK   P+ITPTTK+ E   G D+ IS  EII +G+++R  +E +  Y  +LF+R
Sbjct: 127 EGMRENQKFDSPLITPTTKADE---GHDENISKEEIIAQGLVSREDYELMEKYTYALFQR 183

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG  K   I L DEIHTPDSSRY+  E YE+ F +G     L
Sbjct: 184 GTEIAAEKGLILVDTKYEFG-KKNGRIYLIDEIHTPDSSRYFYAEGYEERFAKGEKQKQL 242

Query: 248 DKDFIRNWILTRC--NPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPL 304
            K+F+R W++           +P++   ++   +  YI  YE ITG KF+ AD++ +  L
Sbjct: 243 SKEFVREWLMDNGFQGQAGQKVPEMTPAVVAGITDRYIELYEHITGQKFVKADSTHV--L 300

Query: 305 ERIRNNL 311
           +RI +N+
Sbjct: 301 KRIEDNV 307


>gi|313675630|ref|YP_004053626.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Marivirga
           tractuosa DSM 4126]
 gi|312942328|gb|ADR21518.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Marivirga
           tractuosa DSM 4126]
          Length = 334

 Score =  228 bits (582), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 124/289 (42%), Positives = 180/289 (62%), Gaps = 12/289 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           +P   N+Y GKVR+ Y   D   I +ATDRLSAFD  +   IP+KG+VLNQI       T
Sbjct: 34  LPNQQNFYRGKVRDVYTTPDQL-IMVATDRLSAFDVVMPRAIPFKGQVLNQIAAKALKDT 92

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
            DI  N  +  PDPNV VG   + +P+E+++RGYLAG+        Y++GKR +    LP
Sbjct: 93  EDIVPNWLIANPDPNVSVGFNCETYPVEMVIRGYLAGHAWRE----YRDGKRSVCGVSLP 148

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + + +N KLP P+ITPTTK+ E   G D+ IS  EI+ +G++++ ++E + SY   LF+R
Sbjct: 149 EGLKENDKLPSPIITPTTKAHE---GHDEDISREEILKQGLVSKEEYEKLESYTQQLFQR 205

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A +NGLILVD+KYEFG      I L DEIHTPDSSR++  + Y+++  +G+    L
Sbjct: 206 GTEIAAKNGLILVDTKYEFG-KVGDKIYLIDEIHTPDSSRFFYSDVYDENQSKGLKQKQL 264

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKF 294
            K+F+R W++      +D   IP++ +  +   S  YI  YEK+TG KF
Sbjct: 265 SKEFVREWLIENGFQGKDGQKIPEMTDEKVEEISNRYIELYEKVTGEKF 313


>gi|34540724|ref|NP_905203.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Porphyromonas gingivalis W83]
 gi|39931717|sp|Q7MVR8|PUR7_PORGI RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|34397038|gb|AAQ66102.1| phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Porphyromonas gingivalis W83]
          Length = 313

 Score =  228 bits (582), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 184/312 (58%), Gaps = 18/312 (5%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
           +P     Y GKVR+ Y L +   + IATDR+SAFD  + A IPYKG+VLNQI  ++   T
Sbjct: 12  LPGQKAVYHGKVRDVYTLENDLLVMIATDRISAFDVVLPAGIPYKGQVLNQIAAHYLDAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
            DI  N  +  PDP V +G + + F +E+++RGY+ G    S    Y  G+R +    LP
Sbjct: 72  RDIVPNWKIATPDPMVTIGHRCEPFKVEMVIRGYITG----SAWRAYAAGERVLCGLPLP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQ+  +P+ITPTTK+ E   G D+ IS  EII +G++++  +E I  Y  +LFER
Sbjct: 128 EGMRENQRFEHPIITPTTKADE---GHDENISRQEIIAQGLVSKEDYEQIERYTYALFER 184

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG  K   I L DEIHTPDSSRY+  E Y++ F  G     L
Sbjct: 185 GTQMAAEKGLILVDTKYEFG-KKDGKIYLIDEIHTPDSSRYFYAEGYQERFERGEAQKQL 243

Query: 248 DKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKF-IADNSELP 302
            K+F+R W++   N ++      IP + E      S+ YI  YE++ G  F  AD S L 
Sbjct: 244 SKEFVRQWLIE--NGFQGKPGQQIPKMTEAYCDSVSERYIELYERVVGKPFEKADLSNLA 301

Query: 303 PLERIRNNLRKY 314
             ERI  N+ +Y
Sbjct: 302 --ERIEKNITEY 311


>gi|332876531|ref|ZP_08444293.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332685498|gb|EGJ58333.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 315

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 183/312 (58%), Gaps = 11/312 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   T
Sbjct: 11  FPGQKSVYHGKVRDVYNINDELMVMVATDRISAFDVILPKGIPFKGQVLNQIAATFLDAT 70

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           SDI  N  L  PDP V VG + + F +E+I+RGYL G    S    Y+NG R++    LP
Sbjct: 71  SDIVPNWKLATPDPMVTVGLKCEGFRVEMIIRGYLTG----SAWREYQNGCRELCGVKLP 126

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +NQK P P+ITPTTK+    +G D+ IS  EII +G++++  +E +  Y  +LF R
Sbjct: 127 EGMKENQKFPTPIITPTTKAD---AGHDENISKEEIIAQGLVSKEDYELMEKYTYALFAR 183

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG  K   + L DEIHTPDSSRY+  + Y++ F +G     L
Sbjct: 184 GTEMAAEKGLILVDTKYEFG-KKDGKVYLIDEIHTPDSSRYFYADGYQEKFEKGEPQKQL 242

Query: 248 DKDFIRNWILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++           +P++ +  +   S  YI  YE I G KF   ++      
Sbjct: 243 SKEFVRQWLIDHNFMGKEGQQVPEMTDEYVNSVSDRYIELYEHIVGQKFNKADNHDDLAA 302

Query: 306 RIRNNLRKYTHR 317
           RI  N+ +Y ++
Sbjct: 303 RIEKNVTEYLNQ 314


>gi|83814469|ref|YP_445636.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salinibacter ruber DSM 13855]
 gi|83755863|gb|ABC43976.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Salinibacter ruber DSM 13855]
          Length = 324

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 122/307 (39%), Positives = 178/307 (57%), Gaps = 12/307 (3%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
           +L   Y GKVR+NY   D  RI + TDR+SAFD  +   IP+KG++LNQ   Y+F  T D
Sbjct: 21  DLGEIYHGKVRDNYRQGD-RRILVTTDRISAFDHVLPQTIPFKGQILNQTAAYFFDATED 79

Query: 70  ICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDN 129
           +  NH L  PDPNV + ++    PIE +VRGYLAG+        Y  G R +    LPD 
Sbjct: 80  LVPNHVLSVPDPNVTIAKECTPIPIEFVVRGYLAGHAWRE----YDRGTRTLCGKSLPDG 135

Query: 130 MSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGC 189
           + ++++LP P++TPTTK+ E   G DQ +S  E +    L    ++ ++ +AL+L+ RG 
Sbjct: 136 LRESEQLPEPILTPTTKAEE---GHDQDVSRKEALANTGLAPATYDQLAEWALALYRRGH 192

Query: 190 KLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
           K+A E GL+LVD+KYEFG     +++L DE+HTPDSSRY+  + YE    EG     L K
Sbjct: 193 KMATEQGLLLVDTKYEFGRTPDGDLVLIDEVHTPDSSRYYYADGYEDRLAEGRPQRQLSK 252

Query: 250 DFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERI 307
           +F+R W++      R  D +P +P+    + ++ Y+  +EK+TG  F  D    P   RI
Sbjct: 253 EFVREWLMDHGFQGRAGDEMPTLPDAFRAKVTKRYVELFEKVTGQTFEPDTHPNPEA-RI 311

Query: 308 RNNLRKY 314
            + L  Y
Sbjct: 312 HSALGDY 318


>gi|294507528|ref|YP_003571586.1| phosphoribosylaminoimidazole-succinocarboxamidesy nthase
           [Salinibacter ruber M8]
 gi|294343856|emb|CBH24634.1| Phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Salinibacter ruber M8]
          Length = 324

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 122/307 (39%), Positives = 178/307 (57%), Gaps = 12/307 (3%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
           +L   Y GKVR+NY   D  RI + TDR+SAFD  +   IP+KG++LNQ   Y+F  T D
Sbjct: 21  DLGEIYHGKVRDNYRQGD-RRILVTTDRISAFDHVLPQTIPFKGQILNQTAAYFFDATED 79

Query: 70  ICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDN 129
           +  NH L  PDPNV + ++    PIE +VRGYLAG+        Y  G R +    LPD 
Sbjct: 80  LVPNHVLSVPDPNVTIAKECTPIPIEFVVRGYLAGHAWRE----YDRGTRTLCGQSLPDG 135

Query: 130 MSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGC 189
           + ++++LP P++TPTTK+ E   G DQ +S  E +    L    ++ ++ +AL+L+ RG 
Sbjct: 136 LRESEQLPEPILTPTTKAEE---GHDQDVSRKEALANTGLAPATYDQLAEWALALYRRGH 192

Query: 190 KLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
           K+A E GL+LVD+KYEFG     +++L DE+HTPDSSRY+  + YE    EG     L K
Sbjct: 193 KMATEQGLLLVDTKYEFGRTPDGDLVLIDEVHTPDSSRYYYADGYEDRLAEGRPQRQLSK 252

Query: 250 DFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERI 307
           +F+R W++      R  D +P +P+    + ++ Y+  +EK+TG  F  D    P   RI
Sbjct: 253 EFVREWLMDHGFQGRAGDEMPTLPDAFRAKVTRRYVELFEKVTGQTFEPDTHPNPEA-RI 311

Query: 308 RNNLRKY 314
            + L  Y
Sbjct: 312 HSALGDY 318


>gi|213963513|ref|ZP_03391766.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Capnocytophaga sputigena Capno]
 gi|213953793|gb|EEB65122.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Capnocytophaga sputigena Capno]
          Length = 317

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 127/310 (40%), Positives = 185/310 (59%), Gaps = 13/310 (4%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P+  + Y GKVR+ Y L D T I IATDR+SAFD  +   IPYKG++LNQI   +   T 
Sbjct: 12  PKQKSVYRGKVRDVYQLKDDTLIMIATDRISAFDAILPKGIPYKGQILNQIAVSFLQQTE 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N  +  PDPNV +GQ  +   +E+++RGYLAG++       YKNG RK+    LP+
Sbjct: 72  DIVPNWLIASPDPNVSIGQVCEPLKVEMVIRGYLAGHSAR----LYKNGVRKLSGVPLPE 127

Query: 129 NMSDNQKLP-YPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
            + +    P +P+ITP TK+ +     D+ IS  EII RGI+  + +  +  Y  +LF R
Sbjct: 128 GLREFDMFPQHPIITPATKAEQGLH--DEDISREEIIRRGIVNEDDYRLMEKYTYALFAR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A ++GLILVD+KYEFG  +   I+L DEIHTPDSSRY+  E YE+    G   I L
Sbjct: 186 GTEIASKHGLILVDTKYEFGKTRDGEIVLIDEIHTPDSSRYFYKEGYEERQENGEPQIQL 245

Query: 248 DKDFIRNWILTRC--NPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPL 304
            K+F+R W++++         +P++ +  +   S  YI  YE I G KF+ AD S++   
Sbjct: 246 SKEFVRQWLISQGFQGEKGQKMPEMSDEYVQSVSDRYIELYENIMGEKFLPADTSDIE-- 303

Query: 305 ERIRNNLRKY 314
            RI +N+ ++
Sbjct: 304 NRIHDNVLRF 313


>gi|300727223|ref|ZP_07060639.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           bryantii B14]
 gi|299775461|gb|EFI72055.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           bryantii B14]
          Length = 316

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 129/302 (42%), Positives = 175/302 (57%), Gaps = 11/302 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   TSDIC N 
Sbjct: 18  YHGKVRDVYDINDDLIVMVATDRISAFDVVLPKGIPFKGQVLNQIAAQFLDATSDICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    YK G R+I    LP+ M +NQ
Sbjct: 78  KLATPDPMVTVGVKCEGFRVEMIIRSILTG----SAWRAYKEGCREICGVKLPEGMKENQ 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P+ITPTTK+ E   G D  IS  EII +GI++   +  I  +   LF+RG ++A +
Sbjct: 134 RFPEPIITPTTKADE---GHDMNISKEEIIAQGIVSAEDYAVIEDWTRKLFQRGQEIAAK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  K   I L DEIHTPDSSRY+  + YE+ F +G+    L K+F+R 
Sbjct: 191 RGLILVDTKYEFG-KKGDQIYLIDEIHTPDSSRYFYADGYEEKFEKGLPQKQLSKEFVRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I +      S+ YI  YE I G KF     E     RI  N++
Sbjct: 250 WLIEHNFMNEPGQQMPEITDEYAESVSERYIELYENIVGEKFDKAVEEGDIASRIEKNVK 309

Query: 313 KY 314
            Y
Sbjct: 310 AY 311


>gi|325288094|ref|YP_004263884.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cellulophaga lytica DSM 7489]
 gi|324323548|gb|ADY31013.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cellulophaga lytica DSM 7489]
          Length = 316

 Score =  224 bits (572), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 124/308 (40%), Positives = 183/308 (59%), Gaps = 16/308 (5%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P+  N Y GKVRE Y L D   + +ATDRLSAFD  +   IPYKG++LNQI     + T+
Sbjct: 12  PKQVNVYKGKVREVYRLEDDIMVMVATDRLSAFDVVMPKGIPYKGQILNQIATKMMNDTA 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N  L  PD NV +G   + F +E+++RGY++G+        YK GKR +    +P+
Sbjct: 72  DIVPNWLLKTPDANVAIGHACEPFKVEMVIRGYMSGHAARE----YKAGKRVLCGVPMPE 127

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            + +N K P P+ITP TK+       D+ IS  +II RGI++   ++ +  Y  +LF+RG
Sbjct: 128 GLKENDKFPSPIITPATKAE--MGDHDEDISREDIIKRGIVSETDYKQLEDYTFALFKRG 185

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A + GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  + Y++   +G     L 
Sbjct: 186 TEIAAKRGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYADGYKERQEKGEPQKQLS 245

Query: 249 KDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPP 303
           K+F+R W+++  N ++      +P++ +  I   S+ YI  YE ITG  F+ AD S +  
Sbjct: 246 KEFVRQWLIS--NNFQGLEGQTLPEMTDEYIASVSERYIELYENITGETFVKADISNIQ- 302

Query: 304 LERIRNNL 311
            +RI  N+
Sbjct: 303 -KRIETNV 309


>gi|260062628|ref|YP_003195708.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Robiginitalea biformata HTCC2501]
 gi|88784195|gb|EAR15365.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Robiginitalea biformata HTCC2501]
          Length = 316

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 177/311 (56%), Gaps = 14/311 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
            P     Y GKVRE Y+L +   + +ATDRLSAFD  +   IPYKG++LNQI       T
Sbjct: 12  FPGQQRVYKGKVREVYYLENNLLVMVATDRLSAFDVVMPRGIPYKGQILNQIATRMMQAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
            D+  N  L  PDPNV VG   + F +E+++RGYLAG+        Y  GKR++    LP
Sbjct: 72  EDLVPNWLLATPDPNVAVGVHCEPFKVEMVIRGYLAGHAARE----YAAGKRELCGVPLP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +N   P P+ITP TK+ +     D+ IS   I+ RG+++   +  +  Y   LF+R
Sbjct: 128 EGMRENDAFPEPIITPATKAEKGDH--DEDISREGILERGLVSAEDYAVLEDYTRKLFQR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G +LA E GL+LVD+KYEFG      I+L DEIHTPDSSRY+    Y +  + G     L
Sbjct: 186 GTQLAAERGLLLVDTKYEFGKTPDGRIVLIDEIHTPDSSRYFYASGYRERQQRGEAQKQL 245

Query: 248 DKDFIRNWILT---RCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPP 303
            K+F+R W++    +  P ++ +P++ +  I   S  YI  YEKITG+ F  AD S++P 
Sbjct: 246 SKEFVRQWLIANGFQGKPGQE-VPEMTDAYIDTVSNRYIELYEKITGVPFAGADTSDIPG 304

Query: 304 LERIRNNLRKY 314
             RI  N+  Y
Sbjct: 305 --RIEKNVLGY 313


>gi|332876871|ref|ZP_08444625.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332685154|gb|EGJ57997.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 317

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 126/310 (40%), Positives = 182/310 (58%), Gaps = 13/310 (4%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P+  + Y GKVR+ Y L D T I IATDR+SAFD  +   IPYKG++LNQ+   +   T 
Sbjct: 13  PKQKSVYRGKVRDVYQLKDDTLIMIATDRISAFDVILPKGIPYKGQILNQMAVRFLEQTE 72

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N     PDPNV +GQ  +   +E+++RGYLAG+        YKNGKR +    LP+
Sbjct: 73  DIVPNWLTASPDPNVSIGQVCEPLKVEMVIRGYLAGHAAR----LYKNGKRMLSGVALPE 128

Query: 129 NMSDNQKLP-YPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
            + +    P +P+ITP TK+ +     D+ IS  EII RGI++   +  +  Y  +LF R
Sbjct: 129 GLREFDIFPQHPIITPATKAEQGLH--DEDISREEIIRRGIVSEEDYRLMEKYTYALFAR 186

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A ++GLILVD+KYEFG  +   I+L DEIHTPDSSRY+  E Y++   +G   I L
Sbjct: 187 GSEIASKHGLILVDTKYEFGKTRDGEIVLIDEIHTPDSSRYFYKEGYDERQEKGEPQIQL 246

Query: 248 DKDFIRNWILTRC--NPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPL 304
            K+F+R W++++         +P++ +  +   S  YI  YE I G KFI  D +++   
Sbjct: 247 SKEFVRQWLISQGFQGEKGQKVPEMSDAYVQSVSDRYIELYENIMGEKFIPGDTTDIEG- 305

Query: 305 ERIRNNLRKY 314
            RI  N+ KY
Sbjct: 306 -RIYENVEKY 314


>gi|313202976|ref|YP_004041633.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Paludibacter propionicigenes WB4]
 gi|312442292|gb|ADQ78648.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Paludibacter propionicigenes WB4]
          Length = 315

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 123/305 (40%), Positives = 188/305 (61%), Gaps = 13/305 (4%)

Query: 14  NYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICS 72
           N Y GKVR+ Y + +   + +ATDR+SAFD  +   IPYKG++LNQI   +   T+DI  
Sbjct: 16  NVYHGKVRDVYTVKNDLLVMVATDRISAFDVVLPKGIPYKGQMLNQIAAKFLDATADIVP 75

Query: 73  NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSD 132
           N  L  PDP V VG + + +P+E+IVRGYL G    S    YK+G R+I    +PD M +
Sbjct: 76  NWKLASPDPMVTVGLRCEGYPVEMIVRGYLCG----SAWRTYKSGVREICGVKIPDGMRE 131

Query: 133 NQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLA 192
           NQ+ P P+ITPTTK+       D+ I+ +EI+ +G+++  ++E +  Y + LF RG ++A
Sbjct: 132 NQRFPQPIITPTTKAELGRH--DEDITRDEILSQGLVSVEEYEMLEKYTMELFMRGTEIA 189

Query: 193 LENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFI 252
            + GLILVD+KYEFG  +   I L DEIHTPDSSRY+ V++Y++ F +G     L K+F+
Sbjct: 190 AKRGLILVDTKYEFG-RRDGKIYLIDEIHTPDSSRYFYVDSYQELFEKGEAQKQLSKEFV 248

Query: 253 RNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPL-ERIRN 309
           R W++      +D  ++P++   I+   S+ YI  +E I+G  F  D +++  + +RI  
Sbjct: 249 REWLMENGFQGKDGQSVPEMTPEIVAGISERYIELFENISGESF--DKADIADISKRIEK 306

Query: 310 NLRKY 314
           N+  Y
Sbjct: 307 NVVDY 311


>gi|110638311|ref|YP_678520.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Cytophaga
           hutchinsonii ATCC 33406]
 gi|122966754|sp|Q11TT6|PUR7_CYTH3 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|110280992|gb|ABG59178.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Cytophaga hutchinsonii ATCC 33406]
          Length = 310

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 184/308 (59%), Gaps = 13/308 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           +P    +Y GKVR+ Y+++D   + +A+DR+SAFD  +   IP+KG+VLNQI       T
Sbjct: 11  LPGQTGFYKGKVRDVYYVADKL-VVVASDRISAFDVVLPRAIPFKGQVLNQIAAKMLAQT 69

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +D+  N  L  PDP+V +G + + F +E+++RGYLAG+        YK GKR +    LP
Sbjct: 70  ADVVPNWILSVPDPSVSIGIKCEPFKVEMVIRGYLAGHAARE----YKAGKRTLCGVALP 125

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + + +N KLP P+ITPTTK+ E   G D+ IS  +++ RGI++   +  +  Y  +LF+R
Sbjct: 126 EELKENDKLPAPIITPTTKADE---GHDEDISREDLLARGIVSEADYIQLEKYTQALFQR 182

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G +LA + GLILVD+KYEFG      I L DEIHTPDSSRY+ ++ Y +   +G     L
Sbjct: 183 GTELAEKQGLILVDTKYEFG-KVGDKIYLIDEIHTPDSSRYFYIDGYAERQAKGEAQKQL 241

Query: 248 DKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++      ++  N+P + + I+   S+ YI  YEK+ G  F     E  P E
Sbjct: 242 SKEFVRQWLIENGFQGKEGQNVPVMTDEIVSSISERYIELYEKVIGESF-KKPEESNPEE 300

Query: 306 RIRNNLRK 313
           RI  N+ K
Sbjct: 301 RILKNILK 308


>gi|219111681|ref|XP_002177592.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217410477|gb|EEC50406.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 562

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 119/284 (41%), Positives = 172/284 (60%), Gaps = 11/284 (3%)

Query: 18  GKVRENYFLSDGTR--ITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           GKVR+ Y    GT+    + TDR S FD+ +A +PYKG VLN  + +WF  T+ I  NH 
Sbjct: 269 GKVRDRY---PGTKSLALVTTDRQSGFDRMLARVPYKGAVLNLTSAFWFEQTAHIIPNHL 325

Query: 76  LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQK 135
           +  P P V V +  Q FPIE +VR Y+ G+T TS+   Y+ G R    + LPD M+ NQK
Sbjct: 326 VSVPHPYVSVVKPCQPFPIEFVVRSYMTGSTSTSIWRNYQEGVRSYCGHDLPDGMTKNQK 385

Query: 136 LPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALEN 195
           L   ++TPTTK  +     D+PIS  +I+    +T++  +  ++ AL +F  G ++A  +
Sbjct: 386 LECNILTPTTKEEDH----DRPISLVDIVAENWMTQSDLDVCAAAALKVFALGQQVAAAH 441

Query: 196 GLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
           GLILVD+KYEFG D+    I+L DE+HTPDSSRYW   TYE+    G  P  +DK+F+R 
Sbjct: 442 GLILVDTKYEFGKDEHTGEILLIDEVHTPDSSRYWLASTYEERIAAGEEPDNIDKEFLRL 501

Query: 255 WILTRCNPYRD-NIPDIPENIILRTSQTYIAAYEKITGLKFIAD 297
           W  ++C+PY D  +P+ P +++L  ++ YI  +E IT   F  D
Sbjct: 502 WFRSQCDPYNDETLPEAPRDLVLELARRYILLFEMITWKDFDFD 545


>gi|319954743|ref|YP_004166010.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cellulophaga algicola DSM 14237]
 gi|319423403|gb|ADV50512.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cellulophaga algicola DSM 14237]
          Length = 317

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 178/308 (57%), Gaps = 16/308 (5%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVRE Y L++   + IATDRLSAFD  +   IPYKG++LNQI       TSDI  N 
Sbjct: 19  YKGKVREVYTLANDIMVMIATDRLSAFDVVMPKGIPYKGQILNQIATKMMADTSDIVPNW 78

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDPNV +G   + F +E+++RGY++G+        YK GKR +    LP+ + +N 
Sbjct: 79  LLATPDPNVAIGHACEPFKVEMVIRGYMSGHAARE----YKAGKRMLCGVALPEGLIEND 134

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           K P P+ITP TK+       D+ IS  +I+ RGI++   +  +  Y   LF+RG ++A E
Sbjct: 135 KFPEPIITPATKAE--MGDHDEDISREDILKRGIVSEEDYSILEKYTKDLFQRGTEIAAE 192

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  E Y +  + G     L K+F+R 
Sbjct: 193 RGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYTEGYTERQKNGAMQKQLSKEFVRQ 252

Query: 255 WILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFIADN-SELPPLERIRN 309
           W+++  N ++      +P++ ++ I   S  YI  YE I G  F   N S++    RI  
Sbjct: 253 WLIS--NDFQGLEGQKVPEMSDDYITTVSDRYIELYENIVGESFQKANISDIQT--RIET 308

Query: 310 NLRKYTHR 317
           N+  Y ++
Sbjct: 309 NVLAYLNK 316


>gi|288925786|ref|ZP_06419717.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           buccae D17]
 gi|288337441|gb|EFC75796.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           buccae D17]
          Length = 316

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 129/319 (40%), Positives = 184/319 (57%), Gaps = 13/319 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K   +     + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYDINDDLLVMVATDRISAFDVILPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+RG L G    S    YKNG
Sbjct: 61  QIAAKFLDATTDICPNWKLATPDPMVTVGLKCEGFRVEMIIRGILTG----SAWREYKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +N++ P P++TPTTK+ E   G D  IS  EII +GI++   +  +
Sbjct: 117 CREICGVKLPEGMRENERFPEPIVTPTTKADE---GHDLNISKEEIIAQGIVSAEDYAVM 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG ++A + GLILVD+KYEFG  +   + L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDYTRKLFKRGQEIAAKQGLILVDTKYEFG-KRGGKVYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++     N     +P+I ++     S  YI  YE ITG KF 
Sbjct: 233 FEKGEPQKQLSKEFVRQWLIEHNFMNEPGQQMPEITDDYAESVSDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKY 314
               +     RI  N+ +Y
Sbjct: 293 KATEQGDIATRIEKNVSEY 311


>gi|89891201|ref|ZP_01202708.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteria bacterium BBFL7]
 gi|89516513|gb|EAS19173.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteria bacterium BBFL7]
          Length = 321

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 124/310 (40%), Positives = 182/310 (58%), Gaps = 12/310 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
            P   N Y GKVR+ Y ++D   + +A+DRLSAFD  +   IPYKG++LNQI       T
Sbjct: 14  FPNQTNVYKGKVRQVYSINDDLLVMVASDRLSAFDVVMPRGIPYKGQILNQIATQMMQAT 73

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
            DI  N  L  PDPNV +G Q + F +E+++RGY++G+        YK G+R +    +P
Sbjct: 74  EDIVPNWLLATPDPNVAIGYQCEPFKVEMVIRGYMSGHAARE----YKAGRRMLCGVPMP 129

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           D M +N + P P+ITP TK+       D+ IS  +II RGI++ + +E +  Y   LF+R
Sbjct: 130 DGMKENDQFPEPIITPATKAE--MGDHDEDISREDIISRGIVSEHDYEILEKYTRDLFKR 187

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G +LA + GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  E Y+           L
Sbjct: 188 GSQLAKKRGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYAEGYQNRQDNNEPQKQL 247

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKF-IADNSELPPL 304
            K+F+R W+++      +   +P++ +  I+  S  YI  YEKITG +F  +D S++   
Sbjct: 248 SKEFVRQWLISHNFQGLEGQILPEMDDAYIMSVSDRYIELYEKITGKEFEKSDTSDIK-- 305

Query: 305 ERIRNNLRKY 314
            RI +N++ +
Sbjct: 306 NRIESNVQDW 315


>gi|315608264|ref|ZP_07883254.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella buccae ATCC 33574]
 gi|315250045|gb|EFU30044.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella buccae ATCC 33574]
          Length = 316

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 129/319 (40%), Positives = 184/319 (57%), Gaps = 13/319 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K   +     + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYDINDDLLVMVATDRISAFDVILPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+RG L G    S    YKNG
Sbjct: 61  QIAAKFLDATTDICPNWKLATPDPMVTVGLKCEGFRVEMIIRGILTG----SAWREYKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LP+ M +N++ P P++TPTTK+ E   G D  IS  EII +GI++   +  +
Sbjct: 117 CREICGVKLPEGMRENERFPEPIVTPTTKADE---GHDLNISKEEIIAQGIVSAEDYAVM 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG ++A + GLILVD+KYEFG  +   + L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDYTRKLFKRGQEIAAKQGLILVDTKYEFG-KRDGKVYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++     N     +P+I ++     S  YI  YE ITG KF 
Sbjct: 233 FEKGEPQKQLSKEFVRQWLIEHNFMNEPGQQMPEITDDYAENVSDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKY 314
               +     RI  N+ +Y
Sbjct: 293 KATEQGDIATRIEKNVSEY 311


>gi|327404400|ref|YP_004345238.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Fluviicola taffensis DSM 16823]
 gi|327319908|gb|AEA44400.1| Phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Fluviicola taffensis DSM 16823]
          Length = 319

 Score =  223 bits (567), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 117/288 (40%), Positives = 177/288 (61%), Gaps = 11/288 (3%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P+  N Y GKVRE Y + + T + +ATDR+SAFD  +   IP+KG+VLNQ+   +   T 
Sbjct: 14  PKQTNVYRGKVREVYTIDNDTMVMVATDRISAFDHILPKGIPFKGQVLNQVATMFLEATR 73

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N  +  PDP+V VG   +   +E+++RGYLAG++       Y  GKR +   +LP+
Sbjct: 74  DIVPNWLIGAPDPSVAVGYACEPVRVEMVIRGYLAGHSARE----YALGKRMLCGVVLPE 129

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M +N + P P+ITP +K+ E   G D+ IS  +I+  GI+ +  +E + +Y  +LF+RG
Sbjct: 130 GMKENDRFPEPIITPASKAEE---GHDEDISREDILKNGIVPQEIYEKMEAYTRALFQRG 186

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A E GLILVD+KYEFGI +   +IL DEIHTPDSSRY+  + YE+   +G     L 
Sbjct: 187 TEMAAERGLILVDTKYEFGI-RNGEVILIDEIHTPDSSRYFYADGYEERQAKGENQRQLS 245

Query: 249 KDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKF 294
           K+F+R W++       +   +P++P++ +   ++ YI  YEKITG  F
Sbjct: 246 KEFVRQWLIENGFQGLEGQVMPEMPDSFVETITERYIELYEKITGNTF 293


>gi|261880573|ref|ZP_06007000.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           bergensis DSM 17361]
 gi|270332692|gb|EFA43478.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           bergensis DSM 17361]
          Length = 316

 Score =  223 bits (567), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 132/319 (41%), Positives = 182/319 (57%), Gaps = 13/319 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K   +     + Y GKVR+ Y + D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFEGQKSVYHGKVRDVYNIDDDLIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DIC N  L  PDP V VG + + F +E+I+R  L G    S    YK+G
Sbjct: 61  QIAAKFLDDTKDICPNWKLATPDPMVTVGVKCEGFRVEMIIRSILTG----SAWRAYKDG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LP+ M +NQ+ P P+ITPTTK+ E   G D  IS  EII +GI++   +  I
Sbjct: 117 CRELCGVKLPEGMRENQRFPEPIITPTTKADE---GHDLNISREEIISQGIVSAEDYAII 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +   LFERG ++A ++GLILVD+KYEFG    Q I L DEIHTPDSSRY+  + YE  
Sbjct: 174 EDWTRKLFERGQEIAAKHGLILVDTKYEFGKSGDQ-IYLIDEIHTPDSSRYFYADGYEDR 232

Query: 238 FREGITPIGLDKDFIRNWILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++     N     +P+I +      S+ YI  YE ITG KF 
Sbjct: 233 FEKGEPQKQLSKEFVRQWLIDHNFMNEPGQTMPEITDEYAESVSERYIELYEHITGEKFN 292

Query: 296 ADNSELPPLERIRNNLRKY 314
             + E     RI  N++ Y
Sbjct: 293 KADEEEDIAARIERNVKDY 311


>gi|120436254|ref|YP_861940.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Gramella
           forsetii KT0803]
 gi|117578404|emb|CAL66873.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Gramella
           forsetii KT0803]
          Length = 317

 Score =  223 bits (567), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 123/312 (39%), Positives = 184/312 (58%), Gaps = 16/312 (5%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ YFL +     IA+DRLSAFD  +   IPYKG++LNQI       T
Sbjct: 12  FPGQQSVYKGKVRDVYFLENDLLAMIASDRLSAFDVVMPKGIPYKGQILNQIATKMMEKT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           SDI  N     PDPNV +G++ + F +E+++RGY++G+        YK GKR++    +P
Sbjct: 72  SDIVPNWLEATPDPNVAIGKKCEPFKVEMVIRGYMSGHAARE----YKAGKRELCGVAMP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + + +N K P P+ITP TK+       D+ IS  +II +GI+    +  +  Y  +LF+R
Sbjct: 128 EGLKENDKFPQPIITPATKAEHGDH--DEDISREDIIKKGIVAEGDYLKLEEYTRNLFQR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A +  LILVD+KYEFG      I+L DEIHTPDSSRY+  + YEK    G     L
Sbjct: 186 GTEIAAQQDLILVDTKYEFGKTVDGEIVLIDEIHTPDSSRYFYKDGYEKRQENGEAQKQL 245

Query: 248 DKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPP 303
            K+F+R W+++  N ++     ++P++ +  I   S+ YI  YEKITG  F  + +++  
Sbjct: 246 SKEFVRQWLIS--NGFQGLEGQSVPEMSDEYIESVSERYIELYEKITGDTF--EKADVSH 301

Query: 304 LE-RIRNNLRKY 314
           +E RI+NN+  Y
Sbjct: 302 IESRIQNNVESY 313


>gi|303237113|ref|ZP_07323683.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           disiens FB035-09AN]
 gi|302482500|gb|EFL45525.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           disiens FB035-09AN]
          Length = 316

 Score =  222 bits (566), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 177/310 (57%), Gaps = 15/310 (4%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   TSDIC N 
Sbjct: 18  YHGKVRDVYNINDDLIVMVATDRISAFDVVLPKGIPFKGQVLNQIASKFLDSTSDICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    YK G R+I    LPD M +N+
Sbjct: 78  KLATPDPMVTVGLKCEGFKVEMIIRSILTG----SAWREYKAGCREICGVKLPDGMRENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P+ITPTTK+ E   G D  IS  EII +GI++   + TI  +   LF RG ++A E
Sbjct: 134 RFPEPIITPTTKADE---GHDLNISREEIIKQGIVSEEDYNTIEDWTRKLFARGQEMAAE 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  +     L DEIHTPDSSRY+  + YE+ F +G     L K+F+R 
Sbjct: 191 KGLILVDTKYEFG-KRNGKCYLIDEIHTPDSSRYFYADGYEEKFEKGEPQKQLSKEFVRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I +         YI  YE ITG KF+         +RI  N+ 
Sbjct: 250 WLIEHNFMNEPGQIMPEITDEYATSVGDRYIELYEHITGEKFVKATDTTDLAKRIEKNVS 309

Query: 313 KYTHRHLSSR 322
           +Y    L+SR
Sbjct: 310 EY----LASR 315


>gi|326799933|ref|YP_004317752.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingobacterium sp. 21]
 gi|326550697|gb|ADZ79082.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sphingobacterium sp. 21]
          Length = 318

 Score =  222 bits (566), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 188/315 (59%), Gaps = 14/315 (4%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTS 68
           P+   +Y GKVR+ Y + +     + +DR+SAFD  +   IPYKG+VLNQI   +   T 
Sbjct: 12  PKQTAFYKGKVRDVYTIDNQYLAMVVSDRISAFDVVLPRAIPYKGQVLNQIAAKFLKATE 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N  +D PDP+V +G+  + F +E+++RGYL+G+        Y  G+R +    LP+
Sbjct: 72  DILPNWVIDVPDPSVTIGKIAEPFKVEMVIRGYLSGHAWRE----YAAGRRSVCGESLPE 127

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            + +N KLP P+ITPTTK++    G D+ IS  EI+ +GI++   +  +  Y  +LFERG
Sbjct: 128 GLKENDKLPKPIITPTTKAT---VGHDEDISRTEILKQGIVSEGDYVKLEKYTHALFERG 184

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A   GLILVD+KYEFG    Q IIL DEIHTPDSSRY+  E Y++  +EG     L 
Sbjct: 185 TEIAAAQGLILVDTKYEFGKIGDQ-IILIDEIHTPDSSRYFYKEGYDELQKEGKPQRQLS 243

Query: 249 KDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPL-E 305
           K+F+R W++      ++  ++P + + ++   S+ YI  YE ITG KFI    E+  + E
Sbjct: 244 KEFVRKWLIENGFQGKEGQSVPMMDDELVASISERYIELYEHITGEKFI--RYEIQHIEE 301

Query: 306 RIRNNLRKYTHRHLS 320
           R+ NN+ K   R L 
Sbjct: 302 RVENNINKALDRLLE 316


>gi|228469387|ref|ZP_04054401.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Porphyromonas uenonis 60-3]
 gi|228309071|gb|EEK17701.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Porphyromonas uenonis 60-3]
          Length = 314

 Score =  222 bits (565), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 181/312 (58%), Gaps = 12/312 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
           +P +   + GKVR+ YFL       +ATDR+SAFD  +   IPYKG+VLNQI       T
Sbjct: 12  LPGIQAVFHGKVRDVYFLEGDLIAMVATDRISAFDVVLPEGIPYKGQVLNQIAAEQLDAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           + +  N  +  PDP V VG + + F +E+IVRGY+AG    S    Y+ G+R I    LP
Sbjct: 72  AHLVPNWKIATPDPMVTVGHRCEPFKVEMIVRGYIAG----SAWRAYQAGERTICGIQLP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + + +N++LP+P+ITPTTK+ E   G D+ IS  EII  G+++   ++ I  Y  +LFE 
Sbjct: 128 EGLKENERLPHPIITPTTKADE---GHDENISREEIIASGLISEEDYKVIEQYTRTLFEE 184

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG  K   +IL DEIHTPDSSRY+ +E YE+   +G     L
Sbjct: 185 GTRIARERGLILVDTKYEFG-KKDGKVILIDEIHTPDSSRYFYLEGYEERQAKGEPQRQL 243

Query: 248 DKDFIRNWILTRC--NPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++ +         +P I        S  YI  YE ITG  F+ + ++    +
Sbjct: 244 SKEFVRQWLIEQGFQGKAGQKMPAITPEYAASVSDRYIELYEHITGKTFVKEQTQ-DVAK 302

Query: 306 RIRNNLRKYTHR 317
           RI +NL  +  +
Sbjct: 303 RIEDNLLAFLKK 314


>gi|315223486|ref|ZP_07865342.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Capnocytophaga ochracea F0287]
 gi|314946521|gb|EFS98513.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Capnocytophaga ochracea F0287]
          Length = 317

 Score =  222 bits (565), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 123/310 (39%), Positives = 184/310 (59%), Gaps = 13/310 (4%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P+    Y GKVR+ Y L D T I IATDR+SAFD  +   IPYKG++LNQ+   +   T 
Sbjct: 12  PKQKTVYRGKVRDVYQLKDDTLIMIATDRISAFDTILPKGIPYKGQILNQMAVSFLQQTE 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N  +  PDPNV +GQ  +   +E+++RGYLAG++       YKNG RK+    LP+
Sbjct: 72  DIVPNWLIASPDPNVSIGQVCEPLKVEMVIRGYLAGHSAR----LYKNGVRKLSGVPLPE 127

Query: 129 NMSDNQKLP-YPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
            + +    P +P+ITP TK+ +     D+ IS  ++I +GI++   +  +  Y  +LF R
Sbjct: 128 GLREFDMFPQHPIITPATKAEQGLH--DEDISREDLIRKGIVSEEDYRLMEKYTYALFAR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A ++GLILVD+KYEFG  +   I+L DEIHTPDSSRY+  E Y+K    G   I L
Sbjct: 186 GTEIASKHGLILVDTKYEFGKTRDGEIVLIDEIHTPDSSRYFYKEGYDKRQENGEPQIQL 245

Query: 248 DKDFIRNWILTRC--NPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPL 304
            K+F+R W++++         +P + +  +   S+ YI  YE I G KF+ AD S++   
Sbjct: 246 SKEFVRQWLISKGFQGEKGQKVPTMTDKYVQSVSERYIELYENIMGEKFLPADTSDIE-- 303

Query: 305 ERIRNNLRKY 314
            RI +N+ ++
Sbjct: 304 NRIYDNIMRF 313


>gi|313885954|ref|ZP_07819692.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Porphyromonas asaccharolytica PR426713P-I]
 gi|332299379|ref|YP_004441300.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Porphyromonas asaccharolytica DSM 20707]
 gi|312924484|gb|EFR35255.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Porphyromonas asaccharolytica PR426713P-I]
 gi|332176442|gb|AEE12132.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Porphyromonas asaccharolytica DSM 20707]
          Length = 314

 Score =  221 bits (564), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 182/312 (58%), Gaps = 12/312 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
           +P + + + GKVR+ YFL       +ATDR+SAFD  +   IPYKG+VLNQI       T
Sbjct: 12  LPGIQSVFHGKVRDVYFLEGDLIAMVATDRISAFDVVLPEGIPYKGQVLNQIAAEQLDAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           + +  N  +  PDP V VG + + F +E+IVRGY+AG    S    Y+ G+R I    LP
Sbjct: 72  AHLVPNWKIATPDPMVTVGHRCEPFKVEMIVRGYIAG----SAWRAYQAGERTICGIELP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + + +N++LP+P+ITPTTK+ E   G D+ IS  EII  G+++   ++ I  Y  +LFE 
Sbjct: 128 EGLKENERLPHPIITPTTKADE---GHDENISREEIIASGLISEEDYKVIEQYTRTLFEE 184

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG  K   +IL DEIHTPDSSRY+ +E YE+   +G     L
Sbjct: 185 GTRIARERGLILVDTKYEFG-KKDGKVILIDEIHTPDSSRYFYLEGYEERQAKGEPQRQL 243

Query: 248 DKDFIRNWILTRC--NPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++ +         +P I        S  YI  YE ITG  F+ + ++    +
Sbjct: 244 SKEFVRQWLIEQGFQGKAGQKMPTITPEYAASVSDRYIELYEHITGKTFVKEQTQ-NLAK 302

Query: 306 RIRNNLRKYTHR 317
           RI +NL  +  +
Sbjct: 303 RIEDNLLAFLKK 314


>gi|225010786|ref|ZP_03701254.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Flavobacteria bacterium MS024-3C]
 gi|225004994|gb|EEG42948.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Flavobacteria bacterium MS024-3C]
          Length = 315

 Score =  221 bits (564), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 120/308 (38%), Positives = 175/308 (56%), Gaps = 14/308 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVRE Y L +   + IATDRLSAFD  +   IPYKG++LNQI       T
Sbjct: 12  FPGQKSIYKGKVREVYALENDLLVMIATDRLSAFDVVMPRGIPYKGQILNQIATKMMGAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
            DI  N     PDPNV +G   + F +E+++RGY++G+        YK GKR +    +P
Sbjct: 72  KDIVPNWLTATPDPNVAIGHACEPFKVEMVIRGYMSGHAARE----YKAGKRMLCGVPMP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + + +N   P P+ITP TK+       D+ IS  +I+ RGI++++ +E +  Y  +LFER
Sbjct: 128 EGLKENDAFPTPIITPATKAE--MGDHDEDISREDILARGIVSKDDYEILEKYTYALFER 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G  LA + GLILVD+KYEFG      I+L DEIHTPDSSRY+  + YE+    G     L
Sbjct: 186 GTALAAQRGLILVDTKYEFGKTASGEIVLIDEIHTPDSSRYFYADGYEERQAAGEAQKQL 245

Query: 248 DKDFIRNWILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLE 305
            K+F+R W++++         +P++ +  I   S+ YI  YE ITG  F+       PL+
Sbjct: 246 SKEFVRQWLISQNFQGLEGQTLPEMSDEYIASVSERYIELYENITGETFVK-----APLD 300

Query: 306 RIRNNLRK 313
            I++ + +
Sbjct: 301 NIQSRIEE 308


>gi|153004018|ref|YP_001378343.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Anaeromyxobacter sp. Fw109-5]
 gi|152027591|gb|ABS25359.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Anaeromyxobacter sp. Fw109-5]
          Length = 320

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 120/311 (38%), Positives = 181/311 (58%), Gaps = 15/311 (4%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRIT-IATDRLSAFDQNIACIPYKGEVLNQITQY 62
           L +  +P L   Y GKVR+NY  S G RI  + TDR+SAFD  +  IP+KGEVL+++T +
Sbjct: 15  LRQLDLPSLGELYRGKVRDNY--SRGDRIVMVTTDRVSAFDHVLGTIPFKGEVLSRLTAF 72

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF    D+   H +D PDP+V+V ++ +  PIE+++RGY+ G    SL   Y+ GK   Y
Sbjct: 73  WFEKVKDVAPTHVVDLPDPSVMVVKRAKPLPIEIVIRGYITG----SLWRDYQAGKAGAY 128

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
               P  +  +Q+   P+ITP+TK+       D+PIS  E++ +G++    W   ++ A 
Sbjct: 129 GIEWPKGLRKDQRFDRPIITPSTKAEYGKH--DEPISEQELLSQGLVAPELWREATAVAE 186

Query: 183 SLFERGCKLALENGLILVDSKYEFG-IDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
            LF RG + AL  GLILVD+KYE G +D K  +++ DEIHTPDSSRYW  + YE  F  G
Sbjct: 187 RLFARGQEWALSRGLILVDTKYEMGVVDGK--LVVIDEIHTPDSSRYWVADGYEDRFARG 244

Query: 242 ITPIGLDKDFIRNWILTRCN-PYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
                LDK+ IR W++           P + +++ +  ++ YI  +E++TG  F ++   
Sbjct: 245 AEQEMLDKENIRQWLIKEHGFSGHGAPPPLSDDVRVMLARKYIEVFERLTGETFASEVGS 304

Query: 301 LPPLERIRNNL 311
           +   +RIR NL
Sbjct: 305 VE--DRIRRNL 313


>gi|281425827|ref|ZP_06256740.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           oris F0302]
 gi|281400088|gb|EFB30919.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           oris F0302]
          Length = 316

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 129/302 (42%), Positives = 173/302 (57%), Gaps = 11/302 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   TSDIC N 
Sbjct: 18  YHGKVRDVYNINDDLMVMVATDRISAFDVVLPKGIPFKGQVLNQIAAKFLDATSDICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            +  PDP V VG + + F +E+I+R  L G+   S    YK G R++    LPD M +N+
Sbjct: 78  KMATPDPMVTVGLKCEGFRVEMIIRSILTGSAWRS----YKEGCRELCGVKLPDGMRENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           K P P++TPTTK+ E   G D  IS  EII +GI+++  +E I  Y   LF+RG ++A +
Sbjct: 134 KFPEPIVTPTTKAEE---GHDLNISKEEIIAQGIVSKEDYEIIEDYTKKLFKRGQEIAAK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  +   I L DEIHTPDSSRY+  E YE+    G     L K+F+R 
Sbjct: 191 QGLILVDTKYEFG-KRDGKIYLIDEIHTPDSSRYFYAEGYEEKLAAGKPQKQLSKEFVRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I        S  YI  YE ITG KF           RI NN+ 
Sbjct: 250 WLIEHNFMNEPGQQMPEITGEYADSVSDRYIELYEHITGEKFDRSIECGDIAARIENNVA 309

Query: 313 KY 314
            Y
Sbjct: 310 TY 311


>gi|228474075|ref|ZP_04058816.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Capnocytophaga gingivalis ATCC 33624]
 gi|228274589|gb|EEK13430.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Capnocytophaga gingivalis ATCC 33624]
          Length = 317

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 123/303 (40%), Positives = 175/303 (57%), Gaps = 12/303 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y + +   + I TDRLSAFD  +   IP+KG++LNQI       T DI  N 
Sbjct: 18  YKGKVRDVYSIGEDLLVMITTDRLSAFDVILPKGIPFKGQILNQIASECMEQTKDIVPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDPNV VG +   F +E+++RGYLAG+        Y+ GKR +    LP+ + +N 
Sbjct: 78  LLATPDPNVSVGMRCTPFKVEMVIRGYLAGHAARE----YQAGKRTLCGVTLPEGLQENA 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
             P P+ITP+TK+       D+ IS   I+ RGI++   +  I  Y   LF+RG +LAL+
Sbjct: 134 PFPSPIITPSTKAENGLH--DEDISRENILKRGIVSEEDYAVIEKYTYDLFKRGSQLALQ 191

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  K+  I+L DE HTPDSSRY+  + YE+  + G     L K+F+R 
Sbjct: 192 RGLILVDTKYEFGKTKEGTIVLIDEAHTPDSSRYFYADGYEERLKRGEPQKQLSKEFVRQ 251

Query: 255 WILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPLERIRNNL 311
           W++      R  + IP++    +   S+ YI  YE + G KFI +D + +   ERI  N+
Sbjct: 252 WLIENGFQGRPGEKIPEMTAAHVASISERYIELYEHLLGKKFIKSDTTNIQ--ERIYKNV 309

Query: 312 RKY 314
            +Y
Sbjct: 310 SEY 312


>gi|294673466|ref|YP_003574082.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           ruminicola 23]
 gi|294473413|gb|ADE82802.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           ruminicola 23]
          Length = 318

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 177/302 (58%), Gaps = 11/302 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   T+DIC N 
Sbjct: 18  YHGKVRDVYNINDDLMVMVATDRISAFDVVLPKGIPFKGQVLNQIAAKFLDATTDICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    YKNG R++    LPD M +N+
Sbjct: 78  KLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWREYKNGCRELCGVKLPDGMKENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P+ITPTTK+ E   G D  IS  EII +GI++   +  +  Y   +F RG ++A +
Sbjct: 134 RFPEPIITPTTKADE---GHDMNISKEEIIAQGIVSAEDYAIMEDYTRKIFARGQEIAAK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  +   + L DEIHTPDSSRY+  + YE+   +G     L K+F+R 
Sbjct: 191 RGLILVDTKYEFG-KRDGKVYLIDEIHTPDSSRYFYADGYEEKLAKGEPQRQLSKEFVRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I +      S+ YI  YE I G KF  +NS+    +RI  N+ 
Sbjct: 250 WLIEHDFMNEPGQTMPEITDEYAESVSERYIELYEHIVGEKFERENSDEDIAQRIEKNVS 309

Query: 313 KY 314
           ++
Sbjct: 310 EW 311


>gi|298372465|ref|ZP_06982455.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275369|gb|EFI16920.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Bacteroidetes oral taxon 274 str. F0058]
          Length = 314

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 179/313 (57%), Gaps = 13/313 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
            P     Y+GKVR+ Y +     + I TDR+SAFD  +   IP+KG++LNQI   +   T
Sbjct: 11  FPNQTTVYNGKVRDVYTIGGKELVMITTDRISAFDVVMPRGIPFKGQILNQIAAKFLDET 70

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
            DIC N     PDP V  G   + FPIE+IVRGYL G    S    YK G + I    +P
Sbjct: 71  KDICPNWKCATPDPMVTCGIMCKGFPIEMIVRGYLCG----SAWRDYKAGAKTISGVPIP 126

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           D M +N+K P P++TPTTK+       D+ IS  EII +G+++   +  +  YAL+LFER
Sbjct: 127 DGMRENEKFPTPIVTPTTKAELGRH--DENISKEEIIAQGLVSAEDYAVVERYALALFER 184

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A   GLILVD+KYEFG      I L DE+HTPDSSRY+   TY + F  G     L
Sbjct: 185 GTQIADRRGLILVDTKYEFGT-ADGTIYLMDEVHTPDSSRYFYKNTYRELFEAGKPQRQL 243

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKF-IADNSELPPL 304
            K+F+R W++      ++   IP++ + ++   S+ Y   YE+ITG KF ++DN ++   
Sbjct: 244 SKEFVRQWLMDNGFQGKEGQKIPEMTDEVVRGISERYRELYEQITGEKFTVSDNEDIE-- 301

Query: 305 ERIRNNLRKYTHR 317
           +RI  N+  Y  +
Sbjct: 302 QRIEKNVLNYLSK 314


>gi|312885693|ref|ZP_07745327.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mucilaginibacter paludis DSM 18603]
 gi|311301789|gb|EFQ78824.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mucilaginibacter paludis DSM 18603]
          Length = 314

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 125/310 (40%), Positives = 187/310 (60%), Gaps = 16/310 (5%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
           +P   NYY GKVR+ Y +S+     + TDR+SAFD  +   IPYKG+VLNQI   +   T
Sbjct: 11  LPGQTNYYKGKVRDVYTISNKYLAMVVTDRISAFDVVLPEPIPYKGQVLNQIAAKFLSAT 70

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DI  N  L  PDPNV +G+  + F +E+++RGYLAG+        YK G+R +    L 
Sbjct: 71  ADIVPNWVLSVPDPNVTIGRICEPFKVEMVIRGYLAGHAARE----YKVGRRAVCGVTLA 126

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + + +N KL  P+ITPTTK+S    G D+ IS  +I+ +GI++ + +  + +Y  +LF+R
Sbjct: 127 EGLKENDKLAEPIITPTTKAS---VGHDEDISREDILAKGIVSESDYIQLEAYTRALFQR 183

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A + GLILVD+KYEFG +    I L DEIHTPDSSRY+  E YE+  + G     L
Sbjct: 184 GTEMAAKQGLILVDTKYEFG-NVDGQIYLIDEIHTPDSSRYFYKEGYEERQKNGEPQKQL 242

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI--ADNSELPP 303
            K+F+R W++      +D   +P +  + +   S+ YI  YE+I G KF+  AD +    
Sbjct: 243 SKEFVRQWLIENGFQGKDGQQVPVMDADKVNSISERYIELYEQIIGEKFVKPADGN---V 299

Query: 304 LERIRNNLRK 313
           LER+  N+++
Sbjct: 300 LERVERNIKE 309


>gi|299140688|ref|ZP_07033826.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           oris C735]
 gi|298577654|gb|EFI49522.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           oris C735]
          Length = 316

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 174/302 (57%), Gaps = 11/302 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   TSDIC N 
Sbjct: 18  YHGKVRDVYNINDDLMVMVATDRISAFDVVLPKGIPFKGQVLNQIAAKFLDATSDICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            +  PDP V VG + + F +E+I+R  L G+   S    YK G R++    LP+ M +N+
Sbjct: 78  KMATPDPMVTVGLKCEGFRVEMIIRSILTGSAWRS----YKEGCRELCGVKLPEGMRENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           K P P++TPTTK+ E   G D  IS  EII +GI+++  +E I  Y   LF+RG ++A +
Sbjct: 134 KFPEPIVTPTTKADE---GHDLNISKEEIIAQGIVSKEDYEIIEDYTKKLFKRGQEIAAK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  +   I L DEIHTPDSSRY+  E YE+    G     L K+F+R 
Sbjct: 191 QGLILVDTKYEFG-KRDGKIYLIDEIHTPDSSRYFYAEGYEEKLAAGKPQKQLSKEFVRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I +      S  YI  YE ITG KF           RI NN+ 
Sbjct: 250 WLIEHNFMNEPGQQMPEITDEYADSVSDRYIELYEHITGEKFDRSIECGDIAARIENNVA 309

Query: 313 KY 314
            Y
Sbjct: 310 TY 311


>gi|256820356|ref|YP_003141635.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Capnocytophaga ochracea DSM 7271]
 gi|256581939|gb|ACU93074.1| Phosphoribosylaminoimidazolesuccinocarboxamidesy nthase
           [Capnocytophaga ochracea DSM 7271]
          Length = 317

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 185/310 (59%), Gaps = 13/310 (4%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P+  + Y GKVR+ Y L D T I IATDR+SAFD  +   IPYKG++LNQ+   +   T 
Sbjct: 12  PKQKSVYRGKVRDVYQLKDDTLIMIATDRISAFDTILPKGIPYKGQILNQMAVSFLQQTE 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N  +  PDPNV +GQ  +   +E+++RGYLAG++       YKNG RK+    LP+
Sbjct: 72  DIVPNWLIASPDPNVSIGQVCEPLKVEMVIRGYLAGHSAR----LYKNGVRKLSGVPLPE 127

Query: 129 NMSDNQKLP-YPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
            + +    P +P+ITP TK+ +     D+ IS  ++I +GI++   +  +  Y  +LF R
Sbjct: 128 GLREFDMFPQHPIITPATKAEQGLH--DEDISREDLIRKGIVSEEDYRLMEKYTYALFAR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A ++GLILVD+KYEFG  +   I+L DEIHTPDSSRY+  E Y++    G   I L
Sbjct: 186 GTEIASKHGLILVDTKYEFGKTRDGEIVLIDEIHTPDSSRYFYKEGYDERQENGEPQIQL 245

Query: 248 DKDFIRNWILTRC--NPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPL 304
            K+F+R W++++         +P + +  +   S+ YI  YE I G KF+ AD S++   
Sbjct: 246 SKEFVRQWLISKGFQGEKGQKVPTMTDKYVQSVSERYIELYENIMGEKFLPADTSDIE-- 303

Query: 305 ERIRNNLRKY 314
            RI +N+ ++
Sbjct: 304 NRIYDNIMRF 313


>gi|86144213|ref|ZP_01062549.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leeuwenhoekiella blandensis MED217]
 gi|85829343|gb|EAQ47809.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leeuwenhoekiella blandensis MED217]
          Length = 317

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 179/312 (57%), Gaps = 16/312 (5%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVRE Y L +   + IATDRLSAFD  +   IPYKG++LNQI       T
Sbjct: 13  FPGQTHVYKGKVREVYSLDNDLLVMIATDRLSAFDVVMPKGIPYKGQILNQIATKMMRDT 72

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
            D+  N     PDPNV VG++   F +E+++RGY++G+        YK GKR +    LP
Sbjct: 73  EDLVPNWLAATPDPNVAVGKKCDPFKVEMVIRGYMSGHAARE----YKAGKRMLCGVPLP 128

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +N K P P+ITP TK+       D+ IS  +I+ RGI++   +  +  Y   LF+R
Sbjct: 129 EGMKENDKFPQPIITPATKAE--MGDHDEDISKEDILKRGIVSAEDYAVLEDYTRKLFQR 186

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I+L DEIHTPDSSRY+  + Y +   +G     L
Sbjct: 187 GSEIAAERGLILVDTKYEFGKTADGEIVLIDEIHTPDSSRYFYADGYAERQEKGEAQKQL 246

Query: 248 DKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELP 302
            K+F+R W+++  N ++      +P++ +  I   S+ YI  YE ITG  F+ AD S++ 
Sbjct: 247 SKEFVRQWLIS--NGFQGLEGQTLPEMTDAYIETVSERYIELYENITGEPFVKADLSDID 304

Query: 303 PLERIRNNLRKY 314
             +RI  N+  Y
Sbjct: 305 --KRIETNVLNY 314


>gi|281420649|ref|ZP_06251648.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           copri DSM 18205]
 gi|281405422|gb|EFB36102.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           copri DSM 18205]
          Length = 316

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 129/323 (39%), Positives = 181/323 (56%), Gaps = 13/323 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K   +     + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYDINDDLLVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G    S    Y+ G
Sbjct: 61  QIAAKFLDTTTDICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWREYQKG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R+I    LPD M +NQ+ P P+ITPTTK+ E   G D  IS  EII +GI++   +  +
Sbjct: 117 CREICGVKLPDGMRENQRFPEPIITPTTKADE---GHDMNISKEEIIAQGIVSAEDYAVM 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   +F RG ++A + GLILVD+KYEFG  +   + L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDYTRRIFARGQEIAAKQGLILVDTKYEFG-KRDGKVYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++     N     +P+I +      S  YI  YE ITG KF 
Sbjct: 233 FEKGEPQRQLSKEFVRQWLIEHNFMNEPGQTMPEITDEYAESVSDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHRH 318
               E     RI  N+ ++   H
Sbjct: 293 KAAEEGDIAARIEKNVSEWLAAH 315


>gi|298208245|ref|YP_003716424.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Croceibacter atlanticus HTCC2559]
 gi|83848166|gb|EAP86036.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Croceibacter atlanticus HTCC2559]
          Length = 316

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 177/311 (56%), Gaps = 16/311 (5%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P   + Y GKVR+ Y L+DG  + +A+DRLSAFD  +   IPYKG++LNQI       T 
Sbjct: 12  PGQTDVYKGKVRDVYTLNDGRLVMVASDRLSAFDVVMPKGIPYKGQILNQIATKMMAATE 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           D+  N     PDPNV VG   + F +E+++RGYL+G+        YK GKR +    +PD
Sbjct: 72  DLVPNWLQATPDPNVAVGIACEPFKVEMVIRGYLSGHAARE----YKAGKRILCGVAMPD 127

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M +N K P P+ITP TK+ +     D+ IS  +I+ RGI+++  +  +  Y   LF+RG
Sbjct: 128 GMKENDKFPEPIITPATKAEKGDH--DEDISKEDILKRGIVSKEDYTVLEDYTKKLFKRG 185

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            +LA + GLILVD+KYEFG      I+L DEIHTPDSSRY+  E Y      G     L 
Sbjct: 186 SELADKRGLILVDTKYEFGKTLDGKILLIDEIHTPDSSRYFYKEGYADRQNAGEAQKQLS 245

Query: 249 KDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPP 303
           K+F+R W++   N ++      IP++ +  I   S  YI  YE ITG  FI +D S +  
Sbjct: 246 KEFVRQWLI--ANDFQGFEGQTIPEMSDAYIKSVSDRYIELYENITGEAFIKSDISNI-- 301

Query: 304 LERIRNNLRKY 314
             RI  NL +Y
Sbjct: 302 TSRISKNLIEY 312


>gi|256424474|ref|YP_003125127.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chitinophaga pinensis DSM 2588]
 gi|256039382|gb|ACU62926.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Chitinophaga pinensis DSM 2588]
          Length = 309

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 120/308 (38%), Positives = 182/308 (59%), Gaps = 12/308 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           +P    +Y GKVR+ Y + D   +  A+DR+SAFD  +   IPYKG+VLNQ+       T
Sbjct: 8   LPGQTAFYKGKVRDVYTIGDKLMVMAASDRISAFDVVLPRPIPYKGQVLNQVAAIMLEAT 67

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
            DI  N   + P PNV +G + + FP+E++VRG L G+   +    YK+GKR++    +P
Sbjct: 68  KDIVPNWVKNVPLPNVTIGLKCETFPVEMVVRGNLTGHAWRT----YKSGKRELCGVTMP 123

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + + +N   P P+ITPTTK+ E   G D+ IS  +II +G++T+  +E +  Y L+LF R
Sbjct: 124 EGLKENDFFPSPIITPTTKAHE---GHDEDISREDIIAKGLVTKEDYEQLEKYTLALFAR 180

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G +LA   GLILVD+KYEFG      I + DEIHTPDSSRY+  E YE+  + G     L
Sbjct: 181 GKELAAARGLILVDTKYEFG-KIGDTIYVIDEIHTPDSSRYFYAEGYEEKQKNGEPQKQL 239

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIA-DNSELPPL 304
            K+F+R W++      +D   +P++ +  +   S+ YI  +E ITG +F+  D S+    
Sbjct: 240 SKEFVREWLMANGFQGKDGQQVPEMTDEFVKTVSERYIELFENITGQQFVKQDVSKADAE 299

Query: 305 ERIRNNLR 312
           ++I + L+
Sbjct: 300 QKIIDTLK 307


>gi|163788811|ref|ZP_02183256.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteriales bacterium ALC-1]
 gi|159876048|gb|EDP70107.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteriales bacterium ALC-1]
          Length = 315

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 181/311 (58%), Gaps = 16/311 (5%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P   + Y GKVRE Y ++D   + +ATDRLSAFD  +   IPYKG++LNQI       T 
Sbjct: 13  PNQKSVYKGKVREVYNINDEQLVMVATDRLSAFDVVMPKGIPYKGQILNQIATKMMKETE 72

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           D+  N  +  PDPNV VG   + F +E+++RGY++G+        YK G+R +    +PD
Sbjct: 73  DLVPNWLVATPDPNVAVGHLCEPFKVEMVIRGYMSGHAARE----YKAGRRLLCGIEMPD 128

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M +N K P P+ITP TK+       D+ IS  +I+ +GI+++  +  +  Y   LF+RG
Sbjct: 129 GMKENDKFPQPIITPATKAE--MGDHDEDISREDILAKGIVSKEDYSILEDYTRKLFQRG 186

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A E GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  + Y++   +G     L 
Sbjct: 187 TEIAAERGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYADGYQERQDKGEAQKQLS 246

Query: 249 KDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPP 303
           K+F+R W+++  N ++      +P + +  I   S+ YI  YE ITG +F+  D S++  
Sbjct: 247 KEFVRQWLIS--NNFQGLEGQTVPFMSDEYIETVSERYIELYENITGDRFVKGDVSDIQG 304

Query: 304 LERIRNNLRKY 314
             RI  N+  Y
Sbjct: 305 --RIEANVLGY 313


>gi|197121583|ref|YP_002133534.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Anaeromyxobacter sp. K]
 gi|196171432|gb|ACG72405.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Anaeromyxobacter sp. K]
          Length = 319

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 121/315 (38%), Positives = 183/315 (58%), Gaps = 14/315 (4%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRIT-IATDRLSAFDQNIACIPYKGEVLNQITQY 62
           L +  +P L   Y GKVR+NY  S G RI  + TDR+SAFD  +  IP+KGEVL+++T +
Sbjct: 15  LQQLDLPGLGELYRGKVRDNY--SRGDRIVMVTTDRISAFDHVLGTIPFKGEVLSRLTAF 72

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF    DI   H ++ PDP+V+V ++ +  PIE+++RGY+ G    SL   Y+ GK   Y
Sbjct: 73  WFDKVKDIAPTHIVEVPDPSVMVVKRAKALPIEIVIRGYITG----SLWRDYQAGKAD-Y 127

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
               P  +  +Q+   P+ITP+TK+       D+PI   EI+ +G++T + W+  ++ A 
Sbjct: 128 GISWPAGLRKDQRFDQPIITPSTKAEYGKH--DEPIGEAEILRQGLVTPDVWKEATAVAR 185

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            LF+RG + A   GLILVD+KYE GI   + +++ DEIHTPDSSRYW  + YE+ F  G 
Sbjct: 186 RLFQRGQEWARTRGLILVDTKYEMGIADGKLVVI-DEIHTPDSSRYWVADGYEERFARGE 244

Query: 243 TPIGLDKDFIRNWILTRCN-PYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
               LDK+ IR W++           P + +++ +  ++ YI  +EK+TG  F ++   +
Sbjct: 245 DQEMLDKENIRQWLIKEHGFSGHGTPPPLTDDVRVMLARKYIEVFEKLTGETFASEVGSV 304

Query: 302 PPLERIRNNLRKYTH 316
               RI  NLR   H
Sbjct: 305 AA--RIERNLRATGH 317


>gi|288800102|ref|ZP_06405561.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           sp. oral taxon 299 str. F0039]
 gi|288333350|gb|EFC71829.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           sp. oral taxon 299 str. F0039]
          Length = 316

 Score =  219 bits (558), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 126/302 (41%), Positives = 177/302 (58%), Gaps = 11/302 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   T+DIC N 
Sbjct: 18  YHGKVRDVYNINDDLIVMVATDRISAFDVVLPKGIPFKGQVLNQIAAQFLDSTTDICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    YKNG R+I    LPD M +N+
Sbjct: 78  KLATPDPMVTVGLKCEGFKVEMIIRSILTG----SAWRDYKNGVREICGIQLPDGMKENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P+ITPTTK+ E   G D  IS  EII +GI++   +  +  Y   +F RG ++A +
Sbjct: 134 RFPEPIITPTTKADE---GHDLNISKEEIIAQGIVSAEDYAIMEDYTRRIFARGQEIASK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
           +GLILVD+KYEFG  +   + L DEIHTPDSSRY+  E YE+   +G     L K+F+R 
Sbjct: 191 HGLILVDTKYEFG-KRDGKVYLIDEIHTPDSSRYFYAEGYEEKLAKGEPQRQLSKEFVRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     IP++ +      S+ YI  YE ITG KF+         +RI++N+ 
Sbjct: 250 WLINHNFMNEPGQVIPEMTDEYTNSVSERYIELYEHITGNKFVKPTESEDINKRIQDNIN 309

Query: 313 KY 314
            Y
Sbjct: 310 NY 311


>gi|282879525|ref|ZP_06288256.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           timonensis CRIS 5C-B1]
 gi|281306473|gb|EFA98502.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           timonensis CRIS 5C-B1]
          Length = 314

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 123/302 (40%), Positives = 174/302 (57%), Gaps = 11/302 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   T DIC N 
Sbjct: 18  YHGKVRDVYDINDDKIVMVATDRISAFDVVLPKGIPFKGQVLNQIAAKFLDLTQDICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    YK G R++    LP+ M +N+
Sbjct: 78  KLATPDPMVTVGIKCEGFRVEMIIRSILTG----SAWREYKAGARELCGVKLPEGMKENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P++TPTTK+ E   G D  IS  EII +G+++   +  I  Y   LF RG ++A +
Sbjct: 134 RFPEPIVTPTTKADE---GHDMNISKEEIIKQGLVSAEDYAVIEDYTRKLFARGQEIAAK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  +   I L DEIHTPDSSRY+  + YE+   +G     L K+F+R 
Sbjct: 191 QGLILVDTKYEFG-KRDGKIYLIDEIHTPDSSRYFYADGYEEKLAKGEPQKQLSKEFVRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I +      S+ YI  YE ITG KF+  +       RI  N++
Sbjct: 250 WLIEHNFMNEPGQTMPEITDEYAESVSERYIELYEHITGEKFVKADEHDDLAARIERNVK 309

Query: 313 KY 314
           +Y
Sbjct: 310 EY 311


>gi|311747449|ref|ZP_07721234.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Algoriphagus sp. PR1]
 gi|126574808|gb|EAZ79179.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Algoriphagus sp. PR1]
          Length = 312

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 121/297 (40%), Positives = 181/297 (60%), Gaps = 13/297 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P    +Y GKVR+ Y   +   + +A+DR+SAFD  +   IP+KG+VLNQI   +   T
Sbjct: 12  FPGQVGFYKGKVRDVYIF-EKELVVVASDRISAFDVVLPKPIPFKGQVLNQIAAKFLEAT 70

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           SDI  N     PDPNV +G++ + F +E+++RGY+AG+        YK GKR +    LP
Sbjct: 71  SDIVPNWVSATPDPNVTIGKKCEPFKVEMVIRGYMAGHAARE----YKAGKRILCGVELP 126

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           ++M +N   P P+ITPTTK+SE   G D+ IS   I+  GI++   +  +  Y  +LF+R
Sbjct: 127 EHMRENDPFPEPIITPTTKASE---GHDEDISKEAILSEGIVSPEDYAVLEKYTRALFKR 183

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E GLILVD+KYEFG      I L DEIHTPDSSRY+  + YE++  +G+    L
Sbjct: 184 GQEMASEMGLILVDTKYEFG-KFGDEIFLIDEIHTPDSSRYFYADGYEENQAKGLPQKQL 242

Query: 248 DKDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKF-IADNSEL 301
            K+F+R W+++     ++  ++P++ + I+   S  YI  +EKITG KF  AD S++
Sbjct: 243 SKEFVRQWLISNGFQGKEGQSVPEMTDEIVESISDRYIELFEKITGQKFEKADTSQI 299


>gi|254495474|ref|ZP_05108398.1| phosphoribosylamidoimidazole-succinocarboxamidesynthase
           [Polaribacter sp. MED152]
 gi|85819829|gb|EAQ40986.1| phosphoribosylamidoimidazole-succinocarboxamidesynthase
           [Polaribacter sp. MED152]
          Length = 314

 Score =  219 bits (557), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 122/308 (39%), Positives = 181/308 (58%), Gaps = 10/308 (3%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P   + Y GKVRE Y ++D   + IATDRLSAFD  +   IP+KG++LNQI     + TS
Sbjct: 12  PGQKSIYKGKVREVYNINDDLLVMIATDRLSAFDVILPRQIPFKGQILNQIATKMMNETS 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N  +  PD NV VG   + F +E+++RGYL+G+        YK GKR +    +P+
Sbjct: 72  DIVPNWLIANPDENVAVGHLCEPFKVEMVIRGYLSGHAARE----YKLGKRLLCGVKMPE 127

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
           N+ +N K P P+ITP+TK+       D+ IS  +I+  GI++   +  +  Y   LF+RG
Sbjct: 128 NLKENDKFPTPIITPSTKADNGEH--DEDISREDILANGIVSEEDYLILEEYTRKLFQRG 185

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A + GLILVD+KYEFG  K+  I+L DEIHTPDSSRY+  E Y++          L 
Sbjct: 186 SEIAAKRGLILVDTKYEFGKTKEGKIVLIDEIHTPDSSRYFYAEGYQERQDNNEAQKQLS 245

Query: 249 KDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLER 306
           K+F+R W++      ++   IP++ +  I+  S  YI  YE+ITG +F+   +E   L+R
Sbjct: 246 KEFVRQWLIENGFQGKEGQAIPEMSDEKIVEISNRYIELYEQITGEQFVKAQTE-NVLDR 304

Query: 307 IRNNLRKY 314
           I  N+  +
Sbjct: 305 IEKNVLDF 312


>gi|229495572|ref|ZP_04389305.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Porphyromonas endodontalis ATCC 35406]
 gi|229317555|gb|EEN83455.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Porphyromonas endodontalis ATCC 35406]
          Length = 316

 Score =  219 bits (557), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 125/313 (39%), Positives = 180/313 (57%), Gaps = 14/313 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
           +P   + Y GKVR+ YFL       IATDR+SAFD  + A IPYKG+VLNQI       T
Sbjct: 13  LPGQQSVYHGKVRDVYFLEGDLVAMIATDRISAFDVILPAGIPYKGQVLNQIAAKQLDAT 72

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DI  N  +  PDP V +G + + F +E+++RGY+ G    S    Y+ G R I    L 
Sbjct: 73  ADIVPNWKIATPDPMVTIGHKCEPFKVEMVIRGYITG----SAWRAYQEGARSICGIPLA 128

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + + +NQ+  +P+ITPTTK+ E   G D+ IS  EII  G+++   +  +  Y   LF R
Sbjct: 129 EGLRENQRFEHPIITPTTKADE---GHDENISREEIISSGLVSEEDYTLLEQYTQDLFAR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G K+A E GLILVD+KYEFG  K   I L DEIHTPDSSRY+  E +E+ F +G     L
Sbjct: 186 GSKIAEEMGLILVDTKYEFG-KKDGKIYLIDEIHTPDSSRYFYAEGFEERFAKGEPQRQL 244

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPL 304
            K+F+R W+  +    ++   +P++ +   L  ++ YI  YE +TG KF+ A+   L   
Sbjct: 245 SKEFVRKWLTEQGFMGKEGQKVPEMTDEYCLSVAERYIELYEHVTGEKFVHAEQDHLA-- 302

Query: 305 ERIRNNLRKYTHR 317
           +RI  N+  +  +
Sbjct: 303 QRIEKNITDFLKK 315


>gi|220916346|ref|YP_002491650.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219954200|gb|ACL64584.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 319

 Score =  219 bits (557), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 120/315 (38%), Positives = 183/315 (58%), Gaps = 14/315 (4%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRIT-IATDRLSAFDQNIACIPYKGEVLNQITQY 62
           L +  +P L   Y GKVR+NY  S G RI  + TDR+SAFD  +  IP+KGEVL+++T +
Sbjct: 15  LQQLDLPGLGELYRGKVRDNY--SRGDRIVMVTTDRISAFDHVLGTIPFKGEVLSRLTAF 72

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF    DI   H ++ PDP+V+V ++ +  PIE+++RGY+ G    SL   Y+ GK   Y
Sbjct: 73  WFDKVKDIAPTHIVEVPDPSVMVVKRAKALPIEIVIRGYVTG----SLWRDYQAGKAD-Y 127

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
               P  +  +Q+   P+ITP+TK+       D+PI   EI+ +G++T + W+  ++ A 
Sbjct: 128 GISWPAGLRKDQRFDQPIITPSTKAEYGKH--DEPIGEAEILKQGLVTPDVWKEATAVAR 185

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            LF+RG + A   GLILVD+KYE GI   + +++ DEIHTPDSSRYW  + YE+ F  G 
Sbjct: 186 RLFQRGQEWARTRGLILVDTKYEMGIADGKLVVI-DEIHTPDSSRYWVADGYEERFARGE 244

Query: 243 TPIGLDKDFIRNWILTRCN-PYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
               LDK+ IR W++           P + +++ +  ++ Y+  +EK+TG  F ++   +
Sbjct: 245 DQEMLDKENIRQWLIKEHGFSGHGTPPPLTDDVRVMLARKYVEVFEKLTGETFASEVGSV 304

Query: 302 PPLERIRNNLRKYTH 316
               RI  NLR   H
Sbjct: 305 AA--RIERNLRATGH 317


>gi|332521534|ref|ZP_08397988.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Lacinutrix
           algicola 5H-3-7-4]
 gi|332042933|gb|EGI79132.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Lacinutrix
           algicola 5H-3-7-4]
          Length = 317

 Score =  219 bits (557), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 126/311 (40%), Positives = 176/311 (56%), Gaps = 16/311 (5%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P   N Y GKVR  Y ++D   + IATDRLSAFD  +   IPYKG++LNQI       T 
Sbjct: 15  PGQKNVYKGKVRAVYNINDEELVMIATDRLSAFDVVMPKGIPYKGQILNQIATSMMKATE 74

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           D+  N     PDPNV VG   + F +E+++RGYL+G+        YK GKR +    +PD
Sbjct: 75  DLVPNWLTATPDPNVAVGHLCEPFKVEMVIRGYLSGHAARE----YKAGKRMLCGVPMPD 130

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M +N K P P+ITP TK+       D+ IS  +I+ +GI+++  +  +  Y   LF+RG
Sbjct: 131 GMKENDKFPEPIITPATKAE--MGDHDEDISREDILKKGIVSKEDYSVLEDYTRKLFQRG 188

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A   GLILVD+KYEFG  K+  I+L DEIHTPDSSRY+  E Y++      T   L 
Sbjct: 189 TEIAASRGLILVDTKYEFGKTKEGKIVLIDEIHTPDSSRYFYTEGYQERQDNNETQKQLS 248

Query: 249 KDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPP 303
           K+F+R W++   N ++      +P++ +  I   S+ YI  YE I G  FI AD S +  
Sbjct: 249 KEFVRQWLI--ANNFQGLEGQTVPEMSDEYIETVSERYIELYENIMGEPFIKADVSNIQA 306

Query: 304 LERIRNNLRKY 314
             RI  N+  Y
Sbjct: 307 --RIEANVLDY 315


>gi|295133687|ref|YP_003584363.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Zunongwangia profunda SM-A87]
 gi|294981702|gb|ADF52167.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Zunongwangia profunda SM-A87]
          Length = 315

 Score =  219 bits (557), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 121/310 (39%), Positives = 177/310 (57%), Gaps = 12/310 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
            P   + Y GKVR+ Y   D   + IA+DRLSAFD  +   IPYKG++LNQI       T
Sbjct: 12  FPGQKSVYKGKVRDVYAFEDDQLVMIASDRLSAFDVVMPKGIPYKGQILNQIATKMMKDT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
            D+  N     PDPNV VG+  + F +E+++RGYL+G+        YK GKR +    +P
Sbjct: 72  EDLVPNWLQATPDPNVAVGEACEPFKVEMVIRGYLSGHAARE----YKAGKRTLCGVAMP 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + M +N + P P+ITP TK+ +     D+ IS  +I+ RGI++   +  +  Y   LF+R
Sbjct: 128 EGMKENDRFPEPIITPATKAEQGDH--DEDISKEDILKRGIVSAEDYAVLEDYTKKLFQR 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A + GLILVD+KYEFG  K   I+L DEIHTPDSSRY+   TY++   +G     L
Sbjct: 186 GTEIAEKRGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYANTYKELQEKGEPQKQL 245

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKF-IADNSELPPL 304
            K+F+R W++      ++   +P + +  I   S+ YI  YE ITG  F  AD S +   
Sbjct: 246 SKEFVRQWLIQNGFQGKEGQEVPFMSDEYIETVSERYIELYENITGETFEKADVSNIE-- 303

Query: 305 ERIRNNLRKY 314
           +R+  N++ Y
Sbjct: 304 KRVEENVKAY 313


>gi|260592408|ref|ZP_05857866.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           veroralis F0319]
 gi|260535644|gb|EEX18261.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           veroralis F0319]
          Length = 316

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 177/311 (56%), Gaps = 15/311 (4%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   T+DIC N 
Sbjct: 18  YHGKVRDVYDINDDLIVMVATDRISAFDVVLPKGIPFKGQVLNQIASKFLDLTADICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    YK+G R I    LPD M +N+
Sbjct: 78  KLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWRAYKDGCRGICGVKLPDGMRENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P++TPTTK+ E   G D  IS  EII +GI++   +  I  +   LF RG ++A +
Sbjct: 134 RFPEPIVTPTTKADE---GHDMNISKEEIIKQGIVSAEDYAIIEDWTRKLFARGQEIAAK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  +     L DEIHTPDSSRY+  + YE+   +G     L K+F+R 
Sbjct: 191 QGLILVDTKYEFG-KRDGQCYLIDEIHTPDSSRYFYADGYEEKLAKGEPQKQLSKEFVRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I +      S+ YI  YE ITG KF     E     RI  N++
Sbjct: 250 WLIEHNFMNEPGQTMPEITDEYAESVSERYIELYEHITGEKFDKAAEEGDIAARIEKNVK 309

Query: 313 KYTHRHLSSRN 323
           +Y    L+SR 
Sbjct: 310 EY----LASRK 316


>gi|317502844|ref|ZP_07960945.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella salivae DSM 15606]
 gi|315666033|gb|EFV05599.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella salivae DSM 15606]
          Length = 316

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 172/302 (56%), Gaps = 11/302 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + IATDR+SAFD  +   IP+KG+VLNQI   +   TSDIC N 
Sbjct: 18  YHGKVRDVYDINDDLLVMIATDRISAFDVVLPKGIPFKGQVLNQIAAKFLDATSDICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    YK G R +    LP+ M +N+
Sbjct: 78  KLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWRAYKEGCRDLCGVKLPEGMRENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P++TPTTK+ E   G D  IS  EII +G++++  ++ I  Y   LF+RG ++A +
Sbjct: 134 RFPEPIVTPTTKADE---GHDMNISREEIIAQGLVSKEDYDVIEDYTKKLFKRGQEIAAK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  +   I L DEIHTPDSSRY+  + YE+    G     L K+F+R 
Sbjct: 191 QGLILVDTKYEFG-KRDGKIYLIDEIHTPDSSRYFYADGYEEKLAAGKPQKQLSKEFVRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I +      S+ YI  YE ITG KF           RI  N+ 
Sbjct: 250 WLIEHNFMNEPGQQMPEISDEYAESVSERYIELYEHITGEKFDKSVESGDIAARIEKNVE 309

Query: 313 KY 314
            Y
Sbjct: 310 NY 311


>gi|225012860|ref|ZP_03703293.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Flavobacteria bacterium MS024-2A]
 gi|225002982|gb|EEG40959.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Flavobacteria bacterium MS024-2A]
          Length = 316

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 123/311 (39%), Positives = 185/311 (59%), Gaps = 13/311 (4%)

Query: 8   YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHH 66
           ++  L + Y+GKVRE Y L + T I +ATDRLSAFD  +   IP+KG++LNQI       
Sbjct: 11  HLEGLKSKYTGKVREVYRLENDTLIMVATDRLSAFDVVMPKGIPFKGQILNQIANKMLAA 70

Query: 67  TSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLL 126
           T+DI  N  +  PDPNV +G   + F +E+++RGYL+G+   +    YK+G+R +    +
Sbjct: 71  TADIVPNWLVATPDPNVSIGVACEPFKVEMVIRGYLSGHAART----YKSGERLLCGVSM 126

Query: 127 PDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFE 186
           P+ + +N   P P+ITP TK+ E   G D+ IS  EII + I++ + +  + SY   LF 
Sbjct: 127 PEGLIENDPFPTPIITPATKAEE---GHDEDISREEIIKQSIVSESDYLKLESYTHKLFA 183

Query: 187 RGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
           RG ++A + GLILVD+KYEFG      I+L DEIHTPDSSRY+  E Y +   + +    
Sbjct: 184 RGTEIAKKQGLILVDTKYEFGKTATGEILLIDEIHTPDSSRYFYEEGYAERQAKALPQKQ 243

Query: 247 LDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPL 304
           L K+F+R W+++      +   +PD+  ++I   S  YI  YE ITGL F  + + +  +
Sbjct: 244 LSKEFVRQWLISNGFQGLEGQILPDMDSSLITSISDRYIELYENITGLPF--EKATISNI 301

Query: 305 -ERIRNNLRKY 314
            ERI+ N+  Y
Sbjct: 302 QERIQKNISNY 312


>gi|212550923|ref|YP_002309240.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Azobacteroides pseudotrichonymphae
           genomovar. CFP2]
 gi|229485672|sp|B6YRK7|PUR7_AZOPC RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|212549161|dbj|BAG83829.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Azobacteroides pseudotrichonymphae
           genomovar. CFP2]
          Length = 323

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 126/303 (41%), Positives = 179/303 (59%), Gaps = 14/303 (4%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y +     + IATDR+SAFD  ++  IPYKG+VLNQI   +   TSDI  N 
Sbjct: 18  YHGKVRDVYTVGSDMLVIIATDRISAFDVVLSRGIPYKGQVLNQIAAKFLDSTSDILPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V +G   + F +E+++RGYL G    S    YK G+R +    LP+ M +N+
Sbjct: 78  KLAEPDPMVTIGLLCEPFKVEMVIRGYLTG----SAWRKYKEGERTLCAVTLPEGMKENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           K P P+ITPTTK+ +   G D+ IS  EII R ++++  +E +  Y  +LF+RG ++A  
Sbjct: 134 KFPNPIITPTTKAYK---GHDENISKEEIIERFLVSKEDYEQLEYYTRALFQRGTEIASS 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  K   I L DEIHTPDSSRY+  E Y++ F +G     L K+F+R 
Sbjct: 191 KGLILVDTKYEFG-KKDGRIYLIDEIHTPDSSRYFYSEDYQERFEKGEGQKQLSKEFVRQ 249

Query: 255 WILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPLERIRNNL 311
           W++ +    ++   +P++        S+ YI  YE I G +FI A  S +    RI+ N+
Sbjct: 250 WLMKQNFQGKEGQIVPEMTPEYCQIVSERYIELYETIVGEQFIRASTSNISA--RIKKNI 307

Query: 312 RKY 314
             Y
Sbjct: 308 ETY 310


>gi|327312415|ref|YP_004327852.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           denticola F0289]
 gi|326945587|gb|AEA21472.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           denticola F0289]
          Length = 316

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 127/311 (40%), Positives = 175/311 (56%), Gaps = 15/311 (4%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   T+DIC N 
Sbjct: 18  YHGKVRDVYDINDDLIVMVATDRISAFDVVLPKGIPFKGQVLNQIAAKFLDQTADICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    YK G R++    LPD M +N+
Sbjct: 78  KLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWRAYKEGCRELCGVRLPDGMCENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P++TPTTK+ E   G D  IS  EII +GI++   +  I  +   LF RG ++A  
Sbjct: 134 RFPEPIVTPTTKADE---GHDLNISKEEIIRQGIVSAEDYAVIEDWTRRLFARGQEIAAR 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  +     L DEIHTPDSSRY+  + YE+   +G     L K+F+R 
Sbjct: 191 QGLILVDTKYEFG-KRDGKCYLIDEIHTPDSSRYFYADGYEEKLAKGEPQRQLSKEFVRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I +      S  YI  YE ITG KF     E     RI  N++
Sbjct: 250 WLIEHDFMNEPGQTMPEITDEYAASVSDRYIELYEHITGEKFDKAAEEGDIAARIEKNVK 309

Query: 313 KYTHRHLSSRN 323
           +Y    L+SR 
Sbjct: 310 QY----LASRK 316


>gi|325270152|ref|ZP_08136759.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella multiformis DSM 16608]
 gi|324987453|gb|EGC19429.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella multiformis DSM 16608]
          Length = 316

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 127/311 (40%), Positives = 174/311 (55%), Gaps = 15/311 (4%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y + D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   T+DIC N 
Sbjct: 18  YHGKVRDVYDIDDDLIVMVATDRISAFDVVLPKGIPFKGQVLNQIAAKFLDQTADICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    YK G R++    LPD M +N+
Sbjct: 78  KLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWRAYKEGCRELCGVRLPDGMRENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P++TPTTK+ E   G D  IS  EII +GI++   +  I  +   LF RG ++A  
Sbjct: 134 RFPEPIVTPTTKADE---GHDLNISKEEIIRQGIVSAEDYAVIEDWTRRLFARGQEIAAR 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  +     L DEIHTPDSSRY+  + YE+   +G     L K+F+R 
Sbjct: 191 QGLILVDTKYEFG-KRDGKCYLIDEIHTPDSSRYFYADGYEEKLAKGEPQRQLSKEFVRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I +      S  YI  YE ITG KF     E     RI  N++
Sbjct: 250 WLIEHDFMNEPGQTMPEITDEYAASVSDRYIELYEHITGEKFDKAAEEGDIAARIEKNVK 309

Query: 313 KYTHRHLSSRN 323
           +Y    L+SR 
Sbjct: 310 RY----LASRK 316


>gi|302346462|ref|YP_003814760.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           melaninogenica ATCC 25845]
 gi|302150442|gb|ADK96703.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           melaninogenica ATCC 25845]
          Length = 316

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 177/311 (56%), Gaps = 15/311 (4%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   T+DIC N 
Sbjct: 18  YHGKVRDVYDINDDLIVMVATDRISAFDVVLPKGIPFKGQVLNQIAAKFLDLTTDICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    YK+G R+I    LPD M +N+
Sbjct: 78  KLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWRAYKDGCREICGVKLPDGMRENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P++TPTTK+ E   G D  IS  EII +GI++   +  I  +   LF RG ++A +
Sbjct: 134 RFPEPIVTPTTKADE---GHDMNISKEEIIEQGIVSAEDYAIIEDWTRKLFARGQEIAAK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  +     L DEIHTPDSSRY+  E YE+   +G     L K+F+R 
Sbjct: 191 QGLILVDTKYEFG-KRDGQCYLIDEIHTPDSSRYFYAEGYEEKLEKGEPQKQLSKEFLRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I +      S  YI  YE ITG KF     +     RI  N++
Sbjct: 250 WLIEHNFMNEPGQTMPEITDEYAETVSDRYIELYEHITGEKFDKAVEDGDIAARIEKNVK 309

Query: 313 KYTHRHLSSRN 323
           +Y    L+SR 
Sbjct: 310 QY----LASRK 316


>gi|332290997|ref|YP_004429606.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169083|gb|AEE18338.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Krokinobacter diaphorus 4H-3-7-5]
          Length = 315

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 121/314 (38%), Positives = 177/314 (56%), Gaps = 16/314 (5%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P   + Y GKVRE Y L D   + +ATDRLSAFD  +   IP+KG++LNQI       T 
Sbjct: 12  PGQKSIYKGKVREVYTLEDDLLLMVATDRLSAFDVVMPKGIPFKGQILNQIATKMMKDTE 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           D+  N  +  PDPNV +G++ + F +E+++RGY++G+        YK G+R +    +P+
Sbjct: 72  DLVPNWLVATPDPNVAIGKRCEPFKVEMVIRGYMSGHAARE----YKAGRRVLCGVEMPE 127

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M +N   P P+ITP TK+       D+ IS  +II + I++   +  +  Y   LF+RG
Sbjct: 128 GMKENDAFPAPIITPATKAE--MGDHDEDISREDIIKKAIVSEEDYLVLEDYTCKLFQRG 185

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A   GLILVD+KYEFG      I+L DEIHTPDSSRY+  E YE+    G     L 
Sbjct: 186 SEIAASRGLILVDTKYEFGKTADGEIVLIDEIHTPDSSRYFYAEGYEERQAAGEAQKQLS 245

Query: 249 KDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPP 303
           K+F+R W+++  N ++      +P++ +  I   S+ YI  YE ITG  F  AD S +  
Sbjct: 246 KEFVRQWLIS--NDFQGLEGQRVPEMTDEYIETVSERYIELYENITGDAFAKADTSNI-- 301

Query: 304 LERIRNNLRKYTHR 317
           L RI  N+  Y  +
Sbjct: 302 LNRIEKNVLAYLAK 315


>gi|288802489|ref|ZP_06407928.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           melaninogenica D18]
 gi|288335017|gb|EFC73453.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           melaninogenica D18]
          Length = 316

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 177/311 (56%), Gaps = 15/311 (4%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   T+DIC N 
Sbjct: 18  YHGKVRDVYDINDDLIVMVATDRISAFDVVLPKGIPFKGQVLNQIAAKFLDLTTDICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    YK+G R+I    LPD M +N+
Sbjct: 78  KLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWRAYKDGCREICGVKLPDGMRENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P++TPTTK+ E   G D  IS  EII +GI++   +  I  +   LF RG ++A +
Sbjct: 134 RFPEPIVTPTTKADE---GHDMNISKEEIIEQGIVSAEDYAIIEDWTRKLFARGQEIAAK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  +     L DEIHTPDSSRY+  E YE+   +G     L K+F+R 
Sbjct: 191 QGLILVDTKYEFG-KRDGQCYLIDEIHTPDSSRYFYAEGYEEKLEKGEPQKQLSKEFLRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I +      S  YI  YE ITG KF     +     RI  N++
Sbjct: 250 WLIEHNFMNEPGQTMPEITDEYAETVSDRYIELYEHITGEKFDKAVEDGDIAARIEKNVK 309

Query: 313 KYTHRHLSSRN 323
           +Y    L+SR 
Sbjct: 310 EY----LASRK 316


>gi|146300478|ref|YP_001195069.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacterium johnsoniae UW101]
 gi|146154896|gb|ABQ05750.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Flavobacterium johnsoniae UW101]
          Length = 317

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 121/309 (39%), Positives = 179/309 (57%), Gaps = 12/309 (3%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P   + Y GKVRE Y ++D   + +ATDRLSAFD  +   IPYKG++LNQI   +   T 
Sbjct: 13  PNQKSVYRGKVREVYNINDELLVMVATDRLSAFDVVLPKGIPYKGQILNQIATKFMELTQ 72

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N  +  PDPNV VG   + F +E+++RGYL+G+        Y  G+++I    + +
Sbjct: 73  DIVPNWLIATPDPNVAVGHLCEPFKVEMVIRGYLSGHAARE----YAAGRKQICGVTMAE 128

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            + +N K P P+ITPTTK+   +   D+ IS   I+ +GI++   +  +  Y  +LF+RG
Sbjct: 129 GLKENDKFPEPIITPTTKADNGSH--DEDISREAILSKGIISEEDYLVLEKYTRALFQRG 186

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A   GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  + Y +   +G     L 
Sbjct: 187 TEIAASRGLILVDTKYEFGKTKDGVIVLIDEIHTPDSSRYFYADGYAERQEKGEEQKQLS 246

Query: 249 KDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPLE 305
           K+F+R W++      ++   IPD+ +  I   S+ YI  YE I G KF+ AD   +   +
Sbjct: 247 KEFVRRWLIENGFQGQEGQQIPDMSDEYIESVSERYIELYENILGEKFVKADIDNID--Q 304

Query: 306 RIRNNLRKY 314
           RI  N+ +Y
Sbjct: 305 RIEKNVLQY 313


>gi|325852022|ref|ZP_08171105.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           denticola CRIS 18C-A]
 gi|325484578|gb|EGC87494.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           denticola CRIS 18C-A]
          Length = 316

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 130/328 (39%), Positives = 182/328 (55%), Gaps = 17/328 (5%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K   +     + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFDGQKSVYHGKVRDVYDINDDLIVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  L  PDP V VG + + F +E+I+R  L G    S    YK G
Sbjct: 61  QIAAKFLDQTADICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWRAYKEG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LPD M +N++ P P++TPTTK+ E   G D  IS  EII +GI++   +  I
Sbjct: 117 CRELCGVRLPDGMRENERFPEPIVTPTTKADE---GHDLNISKEEIIRQGIVSAEDYAVI 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +   LF RG ++A   GLILVD+KYEFG  +     L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDWTRRLFARGQEIAARQGLILVDTKYEFG-KRDGKCYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
             +G     L K+F+R W++     N     +P+I +      S  YI  YE ITG KF 
Sbjct: 233 LAKGEPQRQLSKEFVRQWLIEHDFMNEPGQTMPEITDEYAASISDRYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHRHLSSRN 323
               E     RI  N+++Y    L+SR 
Sbjct: 293 KAAEEGDIATRIEKNVKQY----LASRK 316


>gi|323345646|ref|ZP_08085869.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella oralis ATCC 33269]
 gi|323093760|gb|EFZ36338.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella oralis ATCC 33269]
          Length = 315

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 182/327 (55%), Gaps = 17/327 (5%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K   +     + Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLN
Sbjct: 1   MKALTKTDFHFEGQKSVYHGKVRDVYNINDDLMVMVATDRISAFDVVLPKGIPFKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T DIC N  L  PDP V VG + + F +E+I+R  L G    S    YK+G
Sbjct: 61  QIAAKFLDATKDICPNWKLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWRAYKDG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R +    LPD M +N+    P++TPTTK+ E   G D  IS  EII +GI++   +  I
Sbjct: 117 CRDLCGVKLPDGMRENECFKEPIVTPTTKADE---GHDMNISREEIISQGIVSAEDYAII 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             Y   LF+RG ++A + GLILVD+KYEFG  +   I L DEIHTPDSSRY+  + YE+ 
Sbjct: 174 EDYTRKLFKRGQEIAAKQGLILVDTKYEFG-KRSGKIYLIDEIHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
           F +G     L K+F+R W++     N     +P+I +      S+ YI  YE ITG KF 
Sbjct: 233 FEKGEPQRQLSKEFVRQWLIEHNFMNEPGQQMPEITDEYAESVSERYIELYEHITGEKFD 292

Query: 296 ADNSELPPLERIRNNLRKYTHRHLSSR 322
               E     RI  N+  Y    L+SR
Sbjct: 293 KAVEEGNIAARIEKNVAAY----LASR 315


>gi|300770119|ref|ZP_07079998.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Sphingobacterium spiritivorum ATCC 33861]
 gi|300762595|gb|EFK59412.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Sphingobacterium spiritivorum ATCC 33861]
          Length = 337

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 175/284 (61%), Gaps = 13/284 (4%)

Query: 15  YYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSN 73
           +Y GKVR+ Y ++D     +ATDR+SAFD  +   IPYKG+VLNQI   +   T DI  N
Sbjct: 39  FYRGKVRDVYTIADRYLAMVATDRISAFDVVLPRAIPYKGQVLNQIAAKFLKATEDILPN 98

Query: 74  HTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDN 133
             ++ PDP+V +G+  + F +E+++RGYL+G+        Y  G+R++    L + + +N
Sbjct: 99  WVVEVPDPSVTIGKMCEPFKVEMVIRGYLSGHAWRE----YSAGRREVCGEKLVEGLKEN 154

Query: 134 QKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLAL 193
            KLP P+ITPTTK   +A G D+ IS  +I+ +GI++   +  +  Y  +LF+RG ++A 
Sbjct: 155 DKLPEPIITPTTK---AAVGHDEDISRADILKKGIVSEEDYIQLEKYTKALFQRGTEIAK 211

Query: 194 ENGLILVDSKYEFGIDKKQNII-LADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFI 252
           E GLILVD+KYEFG  K+  +I L DEIHTPDSSRY+  E YE+    G     L K+F+
Sbjct: 212 ERGLILVDTKYEFG--KRDGVIYLIDEIHTPDSSRYFYAEGYEERQANGEPQKQLSKEFV 269

Query: 253 RNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKF 294
           R W++      +D   +P++ + I+   S+ YI  YE ITG +F
Sbjct: 270 RKWLIENGFQGKDGQQVPEMTDEIVNSISERYIELYEHITGERF 313


>gi|91215684|ref|ZP_01252654.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Psychroflexus torquis ATCC 700755]
 gi|91186150|gb|EAS72523.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Psychroflexus torquis ATCC 700755]
          Length = 316

 Score =  216 bits (549), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 119/289 (41%), Positives = 168/289 (58%), Gaps = 9/289 (3%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
           +P   +YY GKVRE Y L+D   + +ATDRLSAFD  +   IPYKG++LN+I       T
Sbjct: 12  LPGQVDYYKGKVREVYTLADHNIVIVATDRLSAFDVVLPQGIPYKGQILNEIASEMLKAT 71

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
            DI  N     PDPNV +G +   F +E++VR YL G+        Y  G RK+    L 
Sbjct: 72  EDIVPNWLEAVPDPNVSIGVKCDTFKVEMVVRNYLVGHAARE----YTAGNRKLCGVNLK 127

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + +  N K   P++TPTTK+ +     DQ IS  EI+ +GI++ + ++ +  YAL LFER
Sbjct: 128 EGLKVNDKFDSPILTPTTKAEQGDH--DQDISKEEILAQGIVSHSDYKVLEDYALKLFER 185

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G +LA + GL+LVD+KYEFG      I++ DEIHTPDSSRY+  E Y +   +G     L
Sbjct: 186 GSQLADQRGLLLVDTKYEFGKTPDGKIVVIDEIHTPDSSRYFYKEGYNERQTKGEKQKQL 245

Query: 248 DKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKF 294
            K+F+R W++      ++   IP++   I+   S+ YI  YEKITG  F
Sbjct: 246 SKEFVREWLMENGFQGKEGQKIPELTPQIVNSISERYIELYEKITGKAF 294


>gi|282859530|ref|ZP_06268635.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           bivia JCVIHMP010]
 gi|282587758|gb|EFB92958.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           bivia JCVIHMP010]
          Length = 332

 Score =  216 bits (549), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 126/302 (41%), Positives = 172/302 (56%), Gaps = 11/302 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   T+DIC N 
Sbjct: 34  YHGKVRDVYNINDDLIVMVATDRISAFDVVLPKGIPFKGQVLNQIAAKFLDQTTDICPNW 93

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    Y+ G R+I    LPD M +N+
Sbjct: 94  KLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWREYQKGCREICGVKLPDGMRENE 149

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P+ITPTTK+ E   G D  IS  EII +GI++   +  I  +   +F RG ++A +
Sbjct: 150 RFPEPIITPTTKADE---GHDLNISREEIIAQGIVSEEDYNIIEDWTRKIFARGQEIAAK 206

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  +     L DEIHTPDSSRY+  E YE+ F +G     L K+F+R 
Sbjct: 207 QGLILVDTKYEFG-KRDGQCYLIDEIHTPDSSRYFYAEGYEEKFEKGEPQRQLSKEFVRQ 265

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     IP+I +      S  YI  YE ITG  F     +    ERI  N++
Sbjct: 266 WLIEHNFMNEPGQVIPEITDEYAETVSDRYIELYEHITGENFEKKEYDGDIAERIEKNVK 325

Query: 313 KY 314
            Y
Sbjct: 326 AY 327


>gi|325103870|ref|YP_004273524.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pedobacter saltans DSM 12145]
 gi|324972718|gb|ADY51702.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pedobacter saltans DSM 12145]
          Length = 314

 Score =  215 bits (548), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 119/294 (40%), Positives = 176/294 (59%), Gaps = 11/294 (3%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P   ++Y GKVR+ Y + +   + + TDR+SAFD  +   IP+KG+VLNQI   + + T 
Sbjct: 12  PGQTSFYKGKVRDVYTIDNKYLVMVVTDRISAFDVVLPEPIPFKGQVLNQIAAKFLNATK 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N  +  PD NV +G+  + F +E+++RGYLAG+        Y  GKR++    LP+
Sbjct: 72  DIVPNWVVTVPDANVTIGRICEPFKVEMVIRGYLAGHVARE----YAAGKRELCGVALPE 127

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            + +N KLP P+ITPTTK   +A G D+ IS  EI+ RGI+T   +  + +Y   L++RG
Sbjct: 128 GLKENDKLPEPIITPTTK---AAVGHDEDISREEILKRGIVTEADYIQLENYTRKLYQRG 184

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A   GLILVD+KYEFG   +  I L DEIHTPDSSRY+  E YE+   +G     L 
Sbjct: 185 TEIAASQGLILVDTKYEFG-KTEGTIYLIDEIHTPDSSRYFYKEGYEELQAKGEPQKQLS 243

Query: 249 KDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSE 300
           K+F+R W++      ++   +P++    +   S+ YI  YEKITG KFI   ++
Sbjct: 244 KEFVRRWLIENGFQGKEGQQVPEMNAERVEAISERYIELYEKITGEKFIKAGTD 297


>gi|284037555|ref|YP_003387485.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Spirosoma
           linguale DSM 74]
 gi|283816848|gb|ADB38686.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Spirosoma
           linguale DSM 74]
          Length = 313

 Score =  215 bits (548), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 123/309 (39%), Positives = 185/309 (59%), Gaps = 19/309 (6%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
            P    +Y GKVR+ Y   D   + IA+DR+SAFD  +   IP+KG+VLNQ   Y+   T
Sbjct: 11  FPGQTAFYRGKVRDVYSFPDKL-VMIASDRISAFDVVLPRPIPFKGQVLNQTASYFLKAT 69

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DI  N  LD PDPNV +G + + + +E++VRGYLAG+        Y++G R +    LP
Sbjct: 70  ADIVPNWLLDVPDPNVSIGLKCEPYAVEMVVRGYLAGHAWRQ----YRDGHRILCGVPLP 125

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           D + +N +LP P+ITP+TK+ E   G D+ IS  EI+ R I+ + ++E +  YAL+LF R
Sbjct: 126 DGLRENDRLPTPIITPSTKAHE---GHDEDISREEILSRSIVPQEEYEQLEQYALALFAR 182

Query: 188 GCKLALENGLILVDSKYEFG-IDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
           G ++A + GLILVD+KYEFG +D K  + L DE+HTPDSSRY+  +TY+ +         
Sbjct: 183 GTEMAAQQGLILVDTKYEFGNLDGK--VYLIDEVHTPDSSRYFYADTYQANQEAEQPQKQ 240

Query: 247 LDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELP 302
           L K+F+R W++   N ++      IP + +  + + +  YI  +EK+TG  F    +   
Sbjct: 241 LSKEFVREWLI--ANGFQGKTGQTIPAMSDEWVNQITTRYIELFEKVTGQSFQPAEA-TD 297

Query: 303 PLERIRNNL 311
           P+ RI  N+
Sbjct: 298 PVARIETNI 306


>gi|86157539|ref|YP_464324.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774050|gb|ABC80887.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 319

 Score =  215 bits (547), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 182/315 (57%), Gaps = 14/315 (4%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRIT-IATDRLSAFDQNIACIPYKGEVLNQITQY 62
           L +  +P L   Y GKVR+NY  S G RI  + TDR+SAFD  +  IP+KGEVL+++T +
Sbjct: 15  LRQLDLPGLGELYRGKVRDNY--SRGDRIVMVTTDRISAFDHVLGTIPFKGEVLSRLTAF 72

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           WF    D+   H ++ PDP+V+V ++ +  PIE+++RGY+ G    SL   Y+ GK   Y
Sbjct: 73  WFDKVKDLAPTHIVEVPDPSVMVVKRAKALPIEIVIRGYITG----SLWRDYQAGKAD-Y 127

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
               P  +  +Q+    VITP+TK+       D+PI  +E++ +G++  + W+  ++ A 
Sbjct: 128 GIAWPAGLRKDQRFDEAVITPSTKAEYGKH--DEPIGEDELLKQGLVAPDVWKEATAVAR 185

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            LF+RG + A   GLILVD+KYE GI   + +++ DEIHTPDSSRYW  + YE+ F  G 
Sbjct: 186 RLFQRGQEWARTRGLILVDTKYEMGIADGKLVVI-DEIHTPDSSRYWVADGYEERFARGE 244

Query: 243 TPIGLDKDFIRNWILTRCN-PYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSEL 301
               LDK+ IR W++           P + +++ +  ++ YI  +EK+TG  F ++   +
Sbjct: 245 DQEMLDKENIRQWLIKEHGFSGHGTPPPLTDDVRVMLARKYIEVFEKLTGETFASEVGSV 304

Query: 302 PPLERIRNNLRKYTH 316
               RI  NLR   H
Sbjct: 305 AA--RIERNLRATGH 317


>gi|86131829|ref|ZP_01050426.1| phosphoribosylaminoimidazolesuccinocarboxamidesynthase [Dokdonia
           donghaensis MED134]
 gi|85817651|gb|EAQ38825.1| phosphoribosylaminoimidazolesuccinocarboxamidesynthase [Dokdonia
           donghaensis MED134]
          Length = 315

 Score =  215 bits (547), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 121/314 (38%), Positives = 177/314 (56%), Gaps = 16/314 (5%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P   + Y GKVRE Y L D   + +ATDRLSAFD  +   IP+KG++LNQI       T 
Sbjct: 12  PGQKSIYKGKVREVYTLEDDLLLMVATDRLSAFDVVMPKGIPFKGQILNQIATKMMKDTE 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           D+  N  +  PDPNV +G++ + F +E+++RGY++G+        YK G+R +    +P+
Sbjct: 72  DLVPNWLVATPDPNVAIGKRCEPFKVEMVIRGYMSGHAARE----YKAGRRILCGVAMPE 127

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M +N   P P+ITP TK+       D+ IS  +II + I++   +  +  Y   LF+RG
Sbjct: 128 GMKENDVFPEPIITPATKAE--MGDHDEDISREDIIKKNIVSEEDYLVLEDYTRKLFQRG 185

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A   GLILVD+KYEFG      I+L DEIHTPDSSRY+  E YE+    G     L 
Sbjct: 186 SEIAASRGLILVDTKYEFGKTADGEIVLIDEIHTPDSSRYFYAEGYEERQAAGEAQKQLS 245

Query: 249 KDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPP 303
           K+F+R W+++  N ++      +P++ +  I   S+ YI  YE ITG  F  AD S +  
Sbjct: 246 KEFVRQWLIS--NNFQGLEGQTVPEMTDEYIETVSERYIELYENITGDAFAKADTSNIQ- 302

Query: 304 LERIRNNLRKYTHR 317
            ERI  N+  Y  +
Sbjct: 303 -ERIEKNVLTYLAK 315


>gi|163755517|ref|ZP_02162636.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Kordia
           algicida OT-1]
 gi|161324430|gb|EDP95760.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Kordia
           algicida OT-1]
          Length = 315

 Score =  215 bits (547), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 123/303 (40%), Positives = 176/303 (58%), Gaps = 12/303 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y+GKVRE Y ++D   + IATDRLSAFD  +   IP+KG++LNQI       T  +  N 
Sbjct: 19  YTGKVREVYTINDDLLVMIATDRLSAFDVVMPKGIPFKGQILNQIATKMMKATEHLVPNW 78

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            +  PDPNV +G   + F +E+++RGYL+G+        YK GKR++    +P+ M +N 
Sbjct: 79  LIATPDPNVAIGHMCKPFKVEMVIRGYLSGHAARE----YKAGKRRLCGVEMPEGMIEND 134

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           K P P+ITP TK+       D+ IS  EI+ +GI++   +  + +Y   LFE G K+A E
Sbjct: 135 KFPSPIITPATKAEMGEH--DEDISREEILAKGIVSEEDYAQLENYTRLLFEEGTKIAKE 192

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  +TYE+  ++      L K+F+R 
Sbjct: 193 RGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYADTYEELQKKQEPQKQLSKEFVRQ 252

Query: 255 WILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKF-IADNSELPPLERIRNNL 311
           W++      ++   +P + +  I   S  YI  YE ITG  F  AD S +  L RI  N+
Sbjct: 253 WLINNDFQGKEGQTVPFMSDEYINSVSDRYIELYENITGETFKKADVSNI--LNRIEENV 310

Query: 312 RKY 314
             +
Sbjct: 311 VSF 313


>gi|282877956|ref|ZP_06286765.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           buccalis ATCC 35310]
 gi|281299957|gb|EFA92317.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           buccalis ATCC 35310]
          Length = 316

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 127/304 (41%), Positives = 173/304 (56%), Gaps = 15/304 (4%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y ++D   + +ATDR+SAFD  +   IP+KG+VLNQI   +   T DIC N 
Sbjct: 18  YHGKVRDVYNINDDLIVMVATDRISAFDVILPKGIPFKGQVLNQIAAKFLDSTKDICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            +  PDP V VG + + F +E+I+R  L G    S    Y  G R++    LPD M +N+
Sbjct: 78  KIATPDPMVTVGVKCEGFRVEMIIRSILTG----SAWREYNAGARELCGVKLPDGMKENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P++TPTTK+ E   G D  IS  EII +GI+    +  I  Y   LF RG ++A +
Sbjct: 134 RFPEPIVTPTTKADE---GHDLNISKEEIISQGIVPAEDYAIIEDYTRKLFARGQEIAAK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  K   I L DEIHTPDSSRY+  + YE+   +G     L K+F+R 
Sbjct: 191 QGLILVDTKYEFG-KKDGKIYLIDEIHTPDSSRYFYADGYEEKLAKGEPQKQLSKEFVRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF--IADNSELPPLERIRNN 310
           W++     N     +P+I +      S+ YI  YE ITG KF   AD+ +L    RI  N
Sbjct: 250 WLIEHNFMNEPGQTMPEITDEYAESVSERYIELYEHITGEKFKKAADHDDLAA--RIEKN 307

Query: 311 LRKY 314
           +  Y
Sbjct: 308 VSDY 311


>gi|227538572|ref|ZP_03968621.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241491|gb|EEI91506.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Sphingobacterium spiritivorum ATCC 33300]
          Length = 325

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 116/284 (40%), Positives = 174/284 (61%), Gaps = 13/284 (4%)

Query: 15  YYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSN 73
           +Y GKVR+ Y ++D     +ATDR+SAFD  +   IPYKG+VLNQI   +   T DI  N
Sbjct: 23  FYRGKVRDVYTIADRYLAMVATDRISAFDVVLPRAIPYKGQVLNQIAAKFLKATEDILPN 82

Query: 74  HTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDN 133
             ++ PDP+V +G+  + F +E+++RGYL+G+        Y  G+R++    L + + +N
Sbjct: 83  WVVEVPDPSVTIGKMCEPFKVEMVIRGYLSGHAWRE----YSAGRREVCGEKLVEGLKEN 138

Query: 134 QKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLAL 193
            KLP P+ITPTTK   +A G D+ IS  +I+ +GI++   +  +  Y  +LF+RG ++A 
Sbjct: 139 DKLPEPIITPTTK---AAVGHDEDISRADILKKGIVSEEDYIQLEKYTKALFQRGTEIAK 195

Query: 194 ENGLILVDSKYEFGIDKKQNII-LADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFI 252
           E GLILVD+KYEFG  K+  +I L DEIHTPDSSRY+  + YE     G     L K+F+
Sbjct: 196 ERGLILVDTKYEFG--KRDGVIYLIDEIHTPDSSRYFYADGYEDRQSNGEPQKQLSKEFV 253

Query: 253 RNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKF 294
           R W++      +D   +P++ + I+   S+ YI  YE ITG +F
Sbjct: 254 RKWLIENGFQGKDGQQVPEMTDEIVNSISERYIELYEHITGERF 297


>gi|150025152|ref|YP_001295978.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacterium psychrophilum JIP02/86]
 gi|166229547|sp|A6GYJ4|PUR7_FLAPJ RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|149771693|emb|CAL43167.1| Phosphoribosylaminoimidazolesuccinocarboxamidesynthase
           [Flavobacterium psychrophilum JIP02/86]
          Length = 316

 Score =  213 bits (541), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 177/309 (57%), Gaps = 12/309 (3%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P   + Y GKVRE Y ++D   + +ATDRLSAFD  +   IPYKG++LNQI   +   T 
Sbjct: 12  PNQKSVYRGKVREVYNINDELLVMVATDRLSAFDVVLPEGIPYKGQILNQIATKFMELTQ 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N  +  PDPNV VG   + F +E+++RGYL+G+        Y  GKR I    +P+
Sbjct: 72  DIVPNWLIATPDPNVAVGHLCEPFKVEMVIRGYLSGHAARE----YALGKRTICGVTMPE 127

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            + +N + P P+ITPTTK+   +   D+ IS + I+ + I++   +  +  Y   L++RG
Sbjct: 128 GLKENDQFPTPIITPTTKADNGSH--DEDISRSAILAKNIVSEQDYLVLEKYTRDLYQRG 185

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A   GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  E Y+           L 
Sbjct: 186 TEIAASRGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYAEGYQDRQNNEEEQKQLS 245

Query: 249 KDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPLE 305
           K+F+R W++      +D   IP++ +  I   S+ YI  YE I G KF+ AD S +   +
Sbjct: 246 KEFVRRWLIENGFQGQDGQEIPEMNQEYITSVSERYIELYENILGEKFVKADISSIN--D 303

Query: 306 RIRNNLRKY 314
           RI  N+ +Y
Sbjct: 304 RIEKNVLEY 312


>gi|149276252|ref|ZP_01882396.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pedobacter sp. BAL39]
 gi|149232772|gb|EDM38147.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pedobacter sp. BAL39]
          Length = 314

 Score =  211 bits (538), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 120/305 (39%), Positives = 176/305 (57%), Gaps = 12/305 (3%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P+  N+Y GKVR+ Y ++D     + TDR+SAFD  +   IP+KG+VLNQI   +   T 
Sbjct: 12  PKQTNFYKGKVRDVYTINDEFMAMVVTDRISAFDVVLPEAIPFKGQVLNQIAAKFLTATQ 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N  L  PD  V +G+  + F +E++VRGYLAG+        Y  G+R +    LP+
Sbjct: 72  DIVPNWVLSVPDEMVTIGRICEPFKVEMVVRGYLAGHAWRE----YSAGRRSVCGVALPE 127

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            + +N +LP P+ITPTTK+S    G D+ IS  +I+ +GI++   +E + +Y L+L+ RG
Sbjct: 128 GLKENDQLPAPIITPTTKAS---VGHDEDISREDILAKGIVSLADYEQLEAYTLALYARG 184

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A   GLILVD+KYEFG    + I L DEIHTPDSSRY+  E Y++          L 
Sbjct: 185 TEMAASRGLILVDTKYEFG-KVGEEIFLIDEIHTPDSSRYFYAEGYQERQDANEPQKQLS 243

Query: 249 KDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLER 306
           K+F+R W++      +D   +P +   I+   S+ YI  YE+ITG  F   N      +R
Sbjct: 244 KEFVRKWLIENGFQGKDGQVVPVMTPEIVNSISERYIELYEQITGDTF-QKNETADVTQR 302

Query: 307 IRNNL 311
           I  N+
Sbjct: 303 IEVNV 307


>gi|288928099|ref|ZP_06421946.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           sp. oral taxon 317 str. F0108]
 gi|288330933|gb|EFC69517.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           sp. oral taxon 317 str. F0108]
          Length = 316

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 170/302 (56%), Gaps = 11/302 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y +     + +ATDR+SAFD  +   IP+KG+VLNQI   +   T+DIC N 
Sbjct: 18  YHGKVRDVYDIDGDKIVMVATDRISAFDVILPKGIPFKGQVLNQIAAKFLDLTADICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    YKNG R++    LP  M +N+
Sbjct: 78  KLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWREYKNGCRELCGVKLPGGMKENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P++TPTTK+ E   G D  IS  EII +G+++   +  +  Y   LF RG ++A +
Sbjct: 134 RFPEPIVTPTTKADE---GHDLNISKEEIIAQGLVSAEDYAVMEDYTKKLFRRGQEIAAK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
           +GLILVD+KYEFG  +   + L DEIHTPDSSRY+  E YE+   +G     L K+F+R 
Sbjct: 191 HGLILVDTKYEFG-KRDGKVYLIDEIHTPDSSRYFYAEGYEEKLAKGEPQRQLSKEFLRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I +      S  YI  YE ITG  F     E     RI  N+ 
Sbjct: 250 WLIEHNFMNEPGQTMPEITDEYAEEVSNRYIELYEHITGETFNKAADEADLAARIEKNVT 309

Query: 313 KY 314
           +Y
Sbjct: 310 EY 311


>gi|304382671|ref|ZP_07365165.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella marshii DSM 16973]
 gi|304336296|gb|EFM02538.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Prevotella marshii DSM 16973]
          Length = 316

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 124/319 (38%), Positives = 178/319 (55%), Gaps = 13/319 (4%)

Query: 1   MRILSKA--YIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLN 57
           M+ L+K   +     + Y GKVR+ Y + +   + +ATDR+SAFD  +   IPYKG+VLN
Sbjct: 1   MKALTKTDFHFKGQKSVYHGKVRDVYDIDNDLIVMVATDRISAFDVVLPKGIPYKGQVLN 60

Query: 58  QITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           QI   +   T+DIC N  +  PDP V VG + + F +E+I+R  L G    S    YKNG
Sbjct: 61  QIAAKFLDLTADICPNWKMATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWREYKNG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            R++    LPD M +N++ P P+ITPTTK+ E   G D  IS  EII +G+++   +  I
Sbjct: 117 CRELCGVRLPDGMKENERFPEPIITPTTKADE---GHDMNISKEEIIAQGLVSAEDYAVI 173

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            +Y   +F+RG ++A   GLILVD+KYEFG  +   + L DE+HTPDSSRY+  + YE+ 
Sbjct: 174 ENYTRKIFKRGQEIAAHQGLILVDTKYEFG-KRDGKVYLIDEVHTPDSSRYFYADGYEEK 232

Query: 238 FREGITPIGLDKDFIRNWILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
            ++G     L K+F+R W++     N     +P+I +      S  YI  YE ITG  F 
Sbjct: 233 LKKGEPQRQLSKEFVRQWLIDHNFMNEPGQVMPEITDTYAQSVSDRYIELYEHITGEPFN 292

Query: 296 ADNSELPPLERIRNNLRKY 314
                     RI  N+  Y
Sbjct: 293 RSTETGDIAARIHRNVSAY 311


>gi|126662346|ref|ZP_01733345.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteria bacterium BAL38]
 gi|126625725|gb|EAZ96414.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Flavobacteria bacterium BAL38]
          Length = 316

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 177/309 (57%), Gaps = 12/309 (3%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P   + Y GKVRE Y ++D   + +ATDRLSAFD  +   IPYKG++LNQI   +   TS
Sbjct: 12  PGQKSVYRGKVREVYNINDDLLVMVATDRLSAFDVVLPKGIPYKGQILNQIATKFMELTS 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N  +  PDPNV VG   + F +E+++RGYL+G+        Y  G+R +    +P+
Sbjct: 72  DIVPNWLVATPDPNVAVGHLCEPFKVEMVIRGYLSGHAARE----YAAGRRILCGVEMPE 127

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            + +N K P P+ITPTTK+   +   D+ IS   I+   I+T   +  +  Y  +L++RG
Sbjct: 128 GLKENDKFPTPIITPTTKADNGSH--DEDISREAILANRIVTEADYLILEKYTRALYQRG 185

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A   GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  E Y++          L 
Sbjct: 186 TEIAASRGLILVDTKYEFGKTKDGQIVLIDEIHTPDSSRYFYAEGYQERQNNNEEQKQLS 245

Query: 249 KDFIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPLE 305
           K+F+R W++      ++   IP++ +  I   S+ YI  +E I G KF+ AD S +   E
Sbjct: 246 KEFVRRWLIENGFQGKEGQQIPNMTDEYIETVSERYIELFENIIGEKFVKADISNIN--E 303

Query: 306 RIRNNLRKY 314
           RI  N+  Y
Sbjct: 304 RIEKNVLNY 312


>gi|149370679|ref|ZP_01890368.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [unidentified eubacterium SCB49]
 gi|149356230|gb|EDM44787.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [unidentified eubacterium SCB49]
          Length = 316

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/314 (38%), Positives = 177/314 (56%), Gaps = 16/314 (5%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P   + Y GKVR  Y L D   + +ATDRLSAFD  +   IPYKG++LNQI       T 
Sbjct: 13  PGQKSVYHGKVRSVYTLQDDILLMVATDRLSAFDVVMPKGIPYKGQILNQIATKMMRDTE 72

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           D+  N  +  PDPNV +G   + F +E+++RGY++G+        YK G+R +    +P+
Sbjct: 73  DLVPNWLIATPDPNVAIGHACEPFKVEMVIRGYMSGHAARE----YKAGRRVLCGVPMPE 128

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M +N   P P+ITP TK+       D+ I+  +II R I++   +  +  Y   LF+RG
Sbjct: 129 GMKENDAFPSPIITPATKAE--MGDHDEDIAREDIIKRNIVSEEDYLVLEDYTRKLFKRG 186

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A   GLILVD+KYEFG  K   I+L DEIHTPDSSRY+  E YE+  + G     L 
Sbjct: 187 SEIADSRGLILVDTKYEFGKTKDGKIVLIDEIHTPDSSRYFYKEGYEERQKAGEAQKQLS 246

Query: 249 KDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPP 303
           K+F+R W++   N ++      +P++ +  I   S  YI  +E ITG  F+ AD + +  
Sbjct: 247 KEFVRQWLIQ--NDFQGLEGQTVPEMTDEYIDTVSDRYIELFENITGDTFVKADVTNID- 303

Query: 304 LERIRNNLRKYTHR 317
            ERI  N+ +Y ++
Sbjct: 304 -ERIVTNVAEYFNK 316


>gi|255531762|ref|YP_003092134.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pedobacter heparinus DSM 2366]
 gi|255344746|gb|ACU04072.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Pedobacter
           heparinus DSM 2366]
          Length = 316

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 180/308 (58%), Gaps = 12/308 (3%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P+  ++Y GKVR+ Y + +     + TDR+SAFD  +   IP+KG+VLNQI   + + T 
Sbjct: 12  PKQTSFYKGKVRDVYTIDNRFMAMVVTDRISAFDVVLPEAIPFKGQVLNQIAAKFLNATK 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
           DI  N  +  PD  V +G+  + F +E++VRGYLAG+        Y  GKR +    LP+
Sbjct: 72  DIVPNWVIAVPDEMVTIGRICEPFKVEMVVRGYLAGHAWRE----YSAGKRSVCGVALPE 127

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            + +N KLP P+ITPTTK+S    G D+ IS  +I+ +GI++   +  + +Y  +L+ERG
Sbjct: 128 GLKENDKLPGPIITPTTKAS---VGHDEDISREDILAKGIVSLADYSQLENYTYALYERG 184

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A E GLILVD+KYEFG    + I L DEIHTPDSSRY+  E Y +   +      L 
Sbjct: 185 TQMAAERGLILVDTKYEFG-KVGEEIYLIDEIHTPDSSRYFYAEGYSERQEQNEPQKQLS 243

Query: 249 KDFIRNWILTRCNPYRD--NIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLER 306
           K+F+R W++      ++  +IP +   I+   +  YI  YE+ITG +F+  N +   + R
Sbjct: 244 KEFVRKWLIENGFQGKEGQSIPVMTPEIVNSIADRYIELYEQITGDRFV-KNEQADVVAR 302

Query: 307 IRNNLRKY 314
           I  N+  +
Sbjct: 303 IEKNVNGF 310


>gi|260911920|ref|ZP_05918485.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           sp. oral taxon 472 str. F0295]
 gi|260633943|gb|EEX52068.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           sp. oral taxon 472 str. F0295]
          Length = 316

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 168/302 (55%), Gaps = 11/302 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y +     + +ATDR+SAFD  +   IP+KG+VLNQI   +   T+DIC N 
Sbjct: 18  YHGKVRDVYDIDGDKIVMVATDRISAFDVILPKGIPFKGQVLNQIAAKFLDLTADICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    YK G R++    LPD M +N+
Sbjct: 78  KLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWREYKKGCRELCGVKLPDGMKENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P++TPTTK+ E   G D  IS  EII +G+++   +  +  Y   LF RG ++A +
Sbjct: 134 RFPEPIVTPTTKADE---GHDLNISKEEIIAQGLVSAEDYAVMEDYTKKLFRRGQEIAAK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
            GLILVD+KYEFG  +   + L DEIHTPDSSRY+  E YE+   +G     L K+F+R 
Sbjct: 191 QGLILVDTKYEFG-KRDGKVYLIDEIHTPDSSRYFYAEGYEEKLAKGEPQRQLSKEFLRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P+I +      S  YI  YE ITG  F     E     RI  N+ 
Sbjct: 250 WLIEHNFMNEPGQTMPEITDEYAEEVSNRYIELYEHITGETFNKAADEADLAARIEKNVT 309

Query: 313 KY 314
            +
Sbjct: 310 DF 311


>gi|124009424|ref|ZP_01694101.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Microscilla marina ATCC 23134]
 gi|123984972|gb|EAY24930.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Microscilla marina ATCC 23134]
          Length = 313

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 173/284 (60%), Gaps = 11/284 (3%)

Query: 14  NYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICS 72
           N+Y GKVR+ Y   D     IA+DR+SAFD  +   IPYKG+VLNQI+ ++   T DI  
Sbjct: 18  NFYRGKVRDVYMF-DKHLAVIASDRISAFDVILPEAIPYKGQVLNQISWFFMQQTQDIVP 76

Query: 73  NHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSD 132
           N  +D PDPNV  G +   +P+E++VRGYLAG    S    YK G R++  Y LP+ + +
Sbjct: 77  NWIIDCPDPNVAYGYKCTPYPVEMVVRGYLAG----SAWRAYKKGVREMNGYKLPEGLKE 132

Query: 133 NQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLA 192
           N  LP P+ITP+TK+++     D+ IS  +I+ +G++ +   + + +Y L+LF+RG ++A
Sbjct: 133 NDPLPQPIITPSTKAAQGEH--DEDISSEDIVKKGLVDKKTLDKLEAYTLALFQRGSEIA 190

Query: 193 LENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFI 252
            + GLIL D+KYEFG   +  I L DEIHTPDSSRY+ +E Y++  ++        K+ +
Sbjct: 191 QKQGLILADTKYEFG-HFEGKIYLIDEIHTPDSSRYFNIEGYQERQQQNQPQPQRSKEMV 249

Query: 253 RNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKF 294
           R W++      ++   IP++    I   S  YIA YE++T  KF
Sbjct: 250 RKWLMENGFNGQEGQKIPEMTPEWIAAVSSEYIALYEQLTNNKF 293


>gi|88803429|ref|ZP_01118955.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polaribacter irgensii 23-P]
 gi|88780995|gb|EAR12174.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polaribacter irgensii 23-P]
          Length = 315

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 116/310 (37%), Positives = 179/310 (57%), Gaps = 14/310 (4%)

Query: 10  PELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           P   + Y GKVRE Y ++D   + +ATDRLSAFD  +   IP+KG++LNQI     + T+
Sbjct: 12  PNQKSVYRGKVREVYNINDSLLVMVATDRLSAFDVILPKQIPFKGQILNQIATRMMNDTA 71

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            I  N  L  PD NV VGQ    F +E+++RGY++G+        Y  GKR +    +P+
Sbjct: 72  AIVPNWLLANPDENVAVGQLCTPFKVEMVIRGYMSGHAARE----YAAGKRMLCGVPMPE 127

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            + +N + P+P+ITP+TK+       D+ IS   I+ +GI+    +  + +Y  +LF +G
Sbjct: 128 GLKENDQFPFPIITPSTKADNGDH--DEDISREAILAQGIVIEADYLILENYTRALFTKG 185

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A + GLILVD+KYEFG   +  I+L DEIHTPDSSRY+  E Y++    G +   L 
Sbjct: 186 TEIAAKRGLILVDTKYEFGKTNEGEIVLIDEIHTPDSSRYFYAEGYQERQNTGGSQKQLS 245

Query: 249 KDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPL 304
           K+F+R W++   N ++      IP++ +  I+  S  YI  YE+I G  F+   +E   L
Sbjct: 246 KEFVRQWLIE--NGFQGLEGQKIPEMSDAKIIEISNRYIELYEQIVGEPFVKAATE-NVL 302

Query: 305 ERIRNNLRKY 314
           +RI  N+  +
Sbjct: 303 DRIEKNINSF 312


>gi|307565641|ref|ZP_07628119.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           amnii CRIS 21A-A]
 gi|307345673|gb|EFN91032.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Prevotella
           amnii CRIS 21A-A]
          Length = 316

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 168/302 (55%), Gaps = 11/302 (3%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVR+ Y + +   + +ATDR+SAFD  +   IP+KG+VLNQI   +   T DIC N 
Sbjct: 18  YHGKVRDVYDIDNDLIVMVATDRISAFDVVLPKGIPFKGQVLNQIASKFLDQTKDICPNW 77

Query: 75  TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQ 134
            L  PDP V VG + + F +E+I+R  L G    S    Y+ G R+I    LPD M +N+
Sbjct: 78  KLATPDPMVTVGLKCEGFRVEMIIRSILTG----SAWREYQKGCREICGVKLPDGMRENE 133

Query: 135 KLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALE 194
           + P P+ITPTTK+ E   G D  IS  EII +GI++   +  I  +   +F RG ++A +
Sbjct: 134 RFPEPIITPTTKADE---GHDMNISREEIIAQGIVSEEDYNIIEEWTRKIFARGQEIAAK 190

Query: 195 NGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
           +GLILVD+KYEFG  +     L DE+HTPDSSRY+  E YE+  ++G     L K+F+R 
Sbjct: 191 HGLILVDTKYEFG-KRNGQCYLIDEVHTPDSSRYFYAEGYEEKLKKGEPQRQLSKEFVRQ 249

Query: 255 WILTR--CNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIRNNLR 312
           W++     N     +P I +      S  YI  YE ITG  F           RI  N++
Sbjct: 250 WLIDHNFMNEPGQTMPYISDEYAESVSNRYIELYEHITGEPFKKQEYTGDIARRIEENVK 309

Query: 313 KY 314
            Y
Sbjct: 310 DY 311


>gi|332668147|ref|YP_004450935.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haliscomenobacter hydrossis DSM 1100]
 gi|332336961|gb|AEE54062.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haliscomenobacter hydrossis DSM 1100]
          Length = 317

 Score =  206 bits (523), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 118/313 (37%), Positives = 179/313 (57%), Gaps = 15/313 (4%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           +P    +Y GKVR+ Y L +   + +A+DR+SAFD  +   IPYKG+VLNQI  ++   T
Sbjct: 16  LPGQTAFYRGKVRDVYTLGE-QLLMVASDRISAFDYVLPRPIPYKGQVLNQIAAHFLKAT 74

Query: 68  SDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           +DI  N     PDPNV +G   + F +E+++R YL G++       Y  G+R +    LP
Sbjct: 75  ADIVPNWLQATPDPNVAIGHACEPFRVEMVIRAYLVGHSA----RVYAIGERSLCGISLP 130

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
           + + +N   P P+ITP TK+ E   G D+ IS  +II +GI+    +  + +Y  +LF+R
Sbjct: 131 EGLRENDPFPTPIITPATKAEE---GHDEGISREDIIAKGIVAEADYIQLETYTRALFQR 187

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A + GLILVD+KYEFG  K   I + DEIHTPDSSRY+ +E Y +   +G     L
Sbjct: 188 GTEMAAKQGLILVDTKYEFG-KKDGQIYVIDEIHTPDSSRYFYLEGYAERQAKGERQKQL 246

Query: 248 DKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKFI-ADNSELPPL 304
            K+F+R W++      +    IP + +  +   S  YI  YE+ITG  F+ AD + +   
Sbjct: 247 SKEFVREWLIENGFQGKPGQTIPAMSDEFVWEISNRYIELYERITGTAFVKADTANIA-- 304

Query: 305 ERIRNNLRKYTHR 317
           ERI  N+  +  +
Sbjct: 305 ERIYQNVLAWMEK 317


>gi|297184141|gb|ADI20260.1| hypothetical protein [uncultured Sphingobacterium sp. EB080_L08E11]
          Length = 316

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 175/306 (57%), Gaps = 10/306 (3%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L ++Y GKVR+ Y +     + +A++R+SAFD  +   IP KG+VLNQI +++   T DI
Sbjct: 12  LTHFYRGKVRDVYTIGRDVLVMVASNRISAFDVVLPRPIPGKGQVLNQIAEHFLEATKDI 71

Query: 71  CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNM 130
             N  L  PD  V +G + + F +E+++RGYLAG+   +    YK+G R++    LP+ M
Sbjct: 72  VPNWRLATPDAQVTIGHRAEPFKVEMVIRGYLAGHAART----YKSGIRELCGVTLPEGM 127

Query: 131 SDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCK 190
            +N   P P+ITP TK+   A   D+ IS   II +GI++   +  +  Y  +LF+RG +
Sbjct: 128 KENGAFPEPIITPATKAEHGAH--DEDISREAIITKGIVSEADYILLEQYTRALFKRGSE 185

Query: 191 LALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKD 250
           +A E GLILVD+KYEFG      I+L DEIHTPDSSRY+  E Y +   +      L K+
Sbjct: 186 MAAERGLILVDTKYEFGKLADGTIVLIDEIHTPDSSRYFYAEGYGERQNKNEPQRQLSKE 245

Query: 251 FIRNWILTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERIR 308
           F+R W++      ++   +P++ ++ +   S  Y   +EKITG  F   + E     RI+
Sbjct: 246 FVREWLMENGFQGQNGQEVPEMTDDFVQLVSNRYQELFEKITGKPFQKVSDEGAEA-RIK 304

Query: 309 NNLRKY 314
            N+  Y
Sbjct: 305 RNVENY 310


>gi|115372703|ref|ZP_01460009.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stigmatella aurantiaca DW4/3-1]
 gi|115370184|gb|EAU69113.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stigmatella aurantiaca DW4/3-1]
          Length = 255

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/259 (39%), Positives = 142/259 (54%), Gaps = 10/259 (3%)

Query: 55  VLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           +LN++  +WF  T  I  NH LD PD NV V +  Q F +E++VRGYL G    SL   Y
Sbjct: 1   MLNRLATFWFERTRHIVPNHVLDVPDANVTVARACQPFALEMVVRGYLTG----SLWRDY 56

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           + G    Y    P  +  +++ P P+ITP+TK+       D PIS  EI+ RG+ +   W
Sbjct: 57  QKGTHTAYGLPFPAGLRKDERFPMPLITPSTKAEYGQH--DAPISEAEILARGLASPRDW 114

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +S  AL LF  G + A E GLILVD+KYEFG      + + DE+HTPDSSRYW  E Y
Sbjct: 115 SRLSEAALGLFAEGQRQARERGLILVDTKYEFG-KVGNELYVIDEMHTPDSSRYWVAEEY 173

Query: 235 EKSFREGITPIGLDKDFIRNWIL-TRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLK 293
           E  F +G     LDK+ IR W++  R        P IP+ + +  +  Y++AYE++TG  
Sbjct: 174 EARFAKGEDQQMLDKENIRQWLIRERGFSGEGTPPPIPDEVRVELAVKYLSAYERLTGNS 233

Query: 294 FIADNSELPPLERIRNNLR 312
              +  ++    RI  NLR
Sbjct: 234 LRLEPGDV--HARIEKNLR 250


>gi|256827577|ref|YP_003151536.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cryptobacterium curtum DSM 15641]
 gi|256583720|gb|ACU94854.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cryptobacterium curtum DSM 15641]
          Length = 290

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 171/301 (56%), Gaps = 34/301 (11%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSD 69
           EL     GKVR+ Y L D   + +ATDR+SAFD  +   IPYKG+VL Q++++WF   +D
Sbjct: 5   ELKPDAQGKVRDLYDLGD-KLLLVATDRISAFDYVLEDEIPYKGKVLTQLSRFWFDLLAD 63

Query: 70  ICSNHTL---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           I  NH +               +Y D   ++ ++ QM+P+E IVRGYL G   + L ++ 
Sbjct: 64  IVDNHVISTDVADLPDEFKPYEEYLDGRFMLVRKAQMYPVECIVRGYLTG---SGLASYR 120

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           KNG   +    LP+ ++++ KLP  + TP+TK+     G D+ IS +  +   ++     
Sbjct: 121 KNG--TVCGIQLPEGLTESSKLPTALFTPSTKA--EIGGHDENISFDTTVD--LVGEQAA 174

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFG-IDKKQNIILADEIHTPDSSRYWEVET 233
            T+    L+++E+    A + G+I+ D+K+EFG +D K  +ILADE+ TPDSSR+W   T
Sbjct: 175 TTLRDLTLAVYEKAADHAAQQGIIIADTKFEFGVVDGK--VILADEVLTPDSSRFWAAAT 232

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLK 293
           Y    REG      DK F+RNW+    +    N P +PE+++ +TS+ YI AYE ITG  
Sbjct: 233 Y----REGEVQPSFDKQFVRNWLNANWD-RSGNPPHLPEDVVQKTSEKYIQAYELITGTS 287

Query: 294 F 294
           F
Sbjct: 288 F 288


>gi|319796439|ref|YP_004158079.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Variovorax paradoxus EPS]
 gi|315598902|gb|ADU39968.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Variovorax paradoxus EPS]
          Length = 301

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 171/310 (55%), Gaps = 28/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  +  + I  LP    GKVR+NY + +   + +A+DRLSAFD  +   IP KGE+L Q+
Sbjct: 1   MTTVHTSSIQSLPLLARGKVRDNYAVGEDRILMVASDRLSAFDVIMGEPIPGKGEILTQM 60

Query: 60  TQYWFHHTSDICSNH-TLDYPD--------PNV----LVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +C NH T D P+        P V    ++ ++L   P+E +VRGYLAG  
Sbjct: 61  ALWWFERLGQLCPNHLTGDAPESVVTAEEVPQVTQRSMLVKRLTPIPVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
             S    Y+   R +    LP+ +++  KLP P+ TP  K++  A   D+ IS + ++  
Sbjct: 119 --SGWKEYQE-SRSVCGVPLPEGLTNASKLPRPIFTPAAKAA--AGEHDENISYDRVVE- 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+     + I   +++++E   ++AL  G+I+ D+K+EFG+D+   ++L DE+ TPDSS
Sbjct: 173 -IVGPKLAQQIRETSIAIYETAAQIALTKGMIIADTKFEFGLDEAGTLVLMDEVLTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWI-LTRCN--PYRDN--IPDIPENIILRTSQT 281
           RYW VE YE +   G  P   DK F+R+W+  T+ N  P+      P +P  +I +T+  
Sbjct: 232 RYWPVEGYEAALAAGTNPPSYDKQFVRDWLEATKINGKPWDKTPPAPRLPAEVIEKTAAK 291

Query: 282 YIAAYEKITG 291
           Y  A E++TG
Sbjct: 292 YREALERLTG 301


>gi|333025579|ref|ZP_08453643.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. Tu6071]
 gi|332745431|gb|EGJ75872.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. Tu6071]
          Length = 299

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 106/301 (35%), Positives = 164/301 (54%), Gaps = 30/301 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  + +A+DRLSA+D  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRDLYRNEAGELVMVASDRLSAYDWVLPSEIPDKGRVLTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH L    P           LV + L M P+E + RGYL G    S L  Y N  
Sbjct: 73  ADLVPNHVLSTKLPEGAPASWAGRTLVCRSLDMIPVEAVARGYLTG----SGLVEY-NAS 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETI 177
           R +    LP+ + D  +LP P+ TP TK+       D+ +S  E+  R G  T  Q   +
Sbjct: 128 RTVCGLALPEGLEDGSELPGPIFTPATKAE--VGEHDENVSYEEVARRVGAETAAQ---L 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ RG  +A E G+IL D+K+EFG D ++ ++LADE+ TPDSSR+W  +++E  
Sbjct: 183 RQTTLAVYARGRDIARERGIILADTKFEFGFDGEE-LVLADEVLTPDSSRFWPADSWEP- 240

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLK 293
              G      DK F+R+W+ +  + +        P++P  I+ RT   Y+ AYEK+TG++
Sbjct: 241 ---GHAQPSFDKQFVRDWLTSPVSGWDRKSEQPPPELPAEIVERTRAKYVEAYEKLTGVR 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|239818054|ref|YP_002946964.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Variovorax paradoxus S110]
 gi|239804631|gb|ACS21698.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Variovorax paradoxus S110]
          Length = 301

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 107/310 (34%), Positives = 170/310 (54%), Gaps = 28/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  +  + I  LP    GKVR+NY + +   + +A+DRLSAFD  +   IP KGE+L Q+
Sbjct: 1   MTTVHTSSIQSLPLLARGKVRDNYAVGEDRILMVASDRLSAFDVIMGEPIPGKGEILTQM 60

Query: 60  TQYWFHHTSDICSNH-TLDYPD--------PNV----LVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +C NH T + P+        P V    ++ ++L   P+E +VRGYLAG  
Sbjct: 61  ALWWFDRLGQLCPNHLTGEAPESVVTPEEVPQVTGRSMLVKRLTPIPVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
             S    Y+   R +    LP+ +++  KLP P+ TP  K++  A   D+ IS + ++  
Sbjct: 119 --SGWKEYQE-SRSVCGVPLPEGLTNASKLPRPIFTPAAKAA--AGEHDENISYDRVVE- 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+     + I   +L ++E   ++AL  G+I+ D+K+EFG+D+   ++L DE+ TPDSS
Sbjct: 173 -IVGPKLAQQIRETSLEIYETAAQIALGKGMIIADTKFEFGLDEAGTLVLMDEVLTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWI-LTRCN--PYRDN--IPDIPENIILRTSQT 281
           RYW VE Y+ +   G  P   DK F+R+W+  T+ N  P+      P +P  +I +T+  
Sbjct: 232 RYWPVEGYQAALAAGANPPSYDKQFVRDWLEATKINGKPWDKTPPAPRLPAEVIEKTAAK 291

Query: 282 YIAAYEKITG 291
           Y  A E++TG
Sbjct: 292 YREALERLTG 301


>gi|296268162|ref|YP_003650794.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Thermobispora bispora DSM 43833]
 gi|296090949|gb|ADG86901.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Thermobispora bispora DSM 43833]
          Length = 283

 Score =  179 bits (453), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 166/291 (57%), Gaps = 23/291 (7%)

Query: 14  NYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICS 72
           + +SGKVR+ Y   DG  + +A+DR+SAFD  +   IP KG++L Q++ +WF   +DI  
Sbjct: 4   HLHSGKVRDLYETEDGLLLMVASDRISAFDHVLQPEIPDKGKILTQLSLWWFDQLADIVP 63

Query: 73  NHTLDYPDPNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           NH +    P    G+     +L+M P+E + RGYLAG   + L  + K+G   I    LP
Sbjct: 64  NHVVSTDVPPEYAGRAVLCRKLRMVPVECVARGYLAG---SGLTDYRKDGA--ISGVPLP 118

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
             +++  +LP P+ TP+TK+ +     D+P++ +E++    + +   E +    L+++ER
Sbjct: 119 PGLTEGSRLPEPIFTPSTKAPKGEH--DRPMTFDEVVAE--VGQEVAEELRRITLAVYER 174

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E G+IL D+K E G D+   + L DE+ TPDSSR+W +      ++ G      
Sbjct: 175 GARIAAERGIILADTKIELGWDENGVLTLGDEVLTPDSSRFWPL----GEWKPGRPQPSF 230

Query: 248 DKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
           DK F+R+W+L+  + +        P +P+ ++ RT + YI AYE +TG +F
Sbjct: 231 DKQFVRDWLLSPESGWDRASGAAPPPLPDEVVARTRERYIQAYELLTGRRF 281


>gi|302520700|ref|ZP_07273042.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. SPB78]
 gi|318061655|ref|ZP_07980376.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. SA3_actG]
 gi|318076897|ref|ZP_07984229.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. SA3_actF]
 gi|302429595|gb|EFL01411.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. SPB78]
          Length = 299

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 106/301 (35%), Positives = 164/301 (54%), Gaps = 30/301 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  + +A+DRLSA+D  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRDLYRNEAGELVMVASDRLSAYDWVLPSEIPDKGRVLTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH L    P           LV + L M P+E + RGYL G    S L  Y N  
Sbjct: 73  ADLVPNHVLSTKLPEGAPASWAGRTLVCRSLDMIPVEAVARGYLTG----SGLVEY-NES 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETI 177
           R +    LP+ + D  +LP P+ TP TK+       D+ +S  E+  R G  T  Q   +
Sbjct: 128 RTVCGLALPEGLEDGSELPGPIFTPATKAE--VGEHDENVSYEEVARRVGAETAAQ---L 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ RG  +A E G+IL D+K+EFG D ++ ++LADE+ TPDSSR+W  +++E  
Sbjct: 183 RQTTLAVYARGRDIARERGIILADTKFEFGFDGEE-LVLADEVLTPDSSRFWPADSWEP- 240

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLK 293
              G      DK F+R+W+ +  + +        P++P  I+ RT   Y+ AYEK+TG++
Sbjct: 241 ---GHAQPSFDKQFVRDWLTSPASGWDRKSEQPPPELPAEIVERTRAKYVEAYEKLTGVR 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|295395679|ref|ZP_06805871.1| phosphoribosylamine-glycine ligase [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294971495|gb|EFG47378.1| phosphoribosylamine-glycine ligase [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 751

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 105/305 (34%), Positives = 166/305 (54%), Gaps = 33/305 (10%)

Query: 10  PELPNY---YSGKVRENYF------LSDGTRI-TIATDRLSAFDQNIAC-IPYKGEVLNQ 58
           P++P +   YSGKVR+ Y       + D  R+  +A+DR+SA+D  I   IP KG+VL  
Sbjct: 458 PQVPGWTHVYSGKVRDLYIPVEATNMDDADRLLMVASDRISAYDHVIPTPIPDKGKVLTG 517

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVGQQ-----LQMFPIELIVRGYLAGNTKTSLLTF 113
           +T +WF   +D+  NH L    P  + G+      L+MFP+E + RG+L G   + L  +
Sbjct: 518 LTAWWFDQVTDLVGNHVLTVDVPAEVAGRGMIVKPLRMFPVECVARGHLTG---SGLKDY 574

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
            + G   +    LP+ + +  KL   + TP TK+       D+ I+ ++ +   +L  + 
Sbjct: 575 QRTGA--VCGNELPEGLGEASKLEPAIFTPATKAE--LGDHDENITFDQTVK--LLGDSD 628

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
            E + S  L+LFER   +A E G+IL D+K+EFG+D    I+L DE+ TPDSSR+W+ E 
Sbjct: 629 AEALKSLTLALFERARSIAAERGIILADTKFEFGLDFTDQIVLGDEVLTPDSSRFWDAE- 687

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKI 289
               F EG +    DK F+R+W+ +  + +  +     P +P  ++  T   YI A+EK+
Sbjct: 688 ---GFVEGQSQPSFDKQFVRDWLTSEESGWDKDSGMAPPQLPTQVVEATRARYIEAFEKL 744

Query: 290 TGLKF 294
           TG KF
Sbjct: 745 TGRKF 749


>gi|295837595|ref|ZP_06824528.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Streptomyces sp. SPB74]
 gi|197698320|gb|EDY45253.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Streptomyces sp. SPB74]
          Length = 299

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 104/301 (34%), Positives = 165/301 (54%), Gaps = 30/301 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  + +A+DRLSA+D  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRDLYRNEAGELVMVASDRLSAYDWVLPSEIPDKGRVLTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH L    P           LV + L M P+E + RGYL G   + L+ + ++  
Sbjct: 73  ADLVPNHVLSTRLPEGAPASWAGRTLVCRSLDMIPVEAVARGYLTG---SGLVEYERS-- 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETI 177
           R +    LP+ ++D  +LP P+ TP TK+       D+ +S  E+  R G  T  Q   +
Sbjct: 128 RTVCGLALPEGLADGSELPGPIFTPATKAEVGEH--DENVSYEEVARRIGSETAAQ---L 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ RG  +A E G+IL D+K+EFG D  + ++LADE+ TPDSSR+W  +++E  
Sbjct: 183 RQTTLAVYGRGRDIARERGIILADTKFEFGFDGDE-LVLADEVLTPDSSRFWPADSWEP- 240

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLK 293
              G      DK F+R+W+ +  + +        P +P  I+ RT   YI AYEK+TG++
Sbjct: 241 ---GRAQPSFDKQFVRDWLTSPASGWDRKSEQPPPGLPAEIVERTRAKYIEAYEKLTGVR 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|218514295|ref|ZP_03511135.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium
           etli 8C-3]
          Length = 117

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 78/117 (66%), Positives = 95/117 (81%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           MRILS+A+ PELPNYY GKVRENY L DG RI I+TDRLSAFD+ + CIPYKG+VL Q  
Sbjct: 1   MRILSEAHFPELPNYYRGKVRENYDLPDGHRIIISTDRLSAFDRILTCIPYKGQVLTQTA 60

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           +YWF  T DIC NH +DYPDPNV++G++L + P+E++VRGYLAG T TS+LT YK G
Sbjct: 61  RYWFEATKDICPNHVIDYPDPNVVIGKRLDILPVEIVVRGYLAGTTGTSILTLYKKG 117


>gi|237784986|ref|YP_002905691.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium kroppenstedtii DSM 44385]
 gi|237757898|gb|ACR17148.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Corynebacterium kroppenstedtii DSM 44385]
          Length = 311

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 110/306 (35%), Positives = 166/306 (54%), Gaps = 32/306 (10%)

Query: 6   KAYIPELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQ 61
           +A  PEL +Y    +GKVRENY + D T + +A+DR+SAFD  +   IP KG +L  ++ 
Sbjct: 13  RAMRPELSSYEHLSAGKVRENYEIDDDTLLMVASDRVSAFDYILDTQIPDKGRILTAMST 72

Query: 62  YWFHHTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLT 112
           ++F        NH +   D            LV ++L+M P E + RGYL G   + L  
Sbjct: 73  FFFEQLD--MPNHLVGPVDDERIPEETLGRALVCEKLKMIPFECVARGYLTG---SGLKE 127

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRN 172
           + + G+    E  LP+ + +  KLP P+ TP TK+   +   D+ +  + ++    L   
Sbjct: 128 YNETGRVCGIE--LPEGLVEGSKLPEPIFTPATKAEFGSH--DENVDYDYVLEH--LGER 181

Query: 173 QWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVE 232
           + ETI   ALSL+ +   +A E GLIL D+K+EFG+D   N+ LADE+ TPDSSRYW  E
Sbjct: 182 RSETIRDAALSLYSQAAAIAEEGGLILADTKFEFGVDADGNVKLADEVLTPDSSRYWPKE 241

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEK 288
            Y    REG      DK ++RNW++   + +        P +P +I+  T   Y+ AYE+
Sbjct: 242 GY----REGHRQPSFDKQYLRNWLIGPKSGWSRESGVQPPALPGSIVEATRDKYVEAYER 297

Query: 289 ITGLKF 294
           ++GLKF
Sbjct: 298 VSGLKF 303


>gi|311744578|ref|ZP_07718378.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Aeromicrobium marinum DSM 15272]
 gi|311312197|gb|EFQ82114.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Aeromicrobium marinum DSM 15272]
          Length = 287

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 102/298 (34%), Positives = 161/298 (54%), Gaps = 28/298 (9%)

Query: 11  ELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHH 66
           +LP Y   +SGKVR+ Y    G  + +A+DR+SAFD  +   IP KGE+L +++ +WF  
Sbjct: 4   DLPGYTHTHSGKVRDLYTDESGRLLMVASDRISAFDVVLEPGIPDKGEILTRMSLWWFEQ 63

Query: 67  TSDICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
            +D+  NH +    P  + G     + L MFP+E + RGYL G   + L+ +   G+  +
Sbjct: 64  LTDLVPNHVVSTDVPAAVSGRAVVCENLAMFPVECVARGYLTG---SGLIDYRATGE--V 118

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LP  + D   LP P+ TP TK++      D+ +S + ++    +      T+    
Sbjct: 119 CGVALPAGLVDGSPLPAPIFTPATKAAVGEH--DENVSYDAVV--ATIGAASAATLRDLT 174

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           LS++ R   +A E G+IL D+K+EFG      ++LADE+ TPDSSR+W  + +E     G
Sbjct: 175 LSIYRRAEMIARERGIILADTKFEFGARPDGTVVLADEVLTPDSSRFWPADDHEP----G 230

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPD-----IPENIILRTSQTYIAAYEKITGLKF 294
                 DK F+RNW+L+  + + D   D     +P  I+ RT Q Y+ AYE++TG +F
Sbjct: 231 RAQASFDKQFVRNWLLSAASGW-DRAGDEPPPPLPPEIVDRTRQRYVEAYERLTGERF 287


>gi|312898670|ref|ZP_07758060.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Megasphaera micronuciformis F0359]
 gi|310620589|gb|EFQ04159.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Megasphaera micronuciformis F0359]
          Length = 298

 Score =  172 bits (435), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 113/312 (36%), Positives = 169/312 (54%), Gaps = 39/312 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQIT 60
           R++ K Y P    Y SGKVRE Y   D   I +ATDR+SAFD  +   I +KG VL Q++
Sbjct: 5   RLVMKEYKP----YKSGKVREVYDAGDSI-IMVATDRISAFDHILKNRITHKGAVLTQMS 59

Query: 61  QYWFHHTSDICSNHTL-----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTK 107
           ++WF  TSDI  NH +     D P+           +  ++L M P+E IVRGY+ G+  
Sbjct: 60  KFWFDFTSDILPNHMISVNTDDMPEFFRTEEFKGKSMKCRKLTMLPLECIVRGYITGSGW 119

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNE---II 164
            S   + KNG   +    LPD + ++Q+LP P+ TP+TK+       D+ +S  E   ++
Sbjct: 120 AS---YQKNGT--VCGIKLPDGLQESQQLPEPIFTPSTKAE--LGDHDENVSFEESIDVL 172

Query: 165 HRGI--LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHT 222
            +      R   E +  Y ++L+++    A   G+I+ D+K+EFGID    ++L DE+ T
Sbjct: 173 EKAFPGKGREYAEKVRDYTIALYKKCADYARTRGIIIADTKFEFGIDDAGRVVLGDEMLT 232

Query: 223 PDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTY 282
           PDSSR+W  E Y      G      DK F+R+W+    NP  D +  +P+++I +T   Y
Sbjct: 233 PDSSRFWPSEGYAP----GKAQPSYDKQFVRDWLT--ANPDSDYL--LPDDVIKKTIAKY 284

Query: 283 IAAYEKITGLKF 294
           I AYE +TG KF
Sbjct: 285 IEAYELLTGEKF 296


>gi|239980937|ref|ZP_04703461.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces albus J1074]
 gi|291452800|ref|ZP_06592190.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces albus J1074]
 gi|291355749|gb|EFE82651.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces albus J1074]
          Length = 300

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 101/300 (33%), Positives = 159/300 (53%), Gaps = 27/300 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRDLYQNEAGDLVMVASDRISAYDWVLPTEIPDKGRVLTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH L    P           LV + L+M P+E + RGYL G    S L  Y+   
Sbjct: 73  ADLVPNHVLSTTLPEGAPADWKGRTLVCKSLEMAPVECVARGYLTG----SGLVEYEE-S 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP  + +  +LP  + TP TK++      D+ +S  E+    ++       + 
Sbjct: 128 RTVCGLALPPGLVNGSELPAAIFTPATKAA--VGDHDENVSYEEVAR--LVGPETAAELR 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L+++ R   +A E GLIL D+K+EFG D    +ILADE+ TPDSSRYW  +T+E   
Sbjct: 184 QTTLAVYSRALDVARERGLILADTKFEFGHDADGTLILADEVLTPDSSRYWPADTWEP-- 241

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGLKF 294
             G      DK F+R+W+ +  + +  +     P +PE ++ RT   YI AYE++TG+ +
Sbjct: 242 --GRAQPSFDKQFVRDWLTSEASGWDRHAEQPPPALPEEVVDRTRAKYIEAYERLTGVSW 299


>gi|302531063|ref|ZP_07283405.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. AA4]
 gi|302439958|gb|EFL11774.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. AA4]
          Length = 293

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 163/299 (54%), Gaps = 26/299 (8%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + + P   +GKVR+ Y + D   + + +DR+SA+D  +   IP KG VL  ++ +WF   
Sbjct: 4   LADYPKIAAGKVRDLYAVGDDHLLLVTSDRISAYDFILDTPIPDKGRVLTAMSVFWFEQL 63

Query: 68  SDICSNHTLDYPDPNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
           SD+  NH + Y DP +        L+ ++L M P+E + RGYL G+  +    + + G  
Sbjct: 64  SDLIPNHLVAYDDPRIPAEVRGRALLVRRLDMLPVEAVARGYLTGSGYSD---YQRTGAV 120

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
              E  LP+ + +  KLP P+ TP TK++      D+ +S + ++    +   + E +  
Sbjct: 121 CGVE--LPEGLVEASKLPSPIFTPATKAAFGEH--DENVSFDAVV--ATIGAKRAEELRE 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L+++ RG ++A + G++L D+K+EFG+D+   ++LADE+ TPDSSRYW  E YE    
Sbjct: 175 ATLAVYRRGAEVAAKRGILLADTKFEFGVDETGALVLADEVLTPDSSRYWPAEGYEP--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPY--RDNI--PDIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++RNW+    + +    N+  P +P  ++  T   Y+ AYE++TGL  
Sbjct: 232 -GRVQPSFDKQYVRNWLTGPESGWDRASNVQPPPLPSEVVEATRGRYVEAYERMTGLSL 289


>gi|257413927|ref|ZP_05591846.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Roseburia
           intestinalis L1-82]
 gi|257201792|gb|EEV00077.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Roseburia
           intestinalis L1-82]
          Length = 304

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 111/312 (35%), Positives = 174/312 (55%), Gaps = 39/312 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
           R+ SK + P       GKVRE Y   D + I +ATDR+SAFD  +   +  KG +L Q++
Sbjct: 12  RMSSKVFQP----IKEGKVREVYDNGD-SLIIVATDRISAFDHILKNKVTKKGAILTQMS 66

Query: 61  QYWFHHTSDICSNHTL-----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           ++WF  T DI  NH +     D P        D N ++ ++L+M PIE IVRGY+ G+  
Sbjct: 67  KFWFDLTKDIVPNHMISVDVKDMPEFFQEERFDGNSMMCKKLEMLPIECIVRGYITGSGW 126

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS---PNEII 164
            S   + +NG   +    LP+ + ++ KLP P+ TP+TK+       D+ IS     EI+
Sbjct: 127 ES---YKENGT--VCGIKLPEGLQESDKLPEPIFTPSTKAEIGLH--DENISFERCREIL 179

Query: 165 HRGILTRNQ--WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHT 222
            +    +     E I  Y ++L+++  + AL  G+I+ D+K+EFG+D+  N++L DE+ T
Sbjct: 180 EKEYPGKGASYAEQIKDYTIALYKKCAEYALTKGIIIADTKFEFGLDENGNVVLGDEMLT 239

Query: 223 PDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTY 282
           PDSSR+W +E Y    + G      DK F+R+W+  + NP  D +  +P+++I +T   Y
Sbjct: 240 PDSSRFWSLEGY----KPGQGQPSFDKQFVRDWL--KANPDSDYL--LPDDVIEKTVNKY 291

Query: 283 IAAYEKITGLKF 294
             AYE +TG KF
Sbjct: 292 KEAYELLTGKKF 303


>gi|311112173|ref|YP_003983395.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase [Rothia
           dentocariosa ATCC 17931]
 gi|310943667|gb|ADP39961.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase [Rothia
           dentocariosa ATCC 17931]
          Length = 308

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 112/314 (35%), Positives = 168/314 (53%), Gaps = 43/314 (13%)

Query: 9   IPELPNYYSGKVRENYF------------LSD------GTRITIATDRLSAFDQNIAC-I 49
           IP   + YSGKVR+ Y             +SD      G+ + +A+DR+SAFD+ +   I
Sbjct: 10  IPGWTHVYSGKVRDLYVPEESRYDAAGLTVSDDAEIRAGSVMVVASDRISAFDKILPTEI 69

Query: 50  PYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAG 104
           P KG++L Q++ +WF   S I  NH +    P  + G     + L MFP+E IVRGYL G
Sbjct: 70  PDKGKILTQMSLWWFQQLSHI-PNHVISTDVPESVAGRAMICKSLNMFPVECIVRGYLTG 128

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEI- 163
               S LT Y++    +    LP  + D  +L  P+ TPT K+       D+P++  E+ 
Sbjct: 129 ----SGLTSYRD-TGSVAGIELPAGLVDGSRLETPIFTPTGKAE--VGQHDEPVTREELY 181

Query: 164 IHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDK-KQNIILADEIHT 222
              G    N+ E +S   L L+    K+A E G+IL D+K EFG D  +  I L DE+ T
Sbjct: 182 AEVGHAIGNRLEELS---LELYSTAEKIAREQGIILADTKVEFGTDSYRGEITLGDELLT 238

Query: 223 PDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQ 280
           PDSSR+W+   YE     G +    DK F+R+W+ +  + +   DN+P +PE+++ +T  
Sbjct: 239 PDSSRFWDASEYEP----GKSQPSFDKQFVRDWLRSPESGWDGSDNVPHLPEDVVEKTRA 294

Query: 281 TYIAAYEKITGLKF 294
            Y+ AYE++TG KF
Sbjct: 295 RYVEAYERLTGTKF 308


>gi|291540070|emb|CBL13181.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Roseburia
           intestinalis XB6B4]
          Length = 304

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 111/312 (35%), Positives = 174/312 (55%), Gaps = 39/312 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
           R+ SK + P       GKVRE Y   D + I +ATDR+SAFD  +   +  KG +L Q++
Sbjct: 12  RMSSKVFQP----IKEGKVREVYDNGD-SLIIVATDRISAFDHILKNKVTKKGAILTQMS 66

Query: 61  QYWFHHTSDICSNHTL-----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTK 107
           ++WF  T DI  NH +     D P        D N ++ ++L+M PIE IVRGY+ G+  
Sbjct: 67  KFWFDLTKDIVPNHMISVDVKDMPEFFQEERFDGNSMMCKKLEMLPIECIVRGYITGSGW 126

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS---PNEII 164
            S   + +NG   +    LP+ + ++ KLP P+ TP+TK+       D+ IS     EI+
Sbjct: 127 ES---YKENGT--VCGIKLPEGLQESDKLPEPIFTPSTKAEIGLH--DENISFERCREIL 179

Query: 165 HRGILTRNQ--WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHT 222
            +    +     E I  Y ++L+++  + AL  G+I+ D+K+EFG+D+  N++L DE+ T
Sbjct: 180 EKEYPGKGASYAEQIKDYTIALYKKCAEYALTKGIIIADTKFEFGLDENGNVVLGDEMLT 239

Query: 223 PDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTY 282
           PDSSR+W +E Y    + G      DK F+R+W+  + NP  D +  +P+++I +T   Y
Sbjct: 240 PDSSRFWPLEGY----KPGQGQPSFDKQFVRDWL--KANPDSDYL--LPDDVIEKTVNKY 291

Query: 283 IAAYEKITGLKF 294
             AYE +TG KF
Sbjct: 292 KEAYELLTGKKF 303


>gi|319942515|ref|ZP_08016825.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sutterella wadsworthensis 3_1_45B]
 gi|319803918|gb|EFW00836.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sutterella wadsworthensis 3_1_45B]
          Length = 297

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 156/305 (51%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  LSK++IP L   YSGKVR+ Y + +   + +A+DR+SAFD  +   IP KG+VL  +
Sbjct: 1   MSGLSKSHIPSLKQIYSGKVRDCYAVGEDKLLLVASDRISAFDVILGDPIPGKGKVLTAL 60

Query: 60  TQYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           T +WF    D+  NH              +D      +V ++L+   IE + RGY+ G  
Sbjct: 61  TNFWFEKLKDVIPNHLTGIAPESVVKPEEVDQVKGRAVVSKRLKPILIECVARGYIIGGG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
               L        K+    LP  +   QKLP P+ TP  K+       D+ I    ++  
Sbjct: 121 WKDYLA-----TGKVCGVELPAGLKQAQKLPEPIFTPAAKAELGTH--DENIPYERVVE- 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            +       TI +  L L++R  + AL  G+I+ D+K+EFG+D   N++L DE+ TPDSS
Sbjct: 173 -MYGEKVASTIRNATLELYKRAAEYALTRGIIIADTKFEFGLDDDGNVLLMDEVLTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  ++YE     G +P   DK +IR+W+ T+        P +PE +I +T+  Y  A 
Sbjct: 232 RFWPADSYEV----GTSPKSFDKQYIRDWLETQPWNKTPPAPKLPEEVIEKTADKYREAL 287

Query: 287 EKITG 291
            ++TG
Sbjct: 288 RRLTG 292


>gi|320532946|ref|ZP_08033706.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320134840|gb|EFW27028.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 316

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 99/302 (32%), Positives = 169/302 (55%), Gaps = 33/302 (10%)

Query: 10  PELPNY---YSGKVRENYF-LSDGTRI------TIATDRLSAFDQNIAC-IPYKGEVLNQ 58
           P +P +    SGKVR+ Y   SDG  +       +A+DR+SA+D  +A  IP KG+VL  
Sbjct: 22  PAVPGWEHRSSGKVRDVYAPSSDGPWVGQDVLLVVASDRISAYDHILATPIPDKGKVLTA 81

Query: 59  ITQYWFHHTSDICSNH--TLDYPD---PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTF 113
           ++ +WF   +D+   H  +LD P       ++ ++L+M+P+E + RGYL G    S L  
Sbjct: 82  LSAWWFERLADVVPGHLVSLDVPAQVAGRAMICRRLEMYPVECVARGYLTG----SGLAE 137

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
           Y+ G R + +  LP+ +++  +LP P+ TP  K+       D+ +S   +I   ++  + 
Sbjct: 138 YR-GSRSVCDVALPEGLTEASRLPEPIFTPAAKAELGEH--DENVSFERVIQ--MVGESA 192

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
              +    L+L+ R  ++A + G+IL D+K+E G D   N++L DE+ TPDSSR+W  + 
Sbjct: 193 ATALRETTLALYSRAAEIARDRGIILADTKFELGTDAGGNLVLGDEVLTPDSSRFWPADA 252

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPY-RDN---IPDIPENIILRTSQTYIAAYEKI 289
           +E      ITP   DK ++R+W+ +  + + RD     P +P++++ RT   Y+ AYE++
Sbjct: 253 WEPGR---ITP-SFDKQYVRDWLTSPASGWDRDGGQEPPPLPDDVVERTRARYLEAYERL 308

Query: 290 TG 291
           TG
Sbjct: 309 TG 310


>gi|300742257|ref|ZP_07072278.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rothia
           dentocariosa M567]
 gi|300381442|gb|EFJ78004.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rothia
           dentocariosa M567]
          Length = 308

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 111/314 (35%), Positives = 167/314 (53%), Gaps = 43/314 (13%)

Query: 9   IPELPNYYSGKVRENYF------------LSD------GTRITIATDRLSAFDQNIAC-I 49
           IP   + YSGKVR+ Y             +SD      G+ + +A+DR+SAFD+ +   I
Sbjct: 10  IPGWTHVYSGKVRDLYVPEESRYDAAGLTVSDDAEIRAGSVMVVASDRISAFDKILPTEI 69

Query: 50  PYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAG 104
           P KG++L Q++ +WF   S I  NH +    P  + G     + L MFP+E IVRGYL G
Sbjct: 70  PDKGKILTQMSLWWFQQLSHI-PNHVISTDVPESVAGRAMICKSLNMFPVECIVRGYLTG 128

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEI- 163
              + L ++   G   I    LP  + D  +L  P+ TPT K+       D+P++  E+ 
Sbjct: 129 ---SGLASYRDTGS--IAGIELPAGLVDGSRLETPIFTPTGKAE--VGQHDEPVTREELY 181

Query: 164 IHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDK-KQNIILADEIHT 222
              G    N+ E +S   L L+    K+A E G+IL D+K EFG D  +  I L DE+ T
Sbjct: 182 AEVGHAIGNRLEELS---LELYSTAEKIAREQGIILADTKVEFGTDSYRGEITLGDELLT 238

Query: 223 PDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQ 280
           PDSSR+W+   YE     G +    DK F+R+W+ +  + +   DN+P +PE+++ +T  
Sbjct: 239 PDSSRFWDANEYEP----GKSQPSFDKQFVRDWLRSPESGWDGSDNVPHLPEDVVEKTRA 294

Query: 281 TYIAAYEKITGLKF 294
            Y+ AYE++TG KF
Sbjct: 295 RYVEAYERLTGTKF 308


>gi|121997707|ref|YP_001002494.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Halorhodospira halophila SL1]
 gi|166229550|sp|A1WVI0|PUR7_HALHL RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|121589112|gb|ABM61692.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Halorhodospira halophila SL1]
          Length = 295

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 101/301 (33%), Positives = 164/301 (54%), Gaps = 27/301 (8%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           +++ +I  LP  +SGKVR+ Y + D   + +ATDRLSAFD  +   IP KG VL +++ +
Sbjct: 7   VAQTHIQSLPLLHSGKVRDIYAVDDERLLIVATDRLSAFDVILPDPIPDKGAVLTRVSNF 66

Query: 63  WFHHTSDICSNHTLDYPDPNVLVGQQ-------------LQMFPIELIVRGYLAGNTKTS 109
           WF  T+ + +NH LD P  +V+  ++             LQ  P+E IVRGYLAG+   S
Sbjct: 67  WFRKTAHLAANHLLDTPPESVVAPEEADQVRDRGVVVRRLQALPVEAIVRGYLAGSGWQS 126

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
              + ++G   +    LPD +  + +LP P+ TPTTK++      D+PIS  + + R  +
Sbjct: 127 ---YQRDGT--VSGVALPDGLRQSDRLPEPIFTPTTKAA--VGDHDEPISFAQTVER--I 177

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
             +  E I + AL +F    + A   GLI+ D+K EFG+  +   ++ DE+ TPDSSR+W
Sbjct: 178 GADLAERIRTIALEVFALATEYAESRGLIIADTKLEFGVTPEGEPVIIDELLTPDSSRFW 237

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKI 289
             + ++     G TP   DK +IR+ +       R   P + +++I +T++ Y  A   +
Sbjct: 238 PADAWQP----GATPPAFDKQYIRDHLEALGWDKRPPAPHLTDDVIRQTAEKYREAERLL 293

Query: 290 T 290
           T
Sbjct: 294 T 294


>gi|171057053|ref|YP_001789402.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leptothrix cholodnii SP-6]
 gi|226723549|sp|B1XWZ1|PUR7_LEPCP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|170774498|gb|ACB32637.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leptothrix cholodnii SP-6]
          Length = 302

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 100/308 (32%), Positives = 163/308 (52%), Gaps = 30/308 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L ++ +  LP    GKVR+NY +     + +A+DRLSAFD  +   IP KGE+L ++  Y
Sbjct: 5   LLESQLHSLPLLARGKVRDNYAVGTDRILMVASDRLSAFDVIMGEGIPGKGELLTRVALY 64

Query: 63  WFHHTSDICSNHTLDYPDPNVLVG--------------QQLQMFPIELIVRGYLAGNTKT 108
           WF     I  NH L   DP  +V               ++L+  P+E +VRGYLAG+   
Sbjct: 65  WFDRLGHIVPNH-LTGADPVSVVAPDEVDQVRGRSMLVKRLKPLPVEAVVRGYLAGSGWK 123

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                Y+   R +    LP  +++  +LP P+ TP TK    A   D  I+ +      I
Sbjct: 124 E----YQE-TRSVCGVALPSGLTNAARLPAPIFTPATK----AEMGDHDINISFERMSEI 174

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +  +  E + + ++ L+    ++AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSRY
Sbjct: 175 IGADLAERVRAISIQLYSSAAEIALSKGIIIADTKFEFGLDEDGTLTLMDEVLTPDSSRY 234

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILT---RCNPYRDN--IPDIPENIILRTSQTYI 283
           W +E Y+ ++ +G  P   DK F+R+W+ +      P+      P +P+++I+ T+ TY 
Sbjct: 235 WPIEHYQSAYAQGRNPPSFDKQFVRDWLESVRIDGQPWNKQAPAPALPDDVIVHTAATYR 294

Query: 284 AAYEKITG 291
            A E++T 
Sbjct: 295 EALERLTA 302


>gi|291537536|emb|CBL10648.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Roseburia
           intestinalis M50/1]
          Length = 292

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 168/296 (56%), Gaps = 35/296 (11%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRE Y   D + I +ATDR+SAFD  +   +  KG +L Q++++WF  T DI  NH +
Sbjct: 12  GKVREVYDNGD-SLIIVATDRISAFDHILKNKVTKKGAILTQMSKFWFDLTKDIVPNHMI 70

Query: 77  -----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
                D P        D N ++ ++L+M PIE IVRGY+ G+   S   + +NG   +  
Sbjct: 71  SVDVKDMPEFFQEERFDGNSMMCKKLEMLPIECIVRGYITGSGWES---YKENGT--VCG 125

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS---PNEIIHRGILTRNQ--WETIS 178
             LP+ + ++ KLP P+ TP+TK+       D+ IS     EI+ +    +     E I 
Sbjct: 126 IKLPEGLQESDKLPEPIFTPSTKAEIGLH--DENISFERCREILEKEYSGKGASYAEQIK 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y ++L+++  + AL  G+I+ D+K+EFG+D+  N++L DE+ TPDSSR+W +E Y    
Sbjct: 184 DYTIALYKKCAEYALTKGIIIADTKFEFGLDENGNVVLGDEMLTPDSSRFWPLEGY---- 239

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
           + G      DK F+R+W+  + NP  D +  +P+++I +T   Y  AYE +TG KF
Sbjct: 240 KPGQGQPSFDKQFVRDWL--KANPDSDYL--LPDDVIEKTVNKYKEAYELLTGKKF 291


>gi|254443847|ref|ZP_05057323.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Verrucomicrobiae bacterium DG1235]
 gi|198258155|gb|EDY82463.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Verrucomicrobiae bacterium DG1235]
          Length = 308

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 109/306 (35%), Positives = 162/306 (52%), Gaps = 47/306 (15%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
           E     SGKVRE Y L D   + +ATDR+SAFD  +   IP +G +L Q++ +WF  T  
Sbjct: 24  EAQKIASGKVREIYDLDDSV-LLVATDRISAFDVVLPGGIPGRGLILTQLSHFWFEQTKH 82

Query: 70  ICSNHTLDYPDPN---VLVGQ---------------QLQMFPIELIVRGYLAGNTKTSLL 111
           I  NH L    PN   +L G+               +LQ   IE +VRGY+AG+   S  
Sbjct: 83  IAPNHIL----PNEQEILAGRLQLSRDSQLRSMAVRKLQPLEIECVVRGYIAGSGWES-- 136

Query: 112 TFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTR 171
            + K+  R +    LP  +    +LP P+ TPTTK+SE   G D P+SP+E     I+ +
Sbjct: 137 -YQKD--RTVCGIELPAGLQLASQLPEPIFTPTTKASE---GHDMPVSPSE--AAAIVGQ 188

Query: 172 NQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEV 231
           + ++ + + +L L+  G +LA + G+IL D+K+EFG D+   I L DE+ TPDSSRYW+ 
Sbjct: 189 DVFDQVKAISLELYNFGSQLAAKAGIILADTKFEFGTDESGKIYLIDEVLTPDSSRYWDA 248

Query: 232 ETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTYIAAY 286
             Y    R G +P   DK  IR+++ T     +  P     P++P  I+ +    Y+  Y
Sbjct: 249 AEY----RVGSSPASYDKQIIRDYLETLKDWNKTAPG----PELPAEIVTKAQSRYLEVY 300

Query: 287 EKITGL 292
            K+ G+
Sbjct: 301 SKLVGV 306


>gi|121606756|ref|YP_984085.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polaromonas naphthalenivorans CJ2]
 gi|189038225|sp|A1VU36|PUR7_POLNA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|120595725|gb|ABM39164.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polaromonas naphthalenivorans CJ2]
          Length = 305

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 163/308 (52%), Gaps = 28/308 (9%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
           +L  + +  LP    GKVR+NY + +   + +A+DRLSAFD  +   IP KG +L Q+  
Sbjct: 7   VLHTSALTSLPLLARGKVRDNYAVGNDRLLMVASDRLSAFDVILGEPIPGKGALLTQMAL 66

Query: 62  YWFHHTSDICSNH-TLDYPD--------PNV----LVGQQLQMFPIELIVRGYLAGNTKT 108
           +WF     IC NH T + P+        P V    ++ ++L+  P+E +VRGYLAG+   
Sbjct: 67  FWFDKLGSICPNHLTGEAPESVVTAAEIPQVAGRSMLVKRLKPIPVEAVVRGYLAGSGWV 126

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
                Y+   + +    LP  + +  KLP P+ TP  K+       D+ IS  +++   +
Sbjct: 127 E----YQQ-SQSVCGVPLPAGLKNASKLPEPIFTPAAKAEVGEH--DENISYEQVVK--V 177

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +       I + +++++E     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSRY
Sbjct: 178 VGPELAAQIKTLSIAIYETAAAFALTKGIIIADTKFEFGLDENGTLTLMDEVLTPDSSRY 237

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWI-LTRCN--PYRDNIPD--IPENIILRTSQTYI 283
           W VE YE +F  G  P   DK F+R+W+   R N  P+    P   +P ++I +T+  Y 
Sbjct: 238 WPVEGYEAAFAAGQNPPSYDKQFVRDWLEAVRINGKPWDKTPPSPHLPPDVISKTAAKYQ 297

Query: 284 AAYEKITG 291
            A  ++T 
Sbjct: 298 EAMARLTA 305


>gi|15602680|ref|NP_245752.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pasteurella multocida subsp. multocida str. Pm70]
 gi|13431799|sp|P57878|PUR7_PASMU RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|12721121|gb|AAK02899.1| PurC [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 286

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 106/300 (35%), Positives = 153/300 (51%), Gaps = 41/300 (13%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF+  + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFNQLAHI 65

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH               D      +V ++L    IE IVRGYL G   + L  + K G
Sbjct: 66  MPNHFTGDTVYDVLPKEEADKVKDRAVVCKRLTPIKIESIVRGYLTG---SGLKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSE-------SASGCDQPISPNEIIHRGILT 170
              I    LP+ + +  KLP P+ TP++K+         S + C+Q I P          
Sbjct: 123 T--ICGLALPEGLVEASKLPEPIFTPSSKAEVGDHDVNISYAECEQLIGPELAAQ----- 175

Query: 171 RNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWE 230
                 +   A++L++   + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W 
Sbjct: 176 ------VKEKAIALYQAAAEYALSKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWS 229

Query: 231 VETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           VETY    REGI P   DK FIR+W+ T     +   P +P  +I +T   Y  A + +T
Sbjct: 230 VETY----REGINPPSFDKQFIRDWLETSGWNKQPPAPKVPAEVIEKTVNKYQEALDLLT 285


>gi|313114836|ref|ZP_07800336.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310622891|gb|EFQ06346.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 294

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 169/296 (57%), Gaps = 35/296 (11%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRE Y   D + I +ATDR+SAFD  +   +  KG VL Q++++WF +T D+  NH L
Sbjct: 15  GKVREIYDNGD-SLIMVATDRISAFDVILKNKVTKKGTVLTQMSKFWFDYTRDLLPNHML 73

Query: 77  -----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
                D P        D N ++ ++L M PIE IVRGY+ G+   S   + K GK  +  
Sbjct: 74  SVDVKDMPEFFQQPQFDGNSMMCRKLTMLPIECIVRGYITGSGWAS---YQKTGK--VCG 128

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTRNQ--WETIS 178
             LP+ + ++ KLP P+ TP+TK+       D+ IS     E++ +      +     + 
Sbjct: 129 IQLPEGLKESDKLPEPIYTPSTKAE--IGDHDENISYEKSIEVLEKQFPGHGEEYATKLR 186

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y ++L+++  + AL  G+I+ D+K+EFG+D+  N++L DE+ TPDSSR+W +E YE   
Sbjct: 187 DYTIALYKKCAEYALSRGIIIADTKFEFGLDENGNVVLGDEMLTPDSSRFWPLEGYEP-- 244

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
             G +    DK F+R+W+  + NP  D+  D+P+++I +T   Y+ AYE +TG K 
Sbjct: 245 --GHSQPSFDKQFVRDWL--KANP--DSNYDLPQDVIDKTIAKYLEAYELLTGKKL 294


>gi|319442486|ref|ZP_07991642.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium variabile DSM 44702]
          Length = 299

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 167/300 (55%), Gaps = 29/300 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + E  ++ +GKVRE Y + D T + +ATDR+SA+D  +   IP KG VL  ++ ++F   
Sbjct: 5   LSEYTHFSAGKVREIYEIDDATLLMVATDRISAYDYVLDTDIPDKGRVLTAMSDFFFDAL 64

Query: 68  SDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
                NH     D            +V ++L+M P E +VRGYL G   + L  + +NG 
Sbjct: 65  D--FPNHLAGSADDERIPEKVLGRAMVCRKLEMLPFECVVRGYLTG---SGLKEYRENGT 119

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
               E  LP+ +++  KLP P+ TP TK+       D+ +S + ++    L + + E + 
Sbjct: 120 VCGVE--LPEGLTEASKLPEPLFTPATKAE--IGDHDENVSFDRVVAD--LGQERAEQLR 173

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
             ++S++ +   +A E+G+IL D+K+EFG+D + N++L DE+ TPDSSRYW  +TYE   
Sbjct: 174 EASISIYSQAAAIAAEHGIILADTKFEFGLDAEGNLVLGDEVLTPDSSRYWPADTYE--- 230

Query: 239 REGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            EG      DK ++RNW+    + +    +   P++P +++  T + YI AYE+I+G +F
Sbjct: 231 -EGKVQPSFDKQYVRNWLTGPKSGWDIKSQTPPPELPGSVVEATRERYIEAYERISGNRF 289


>gi|226941992|ref|YP_002797066.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Laribacter hongkongensis HLHK9]
 gi|226716919|gb|ACO76057.1| Pur7 [Laribacter hongkongensis HLHK9]
          Length = 292

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/305 (34%), Positives = 158/305 (51%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L+   +  L   YSGKVR+ Y + D   + IATDRLSAFD  +   IP KG++L  I
Sbjct: 1   MNGLTTTDLTSLKKIYSGKVRDLYEIDDQRMLMIATDRLSAFDVILPDPIPEKGKLLTAI 60

Query: 60  TQYWFHHTSDICSNH-TLDYPD--------PNV----LVGQQLQMFPIELIVRGYLAGNT 106
           + +WF    D+  NH T + P+        P V    +V ++L+  PIE +VRGYLAG  
Sbjct: 61  SNFWFDKLKDVVPNHLTGERPEDMVSAADRPQVEGRAVVARKLKALPIEAVVRGYLAGG- 119

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
                 + K G   +    LP  + +  KLP P+ TP+TK++      D+ IS       
Sbjct: 120 --GWKEYRKTGG--VCGIALPAGLQEASKLPEPIFTPSTKAA--VGDHDENISFERCAD- 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+ R     +   AL L+    + A   G+I+ D+K+EFG+D+   ++L DE  TPDSS
Sbjct: 173 -IIGREMAGQVRDTALRLYRVASEYAASRGIIICDTKFEFGLDENGTLVLMDEALTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  ++Y    REGI+P   DK F+R+W+ T         P +P+ +  +T+  Y  A 
Sbjct: 232 RFWPADSY----REGISPPSFDKQFVRDWLETTGWDKVSPAPRVPDEVAQKTADKYREAL 287

Query: 287 EKITG 291
            ++ G
Sbjct: 288 VRLAG 292


>gi|255326692|ref|ZP_05367768.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rothia
           mucilaginosa ATCC 25296]
 gi|255295909|gb|EET75250.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rothia
           mucilaginosa ATCC 25296]
          Length = 308

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 106/313 (33%), Positives = 164/313 (52%), Gaps = 41/313 (13%)

Query: 9   IPELPNYYSGKVRENYF------------------LSDGTRITIATDRLSAFDQNIAC-I 49
           IP   + YSGKVR+ Y                   L  G+ + +A+DR+SAFD+ +   I
Sbjct: 10  IPGWTHIYSGKVRDLYVPNEERFDATGLTVNDDAELRAGSVMVVASDRISAFDRILPTEI 69

Query: 50  PYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQ-----QLQMFPIELIVRGYLAG 104
           P KG++L Q++ +WF     +  NH L    P+V+ G+      L MFP+E IVRGYL G
Sbjct: 70  PDKGKILTQMSLWWFEQLKQV-PNHVLSTDVPDVVAGRAMICRSLNMFPVECIVRGYLTG 128

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
              + L  + + G+  I    LP  + D  +L  P+ TPT K+       D+ ++  E+ 
Sbjct: 129 ---SGLAVYNETGE--IAGVKLPAGLVDGSRLETPIFTPTGKAE--VGEHDELVTREELY 181

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDK-KQNIILADEIHTP 223
               + +   E +   +LSL+    K+A E G+IL D+K EFG D  +  I L DE+ TP
Sbjct: 182 AE--VGQPVGERLEELSLSLYTTAEKIAREQGIILADTKMEFGTDSYRGEITLGDEVLTP 239

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQT 281
           DSSR+W+ + YE     G      DK ++R+W+ +    +   DN+P +PE ++ +T   
Sbjct: 240 DSSRFWDAQQYEP----GRAQPSFDKQYVRDWLRSPEAGWDGSDNVPHLPEEVVEKTRAR 295

Query: 282 YIAAYEKITGLKF 294
           Y+ AYE++TG KF
Sbjct: 296 YVEAYERLTGTKF 308


>gi|294892702|ref|XP_002774191.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Perkinsus marinus ATCC 50983]
 gi|239879408|gb|EER06007.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Perkinsus marinus ATCC 50983]
          Length = 508

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 113/340 (33%), Positives = 180/340 (52%), Gaps = 40/340 (11%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L++ +IPEL     GKVRE YF +D   + +  DR+SAFD  +   IP+KG+VLN I+Q+
Sbjct: 23  LAECFIPELGMPMKGKVREIYF-TDANVVMVTNDRVSAFDYVLPNLIPFKGQVLNTISQW 81

Query: 63  WFHHTSDICSNHTL--DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
             + T DI  N  +  D  DP V+V ++++   +E I+RGYL G    S+   Y+ G R 
Sbjct: 82  AMNSTKDIVPNAMVGDDLVDPAVVVQKKMKNVGVECIIRGYLWG----SMAAAYEKGDRT 137

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII-HRGILTRNQWETISS 179
                L + +   QKLP P+ TPTTK+     G D+ ++  E+  + G     Q + +S 
Sbjct: 138 FCGLKLEEGLIRFQKLPTPIFTPTTKAE---VGHDENMTMEEVASYCGADVARQMKELS- 193

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
               L+ERG +L  + GLIL+D+KYEFG+D+   + + DE++TPDSSR  +V+ +E  F 
Sbjct: 194 --FKLYERGAQLMRDRGLILLDTKYEFGVDENGVLHVIDEVNTPDSSRMCDVKEWESKFP 251

Query: 240 E---------------------GITPIGLDKDFIRNWILTRC-NPYRDN-IPDIPENIIL 276
           +                      + P    K ++R+ +L     P RD  +P +    ++
Sbjct: 252 QIEKLMNDGNYRNVSDLLKDHPHLKPAEFSKQYVRDALLDMGFKPDRDKAVPKLSNEHVV 311

Query: 277 RTSQTYIAAYEKITGLKF--IADNSELPPLERIRNNLRKY 314
             +  YIA  E++TG  F   +   ++ P ER+ +NLR +
Sbjct: 312 ECAYRYIAVCERVTGQPFEWPSKAVKMTPEERVCSNLRHH 351


>gi|297200746|ref|ZP_06918143.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sviceus ATCC 29083]
 gi|197712316|gb|EDY56350.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sviceus ATCC 29083]
          Length = 299

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/301 (34%), Positives = 165/301 (54%), Gaps = 30/301 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVRE Y    G  + IA+DR+SAFD  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRELYQNEAGDLVMIASDRISAFDWVLPTEIPDKGRVLTQLSLWWFDQI 72

Query: 68  SDICSNHTL--DYPD-------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH L  D P+          LV + L+M P+E + RGYL G   + LL +  N  
Sbjct: 73  ADLLPNHVLSTDVPEGAPADWAGRTLVCKSLRMVPVEAVARGYLTG---SGLLEY--NES 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETI 177
           R +    LP+ + D  +LP P+ TP TK+  +    D+ +S  E+  + G  T  Q   +
Sbjct: 128 RTVCGLALPEGLVDGSELPAPIFTPATKA--AVGEHDENVSYEEVARQVGADTAAQ---L 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ RG  +A + G+IL D+K+EFG D  + +++ADE+ TPDSSR+W  E +E  
Sbjct: 183 RQATLAVYSRGRDIARDRGIILADTKFEFGFD-GETLVIADEVLTPDSSRFWPAEQWEP- 240

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLK 293
              G      DK F+R+W+ +  + +        P +P+ ++ RT   YI AYE++TG  
Sbjct: 241 ---GHAQPSYDKQFVRDWLTSAESGWDRKSEQPPPPLPQEVVDRTRAKYIEAYERLTGTS 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|124265485|ref|YP_001019489.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylibium petroleiphilum PM1]
 gi|167011920|sp|A2SCG5|PUR7_METPP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|124258260|gb|ABM93254.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylibium petroleiphilum PM1]
          Length = 300

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 102/307 (33%), Positives = 160/307 (52%), Gaps = 32/307 (10%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L ++ +  LP    GKVR+NY +     + +A+DRLSAFD  +   IP KGE+L ++  +
Sbjct: 7   LLESRLQSLPLLARGKVRDNYAVGSDRLLMVASDRLSAFDVVMGEPIPGKGELLTRMALF 66

Query: 63  WFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNTKTS 109
           WF     I  NH T D P+  V            ++ ++L+  P+E +VRGYLAG   + 
Sbjct: 67  WFARLGHIVPNHLTGDAPESVVSAAERSQVTGRSMLVKRLKPLPVEAVVRGYLAG---SG 123

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
              +  NG+  +    LP  + +  KLP P+ TP TK+       D+ I    ++   I+
Sbjct: 124 WKEYQHNGQ--VCGVKLPPGLKNASKLPSPIFTPATKAEMGEH--DENIPFERMVE--II 177

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
                E +   A++L+E     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W
Sbjct: 178 GAPLAEQVRRVAIALYETAAAFALGKGIIIADTKFEFGLDEAGTLTLMDEVLTPDSSRFW 237

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWI---LTRCNPYRDN--IPDIPENIILRTSQTYIA 284
            VE Y     EGI P   DK F+R+W+   +    P+      P +P +++ RT+  Y  
Sbjct: 238 PVEGYA----EGINPPSYDKQFVRDWLEQAVVDGRPWNKQAPAPALPADVVARTAAKYRE 293

Query: 285 AYEKITG 291
           A E++T 
Sbjct: 294 ALERLTA 300


>gi|121596214|ref|YP_988110.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax sp. JS42]
 gi|222112441|ref|YP_002554705.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax ebreus TPSY]
 gi|120608294|gb|ABM44034.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax sp. JS42]
 gi|221731885|gb|ACM34705.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax ebreus TPSY]
          Length = 306

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 106/310 (34%), Positives = 162/310 (52%), Gaps = 34/310 (10%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L  + +  LP    GKVR+NY + D   + +A+DRLSAFD  +   IP KGE+L Q+  +
Sbjct: 9   LHTSALTSLPLLARGKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGELLTQMALF 68

Query: 63  WFHHTSDICSNH-TLDYPD--------PNV----LVGQQLQMFPIELIVRGYLAGNTKTS 109
           WF     I  NH T + P+        P V    ++ Q+L+  PIE +VRGYLAG+    
Sbjct: 69  WFGKLGHIVPNHLTGEAPESVVTPAEAPQVRGRSMLVQRLKPIPIEAVVRGYLAGSGWKE 128

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS---PNEIIHR 166
               Y+   R +    LPD +++  KLP  + TP  K++      D+ IS     EI+  
Sbjct: 129 ----YQE-SRSVCGVPLPDGLTNAAKLPQTIYTPAAKAAMGEH--DENISFERTVEIVGL 181

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            + TR     I   ++ L+E    +ALE G+I+ D+K+EFG+     ++L DE+ TPDSS
Sbjct: 182 DLATR-----IRDISIQLYEAAAAIALEKGMIIADTKFEFGLAPDGTLVLMDEVLTPDSS 236

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWI---LTRCNPYRDNIPD--IPENIILRTSQT 281
           RYW VE Y ++  +G  P   DK F+R+W+        P+    P   +P  ++ +T+  
Sbjct: 237 RYWPVEGYAEALAKGENPPSYDKQFVRDWLEQAQVGGKPWNKTAPAPRLPREVVEKTAAK 296

Query: 282 YIAAYEKITG 291
           Y  A E++T 
Sbjct: 297 YREALERLTA 306


>gi|225377441|ref|ZP_03754662.1| hypothetical protein ROSEINA2194_03089 [Roseburia inulinivorans DSM
           16841]
 gi|225210717|gb|EEG93071.1| hypothetical protein ROSEINA2194_03089 [Roseburia inulinivorans DSM
           16841]
          Length = 318

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 103/296 (34%), Positives = 166/296 (56%), Gaps = 35/296 (11%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRE Y   D + I +ATDR+SAFD  +   I  KG +L Q++++WF +T DI  NH +
Sbjct: 38  GKVREVYDNGD-SLIIVATDRISAFDHILKNKITKKGAILTQMSKFWFDYTKDIVPNHMI 96

Query: 77  -----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
                D P        D N ++ ++L M PIE IVRGY+ G   +   ++ KNG   +  
Sbjct: 97  SVDVKDMPEFFQNEKYDGNSMMCKKLNMLPIECIVRGYITG---SGWASYKKNGT--VCG 151

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSS----ESASGCDQPISPNEIIHRGILTRNQWET-IS 178
             LP+ + ++ KLP P+ TP+TK+     +     +Q +   E +H G     ++ T I 
Sbjct: 152 IKLPEGLVESDKLPEPIYTPSTKADLGDHDENISFEQSVEVLEKLHPG--KGEEYATKIK 209

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              ++L+++  + AL  G+I+ D+K+EFG+D+  N++L DE+ TPDSSR+W +E YE   
Sbjct: 210 DATIALYKKCAEYALSKGIIIADTKFEFGLDENGNVVLGDEMLTPDSSRFWPLEGYE--- 266

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
             G      DK ++R+W+  + NP  D +  +PE ++ +T   Y  A+  +TG +F
Sbjct: 267 -AGKGQPSFDKQYVRDWL--KANPDNDFL--LPEEVVTKTVDKYKEAFALLTGKEF 317


>gi|283457376|ref|YP_003361952.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rothia
           mucilaginosa DY-18]
 gi|283133367|dbj|BAI64132.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rothia
           mucilaginosa DY-18]
          Length = 342

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 106/313 (33%), Positives = 164/313 (52%), Gaps = 41/313 (13%)

Query: 9   IPELPNYYSGKVRENYF------------------LSDGTRITIATDRLSAFDQNIAC-I 49
           IP   + YSGKVR+ Y                   L  G+ + +A+DR+SAFD+ +   I
Sbjct: 44  IPGWTHIYSGKVRDLYVPNEERFDATGLTVNDDAELRAGSVMVVASDRISAFDRILPTEI 103

Query: 50  PYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVGQ-----QLQMFPIELIVRGYLAG 104
           P KG++L Q++ +WF     +  NH L    P+V+ G+      L MFP+E IVRGYL G
Sbjct: 104 PDKGKILTQMSLWWFEQLKQV-PNHVLSTDVPDVVAGRAMICRSLNMFPVECIVRGYLTG 162

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
              + L  + + G+  I    LP  + D  +L  P+ TPT K+       D+ ++  E+ 
Sbjct: 163 ---SGLAVYNETGE--IAGVKLPAGLVDGSRLDTPIFTPTGKAEVGEH--DELVTREELY 215

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDK-KQNIILADEIHTP 223
               + +   E +   +LSL+    K+A E G+IL D+K EFG D  +  I L DE+ TP
Sbjct: 216 AE--VGQPVGERLEELSLSLYTTAEKIAREQGIILADTKMEFGTDSYRGEITLGDEVLTP 273

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPY--RDNIPDIPENIILRTSQT 281
           DSSR+W+ + YE     G      DK ++R+W+ +    +   DN+P +PE ++ +T   
Sbjct: 274 DSSRFWDAQQYEP----GRAQPSFDKQYVRDWLRSPEAGWDGSDNVPHLPEEVVEKTRAR 329

Query: 282 YIAAYEKITGLKF 294
           Y+ AYE++TG KF
Sbjct: 330 YVEAYERLTGTKF 342


>gi|58651789|emb|CAI50969.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [uncultured bacterium]
          Length = 296

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 106/305 (34%), Positives = 166/305 (54%), Gaps = 34/305 (11%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQ-NIACIPYKGEVLNQITQY 62
           L +  +P +     GKVR+ Y + D   I +ATDR+SAFD  N   IP KG++L Q++ Y
Sbjct: 5   LCETRLPGIEPVARGKVRDIYDVGDALLI-VATDRISAFDWVNPVGIPDKGKILTQMSLY 63

Query: 63  WFHHTSDICSNHTL-----DYPD-----PNVLVGQQL-----QMFPIELIVRGYLAGNTK 107
           WF  T D+C NH +     D+P      P    G+ +      MFP+E +VRGYLAG   
Sbjct: 64  WFEVTRDLCRNHLISSRLADFPSEFRNAPEQFEGRSMLVHKCAMFPVEFVVRGYLAG--- 120

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
           +    + ++G   +    LP  + ++ KL  P+ TP TK+S   +G D  I P+E    G
Sbjct: 121 SGWKEYREHG--TVCGIPLPKGLQESSKLDTPIFTPATKAS---NGHDINIPPDEA---G 172

Query: 168 ILTRNQW-ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            +   +W +  S  A++++ER   +A   G+IL D+K+EFG+  +  ++LADE+ TPDSS
Sbjct: 173 KIIGQEWAKAASGKAIAIYERARDIAGSKGIILCDTKFEFGL-FEGALMLADEVLTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           RYW  + Y+     G      DK ++R+W+ T         P +P ++I +T + Y+ AY
Sbjct: 232 RYWPADEYQP----GRGQPSYDKQYVRDWLETTGWDKNSPPPALPADVITKTREKYVEAY 287

Query: 287 EKITG 291
            ++TG
Sbjct: 288 RRLTG 292


>gi|117929336|ref|YP_873887.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidothermus cellulolyticus 11B]
 gi|117649799|gb|ABK53901.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidothermus cellulolyticus 11B]
          Length = 284

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 154/287 (53%), Gaps = 21/287 (7%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           YSGKVR+ Y L DG  + +ATDR+SA+D  +   IP KG +L  ++ +WF   +D+  NH
Sbjct: 10  YSGKVRDLYELPDGRLLFVATDRISAYDHILPTLIPDKGRILTALSLWWFDQLADVVPNH 69

Query: 75  TLDYPDP-----NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDN 129
            +    P       ++ ++L+M P E + RGYL G+    L  + + G+  +    LP  
Sbjct: 70  VVSTDVPAEFHGRAMICERLEMIPFECVARGYLTGS---GLADYQRTGQ--VCGVPLPPG 124

Query: 130 MSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGC 189
           + D  +LP P+ TP TK+       + P++  E      L       ++   L+++ +  
Sbjct: 125 LVDGDRLPEPIFTPATKAPRGTHDENVPLAAVE----KALGAETAARLAELTLTIYRQAH 180

Query: 190 KLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDK 249
             AL +G+I+ D+K EFG      ++LADE+ TPDSSR+W  E    S+R G      DK
Sbjct: 181 DRALASGIIVADTKVEFGRRADGTLVLADEVLTPDSSRFWPAE----SWRPGRAQPSFDK 236

Query: 250 DFIRNWIL-TRCNPYRDN-IPDIPENIILRTSQTYIAAYEKITGLKF 294
            ++R+W+  T  +P      P +PE+++ +T   YI AYE+ITG ++
Sbjct: 237 QYVRDWLRSTGWDPAGSAPPPPLPEDVVAQTRARYIEAYERITGRRW 283


>gi|329938782|ref|ZP_08288178.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces griseoaurantiacus M045]
 gi|329302273|gb|EGG46165.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces griseoaurantiacus M045]
          Length = 299

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 161/300 (53%), Gaps = 28/300 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVRE Y    G  + +A+DR+SA+D  +   IP KG +L Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRELYQNEAGDLVMVASDRISAYDWVLPTEIPDKGRILTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+   H L    P           LV + L+M P+E + RGYL G    S L  Y N  
Sbjct: 73  ADLVPGHVLSTELPAGAPADWRGRTLVCKSLRMVPVECVARGYLTG----SGLVEY-NAS 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP+ + D  +LP P+ TP TK++      D+ +S  E+  +  +  +    + 
Sbjct: 128 RTVCGLALPEGLVDGSELPAPIFTPATKAA--VGDHDENVSYEEVARQ--VGADTAARLR 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L+++ RG  +A + G++L D+K+EFG D  + ++LADE+ TPDSSR+W  E +E   
Sbjct: 184 QATLAVYVRGRDIARDRGILLADTKFEFGFDGDE-LVLADEVLTPDSSRFWPAEEWEP-- 240

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGLKF 294
             G      DK F+R+W+ +  + +        P +P+ ++  T   Y+ AYE++TG+++
Sbjct: 241 --GRAQPSYDKQFVRDWLTSPASGWDRTAEQPPPALPDEVVEATRGKYVEAYERLTGVRW 298


>gi|326772418|ref|ZP_08231702.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces viscosus C505]
 gi|326637050|gb|EGE37952.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces viscosus C505]
          Length = 352

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 93/300 (31%), Positives = 166/300 (55%), Gaps = 30/300 (10%)

Query: 9   IPELPNYYSGKVRENYF-LSDG------TRITIATDRLSAFDQNIAC-IPYKGEVLNQIT 60
           +P   +  SGKVR+ Y   SDG        + +A+DR+SA+D  +A  IP KG+VL  ++
Sbjct: 60  VPGWEHRSSGKVRDVYAPTSDGPWGGQDVLLVVASDRISAYDHILATPIPDKGKVLTALS 119

Query: 61  QYWFHHTSDICSNH--TLDYPD---PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +D+  NH  +LD P       ++ ++L+M+P+E + RGYL G    S L  Y+
Sbjct: 120 AWWFEQLADVVPNHLVSLDVPAQVAGRAMICRRLEMYPVECVARGYLTG----SGLVEYR 175

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
            G R +    LP+ +++  +LP P+ TP  K+       D+ ++   ++   ++  +   
Sbjct: 176 QG-RSVCGVALPEGLTEASRLPEPIFTPAAKAELGEH--DENVTFERVVQ--MVGDSAAT 230

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L+L+ R  ++A + G+IL D+K+E G D   +++L DE+ TPDSSR+W  + +E
Sbjct: 231 ALRETTLALYSRAAEIARDRGIILADTKFELGTDADGDLVLGDEVLTPDSSRFWPADAWE 290

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITG 291
                 +TP   DK ++R+W+ +  + +        P +P++++ RT   Y+ AYE++TG
Sbjct: 291 PGR---VTP-SFDKQYVRDWLTSPASGWDRGGDQEPPALPDDVVERTRARYLEAYERLTG 346


>gi|295104229|emb|CBL01773.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Faecalibacterium prausnitzii SL3/3]
          Length = 289

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 172/298 (57%), Gaps = 39/298 (13%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRE Y   D + I +ATDR+SAFD  +   +  KG VL Q++++WF +T D+  NH L
Sbjct: 10  GKVREIYDNGD-SLIMVATDRISAFDVILKNKVTKKGTVLTQMSKFWFDYTRDLLPNHML 68

Query: 77  -----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
                D P+         N ++ ++L M PIE IVRGY+ G+   S   + K GK  +  
Sbjct: 69  SVDVQDMPEFFRQPQFTGNSMMCRKLTMLPIECIVRGYITGSGWAS---YQKTGK--VCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRN------QWET- 176
             LP+ + ++ KLP P+ TP+TK+       D+ IS  + I   +L +       ++ T 
Sbjct: 124 IQLPEGLQESDKLPEPIYTPSTKAE--IGDHDENISYEQSID--VLEKQFPGHGLEYATK 179

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +  Y ++L+++  + AL  G+I+ D+K+EFG+D+  N++L DE+ TPDSSR+W +E YE 
Sbjct: 180 LRDYTIALYKKCAEYALSRGIIIADTKFEFGLDEDGNVVLGDEMLTPDSSRFWPLEGYEP 239

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
               G +    DK F+R+W+  + NP  D+  D+P+++I +T   Y+ AYE +TG K 
Sbjct: 240 ----GHSQPSFDKQFVRDWL--KANP--DSNYDLPQDVIDKTIAKYLEAYELLTGKKL 289


>gi|160944880|ref|ZP_02092107.1| hypothetical protein FAEPRAM212_02396 [Faecalibacterium prausnitzii
           M21/2]
 gi|158444064|gb|EDP21068.1| hypothetical protein FAEPRAM212_02396 [Faecalibacterium prausnitzii
           M21/2]
          Length = 297

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 172/298 (57%), Gaps = 39/298 (13%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRE Y   D + I +ATDR+SAFD  +   +  KG VL Q++++WF +T D+  NH L
Sbjct: 18  GKVREIYDNGD-SLIMVATDRISAFDVILKNKVTKKGTVLTQMSKFWFDYTRDLLPNHML 76

Query: 77  -----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
                D P+         N ++ ++L M PIE IVRGY+ G+   S   + K GK  +  
Sbjct: 77  SVDVQDMPEFFRQPQFTGNSMMCRKLTMLPIECIVRGYITGSGWAS---YQKTGK--VCG 131

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRN------QWET- 176
             LP+ + ++ KLP P+ TP+TK+       D+ IS  + I   +L +       ++ T 
Sbjct: 132 IQLPEGLQESDKLPEPIYTPSTKAE--IGDHDENISYEQSID--VLEKKFPGHGLEYATK 187

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +  Y ++L+++  + AL  G+I+ D+K+EFG+D+  N++L DE+ TPDSSR+W +E YE 
Sbjct: 188 LRDYTIALYKKCAEYALSRGIIIADTKFEFGLDEDGNVVLGDEMLTPDSSRFWPLEGYEP 247

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
               G +    DK F+R+W+  + NP  D+  D+P+++I +T   Y+ AYE +TG K 
Sbjct: 248 ----GHSQPSFDKQFVRDWL--KANP--DSNYDLPQDVIDKTIAKYLEAYELLTGKKL 297


>gi|294887377|ref|XP_002772079.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Perkinsus marinus ATCC 50983]
 gi|239876017|gb|EER03895.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase, putative
           [Perkinsus marinus ATCC 50983]
          Length = 508

 Score =  166 bits (419), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 113/340 (33%), Positives = 179/340 (52%), Gaps = 40/340 (11%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L++ +IPEL     GKVRE YF +D   + +  DR+SAFD  +   IP+KG+VLN I+Q+
Sbjct: 23  LAECFIPELGMPMKGKVREIYF-TDANVVMVTNDRVSAFDYVLPNLIPFKGQVLNTISQW 81

Query: 63  WFHHTSDICSNHTL--DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
             + T DI  N  +  +  DP V+V ++++   +E IVRGYL G    S+   Y+ G R 
Sbjct: 82  AMNSTKDIVPNAMVGDNLVDPAVVVQKKMKNVGVECIVRGYLWG----SMAAAYEKGDRT 137

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII-HRGILTRNQWETISS 179
                L + +   QKLP P+ TPTTK+     G D+ ++  E+  + G     Q   I  
Sbjct: 138 FCGLKLEEGLIRFQKLPTPIFTPTTKAE---VGHDENMTMEEVASYCGADVARQ---IKE 191

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
            +  L+ERG +L  + GLIL+D+KYEFG+D+   + + DE++TPDSSR  +V+ +E  F 
Sbjct: 192 LSFKLYERGAQLMRDRGLILLDTKYEFGVDENGVLHVIDEVNTPDSSRMCDVKEWESKFP 251

Query: 240 E---------------------GITPIGLDKDFIRNWILTRC-NPYRDN-IPDIPENIIL 276
           +                      + P    K ++R+ +L     P RD  +P +    ++
Sbjct: 252 QIEKLMNDGNYRNVSELLKDHPHLKPAEFSKQYVRDALLDMGFKPDRDKAVPKLSNEHVV 311

Query: 277 RTSQTYIAAYEKITGLKF--IADNSELPPLERIRNNLRKY 314
             +  YIA  E++TG  F   +   ++ P ER+ +NLR +
Sbjct: 312 ECAYRYIAVCERVTGQPFGWPSKAVKMTPEERVCSNLRHH 351


>gi|118594430|ref|ZP_01551777.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylophilales bacterium HTCC2181]
 gi|118440208|gb|EAV46835.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylophilales bacterium HTCC2181]
          Length = 294

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 164/302 (54%), Gaps = 26/302 (8%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
           +L  + I  LP  + GKVR+ Y +++   + + TDRLSAFD  +   IP+KG+VL ++  
Sbjct: 2   VLLNSSIKSLPLIHQGKVRDIYDINEHKMLIVTTDRLSAFDVIMGEPIPFKGQVLTEMAN 61

Query: 62  YWFHHTSDICSNHTLDYPDPNVL------------VGQQLQMFPIELIVRGYLAGNTKTS 109
           +WF +  DI ++ T + P+  VL            V ++L+  PIE IVRGY+ G+    
Sbjct: 62  FWFDYFKDIPNHLTYENPENFVLPAEIDQIHGRAVVVKKLRPIPIEAIVRGYIIGSGWKE 121

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
                    + I    LP  +    KLP  + TP+ K+ +     D+ IS      R +L
Sbjct: 122 Y-----QASQSICNISLPKGLKQASKLPQALFTPSNKADQGQH--DENISLEHC--RSLL 172

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
             +  +TIS  ++S++ +  +LA   G+I+ D+K EFG+D    + L DE+ TPDSSR+W
Sbjct: 173 GDDLTKTISEMSISIYIKASELAKAKGIIIADTKLEFGLDSNNQVTLMDEVLTPDSSRFW 232

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKI 289
                EKS++ G++P   DK ++R+W+ T+    +   P +P+ +I  TS  Y  A+EKI
Sbjct: 233 P----EKSYQMGMSPPSFDKQYVRDWLETQDWNKQAPAPTLPKTVIEETSNKYREAFEKI 288

Query: 290 TG 291
           TG
Sbjct: 289 TG 290


>gi|255659536|ref|ZP_05404945.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Mitsuokella multacida DSM 20544]
 gi|260848090|gb|EEX68097.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Mitsuokella multacida DSM 20544]
          Length = 290

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 164/300 (54%), Gaps = 31/300 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           + E   + SGKVRE Y   D   I +ATDR+SAFD  +   I  KG+VL Q++++WF  T
Sbjct: 1   MKEYKPFKSGKVREVYDAGDSI-IMVATDRISAFDHILKNQITKKGKVLTQMSKFWFDFT 59

Query: 68  SDICSNHTL-----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
            DI  NH +     D P+         N +  ++L M P+E IVRGY+ G   +   ++ 
Sbjct: 60  KDIIPNHMISVDNNDMPEFFRQPQFLGNSMKCKKLTMLPMECIVRGYITG---SGWASYQ 116

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           +NG   +    LP+ + ++QKLP P+ TP+TK+       +  +     +       +  
Sbjct: 117 ENGT--VCGIKLPEGLKESQKLPEPIFTPSTKAELGDHDENVSLEQGAAVFEKEFPGHGM 174

Query: 175 E---TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEV 231
           E    +  Y ++++++    AL  G+I+ D+K+EFG+D+  NI+L DE+ TPDSSR+W +
Sbjct: 175 EYAEKLRDYTIAIYKKCAAYALSRGIIIADTKFEFGLDEDGNIVLGDEVLTPDSSRFWPL 234

Query: 232 ETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           E YE     G      DK F+R+W+  + NP  D+   +P+++I +T   Y+ AY+ ITG
Sbjct: 235 EGYEA----GKPQPSYDKQFVRDWL--KANP--DSDYKLPQDVIDKTIAKYVEAYKMITG 286


>gi|184200075|ref|YP_001854282.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Kocuria
           rhizophila DC2201]
 gi|183580305|dbj|BAG28776.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Kocuria
           rhizophila DC2201]
          Length = 323

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 103/313 (32%), Positives = 166/313 (53%), Gaps = 41/313 (13%)

Query: 9   IPELPNYYSGKVRENYFLSD------------------GTRITIATDRLSAFDQNIAC-I 49
           IP   + YSGKVRE Y   +                  G  + +A+DR+SAFDQ +   I
Sbjct: 10  IPGWKHVYSGKVRELYVPDESRMTATGVAIHDDAEYRAGAVLVVASDRISAFDQVLPTEI 69

Query: 50  PYKGEVLNQITQYWFHHTSDICSNHTL-----DYPDPNVLVGQQLQMFPIELIVRGYLAG 104
           P KG +L Q++ +WF     I  NH L     +      +V + L MFP+E IVRGYL G
Sbjct: 70  PDKGTILTQLSLWWFEQLDGI-PNHILSTDVHESVRGRAVVCKNLSMFPVENIVRGYLTG 128

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
              + L  +   G   +    LP+ + D  +L  P+ TPT K++      D+PI+  E+ 
Sbjct: 129 ---SGLKDYRTTGS--VCGIELPEGLQDGDRLEQPIFTPTGKAALGEH--DEPITYREMA 181

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDK-KQNIILADEIHTP 223
              ++  +  + +   +L ++ R  ++A E G+I+ D+K EFG+D  +  I L DE+ TP
Sbjct: 182 D--VVGNSVADRLRELSLKIYTRAERIARERGIIVADTKVEFGLDSYRGAITLGDEVLTP 239

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDN--IPDIPENIILRTSQT 281
           DSSR+W++ETY    R G      DK ++R+W+ +  + +  +  +P +PE+++ RT + 
Sbjct: 240 DSSRFWDMETY----RPGRAQPSFDKQYVRDWLRSDASGWDGHGPVPQLPEDVVARTRER 295

Query: 282 YIAAYEKITGLKF 294
           Y+ AYE++TG  F
Sbjct: 296 YVEAYERLTGRVF 308


>gi|261856472|ref|YP_003263755.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Halothiobacillus neapolitanus c2]
 gi|261836941|gb|ACX96708.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Halothiobacillus neapolitanus c2]
          Length = 306

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 104/306 (33%), Positives = 159/306 (51%), Gaps = 33/306 (10%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQY 62
           L ++ +  LP  + GKVR+ Y +     + + TDR+SAFD  +   IP KG VL  I+ +
Sbjct: 8   LLESKLSHLPLLHRGKVRDLYAVDTDRLLIVTTDRISAFDVILPTAIPDKGRVLTAISHF 67

Query: 63  WFHHTSDICSNHTLD-------YPDPN--------VLVGQQLQMFPIELIVRGYLAGNTK 107
           WF  T  I  NH  D        PD +         L+ ++L+  PIE +VRGYL G   
Sbjct: 68  WFDRTRTIVPNHLTDDQSLTDIIPDRDERALLEGRSLIVKRLKALPIEAVVRGYLIG--- 124

Query: 108 TSLLTFYKN--GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
               T YK+      +    LP ++    +LP P+ TP TK++      D+ I  +  + 
Sbjct: 125 ----TGYKDYLATGAVCGIALPKDLPLAARLPEPIFTPATKAA--VGDHDENIDFDTTV- 177

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             +L R   E +   A+ L++   K ALE G+I+ D+K+EFG+D +  + L DE  TPDS
Sbjct: 178 -SLLGRPLAEQVRDTAIRLYQEAAKYALERGIIIADTKFEFGLDDQGTLHLIDEALTPDS 236

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W V+ Y    + GI+P   DK F+R+W+ T     +   P IP++I+ +T   Y+ A
Sbjct: 237 SRFWPVDQY----KTGISPPSFDKQFVRDWLETLDWDKKAPGPTIPDDIVQQTRSRYLEA 292

Query: 286 YEKITG 291
           Y  +TG
Sbjct: 293 YRLLTG 298


>gi|189202646|ref|XP_001937659.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187984758|gb|EDU50246.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 301

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 103/298 (34%), Positives = 168/298 (56%), Gaps = 30/298 (10%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHH--- 66
           +LP   SGKVR+ Y + D T + +A+DR+SA+D  +   IP KG +L  ++ YWFHH   
Sbjct: 14  KLPKVASGKVRDLYAIDDDTLLFVASDRISAYDVIMENGIPGKGALLTAMSIYWFHHLPT 73

Query: 67  ----------TSDI---CSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTF 113
                     TS +    SN T D  D ++ V ++L++ PIE IVRGY+ G+  +    +
Sbjct: 74  QVPGLKTHFLTSSLPAALSNQT-DLKDRSMQV-RRLRILPIESIVRGYITGSGWSE---Y 128

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
            K+G   +    +P  + + QKLP P+ TP+TK+     G D+ ISP E     I     
Sbjct: 129 TKSGT--VNGIKMPTGLIEGQKLPEPLWTPSTKAD--VGGKDENISP-EKARELIGDEKV 183

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
            + +   +L++++   + A E G+IL D+K+EFG+D+   ++L DE+ TPDSSR+W  E+
Sbjct: 184 AKKVEELSLAIYQAAAERAEEVGIILADTKFEFGVDEGSEVVLVDEVLTPDSSRFWPKES 243

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           +E +   G      DK F+R+W+ +     ++ +  +PE+++ RT+  Y  A EK+TG
Sbjct: 244 WESNL--GKAQPSFDKQFLRDWLTSNGLKGKEGV-KVPEDVVERTAAKYREACEKLTG 298


>gi|284993125|ref|YP_003411680.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geodermatophilus obscurus DSM 43160]
 gi|284066371|gb|ADB77309.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Geodermatophilus obscurus DSM 43160]
          Length = 287

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 92/295 (31%), Positives = 160/295 (54%), Gaps = 25/295 (8%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVRE Y   +   + +A+DR+SA+D  +   IP KG VL Q++ +WF   + +
Sbjct: 5   LPLVARGKVREVYDAGEDRLLLVASDRISAYDHVLPTPIPDKGRVLTQLSVWWFDQLAPV 64

Query: 71  -----CSNHTL---DYPDP---NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
                 S+H L   D P P     ++ ++L+M P+E + RGYL+G+     + + + G  
Sbjct: 65  LASSGASHHLLSASDVPAPVAGRAMLVRRLEMLPVECVARGYLSGS---GTVEYQRTGS- 120

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            I +  LP  + +  +LP PV TP+TK+ +     D+ I    ++    +   + E +  
Sbjct: 121 -IRDVPLPAGLVEGSELPEPVFTPSTKAEQGEH--DEAIDFAAVV--AAVGSERAEQLRE 175

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L+L+ RG ++AL+ G++L D+K+EFG+     ++L DE+ TPDSSR+W    +     
Sbjct: 176 LTLALYRRGAEIALDAGIVLADTKFEFGLGPDGGLVLGDEVLTPDSSRFWPATLWSPG-- 233

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            G+ P   DK ++R+W+ +         P++P +++  T + Y+ AYE++TG  F
Sbjct: 234 -GVQP-SYDKQYVRDWLTSSGWDRVSPPPELPADVVEATRERYVTAYERLTGTAF 286


>gi|114776739|ref|ZP_01451782.1| phosphoribosylaminoimidazole-succinocarboxamide (SAICAR) synthetase
           [Mariprofundus ferrooxydans PV-1]
 gi|114552825|gb|EAU55256.1| phosphoribosylaminoimidazole-succinocarboxamide (SAICAR) synthetase
           [Mariprofundus ferrooxydans PV-1]
          Length = 293

 Score =  165 bits (417), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 104/306 (33%), Positives = 159/306 (51%), Gaps = 28/306 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQI 59
           M  +  A I  L   +SGKVR+ Y + +   + + TDRLSAFD  +   IP KG+VLN +
Sbjct: 1   MDAMMHADIKSLKLLHSGKVRDMYEIDENHLLIVTTDRLSAFDVVLPTPIPGKGQVLNAV 60

Query: 60  TQYWFHHTSDICSNHTLDY------PDPN--------VLVGQQLQMFPIELIVRGYLAGN 105
           + +WF   + I  NHT         PD +         +V ++LQ  PIE IVRGYL G+
Sbjct: 61  SDFWFEKLAHILPNHTATMTLEEAIPDADERERVRSHAIVVKRLQPLPIEAIVRGYLIGS 120

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
             +    + K G   +    LP+ +    KLP P+ TP+TK++      D+ I  + +  
Sbjct: 121 GWSE---YQKQGS--VCGIALPEGLPLAGKLPEPLFTPSTKAA--VGEHDENIDFDRMC- 172

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
            GI+       +   +L L++     AL  G+I+ D+K+EFG+D+  N+ L DE+ TPDS
Sbjct: 173 -GIVGTELATKMRDVSLQLYKEAAAFALTKGIIIADTKFEFGLDQDGNLTLIDEVLTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W V  Y+     GI+P   DK F+R+W+ T     +   P +P +I  +TS  Y  A
Sbjct: 232 SRFWPVSDYQP----GISPPSFDKQFVRDWLETLTWNKQSPGPAVPADIAEKTSAKYAEA 287

Query: 286 YEKITG 291
             ++T 
Sbjct: 288 LARLTA 293


>gi|323141460|ref|ZP_08076349.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Phascolarctobacterium sp. YIT 12067]
 gi|322414040|gb|EFY04870.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Phascolarctobacterium sp. YIT 12067]
          Length = 291

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 109/304 (35%), Positives = 168/304 (55%), Gaps = 33/304 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           + E   + SGKVRE Y + D + I +ATDR+SAFD  +   I  KG VL QI+++WF  T
Sbjct: 1   MQEYKPFKSGKVREMYDVGD-SIIMVATDRISAFDHILKNMIVKKGTVLTQISKFWFDLT 59

Query: 68  SDICSNH-----TLDYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
            DI  NH     T D P+         N +  ++L M PIE IVRGY+ G+   S   + 
Sbjct: 60  KDIVPNHMISVDTKDMPEFFQKPEFTGNSMKCKKLNMLPIECIVRGYITGSGWDS---YK 116

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSS----ESASGCDQPISPNEIIHRGILT 170
           K G+  I    LP+ + ++QKL  P+ TP+TK+     +     +Q I   E ++ G   
Sbjct: 117 KTGE--ICGIKLPEGLQESQKLAEPIFTPSTKAEIGDHDENISVEQSIEILEKLYPG-RG 173

Query: 171 RNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWE 230
           +     +  Y ++++++    ALE G+I+ D+K+EFG+D+   ++L DE+ TPD SR+W 
Sbjct: 174 KEYALKLRDYTIAIYKKCAAYALERGIIIADTKFEFGLDENGEVVLGDEMITPDCSRFWP 233

Query: 231 VETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           +E Y    + G      DK F+R+W+    NP  D   ++P+++I +T   YI AYE +T
Sbjct: 234 LEGY----KVGQGQPSYDKQFVRDWL--SANP--DAGYELPQDVIDKTIGKYIEAYELLT 285

Query: 291 GLKF 294
           G KF
Sbjct: 286 GQKF 289


>gi|326203382|ref|ZP_08193247.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium papyrosolvens DSM 2782]
 gi|325986640|gb|EGD47471.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium papyrosolvens DSM 2782]
          Length = 298

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 107/304 (35%), Positives = 159/304 (52%), Gaps = 32/304 (10%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSD 69
           +LP +  GKVR  Y L D   I + TDR+SAFD      IP KG VLN I+ +WF  T D
Sbjct: 10  KLPLFVKGKVRNVYDLGDQLLIVV-TDRISAFDVVFDELIPNKGTVLNSISAFWFDFTKD 68

Query: 70  ICSNHTL-----DYPDP----------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           +  NH +      YP              ++ +++QM P E IVRGYL G   + L  + 
Sbjct: 69  VIGNHVITTDVDKYPKELSAFKDELQGRSMLVKKVQMLPAECIVRGYLEG---SGLKEYQ 125

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           K G   +    LP  +    KLP P+ TP+TK SE   G D  +S   +  +  L   Q 
Sbjct: 126 KTGT--VCGIKLPAGLKQADKLPEPIFTPSTKESE---GHDINVSFEVLCEKIGLEMAQ- 179

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +   +L L+E+  K A   GLIL D+K+EFG+   + +++ DE+ TPDSSR+W ++ Y
Sbjct: 180 -KLKDASLKLYEKASKHAESKGLILADTKFEFGMLDGE-LVVGDEMFTPDSSRFWAMDEY 237

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
           +     G      DK ++R ++ +     +   P++P+ +I +T + Y+ AYE+ITG KF
Sbjct: 238 QP----GRAQKSFDKQYLREYLESITWDKQPPAPELPKEVIRKTEEKYVEAYERITGKKF 293

Query: 295 IADN 298
             DN
Sbjct: 294 QGDN 297


>gi|260424817|ref|ZP_05733383.2| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Dialister
           invisus DSM 15470]
 gi|260403284|gb|EEW96831.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Dialister
           invisus DSM 15470]
          Length = 288

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 109/309 (35%), Positives = 169/309 (54%), Gaps = 39/309 (12%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           + K Y P    + SGKVRE Y L D + I + TDR+SAFD  +   IP KGEVLN+++++
Sbjct: 1   MMKEYKP----FKSGKVRELYDLGD-SLIMVCTDRISAFDNILENPIPKKGEVLNKMSKF 55

Query: 63  WFHHTSDICSNHTL-----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTS 109
           WF  T D+  NH +     D P        D N +  Q+L+M P+E IVRGY+ G+   S
Sbjct: 56  WFDFTKDVVPNHMISIDAADMPAFFRKPEFDGNSMKTQKLEMIPVECIVRGYITGSGWES 115

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN-EIIHRGI 168
              + K+G   I    LP+ + + +KLP  + TP+TK+       +  +    E I +  
Sbjct: 116 ---YKKDGT--ICGIRLPEGLEECEKLPEAIFTPSTKAPVGEHDMNISMEEGAEWIEKTF 170

Query: 169 LTRNQ--WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             + +   E +    L+L+ +    AL  G+I+ D+K+EFG+DK+ NI+L DE+ TPD+S
Sbjct: 171 PGKGKEYMERLRDLTLALYRKCADYALSKGIIIADTKFEFGLDKEGNIVLGDEMLTPDNS 230

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDI-PENIILRTSQTYIAA 285
           R+W ++ Y      G      DK F+R+++       ++N  D+ P+ II +T   Y+ A
Sbjct: 231 RFWPLDGYAP----GKGQPSYDKQFVRDYL-------KENPGDVLPQEIIDKTIGKYVEA 279

Query: 286 YEKITGLKF 294
           YE +TG KF
Sbjct: 280 YELLTGEKF 288


>gi|125975366|ref|YP_001039276.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum ATCC 27405]
 gi|256005488|ref|ZP_05430450.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum DSM 2360]
 gi|281419326|ref|ZP_06250341.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum JW20]
 gi|125715591|gb|ABN54083.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum ATCC 27405]
 gi|255990543|gb|EEU00663.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum DSM 2360]
 gi|281406946|gb|EFB37209.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum JW20]
 gi|316939481|gb|ADU73515.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium thermocellum DSM 1313]
          Length = 294

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 115/302 (38%), Positives = 163/302 (53%), Gaps = 36/302 (11%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSD 69
           +LP Y  GKVR  Y L D   I + TDR+SAFD      IP KG+VLN I+++WF +T D
Sbjct: 10  DLPLYIKGKVRNVYDLGDKLLIVV-TDRISAFDVVFPNLIPNKGKVLNGISKFWFDYTRD 68

Query: 70  ICSNHTL-----DYP----------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           I  NH +     +YP          +   ++ ++++M P E IVRGYL G    S L  Y
Sbjct: 69  IVDNHVITTDVSEYPEGLSKFKEELEGRSMLVKKIKMIPAECIVRGYLEG----SGLKDY 124

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQ 173
           K     I    LP+ +    KLP P+ TP+TK +E   G DQ +S   + +  G     +
Sbjct: 125 K-ATGSICGIKLPEGLRQADKLPEPIFTPSTKETE---GHDQNVSFEGLCNAIGTELATK 180

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGI-DKKQNIILADEIHTPDSSRYWEVE 232
              IS   L+L+E+  K A   G+IL D+K+EFGI D K  I+L DE+ TPDSSR+W++ 
Sbjct: 181 LRDIS---LALYEKASKYAESRGIILADTKFEFGILDGK--IVLGDELFTPDSSRFWDMN 235

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGL 292
            YE     G      DK F+R ++ +     +   P +P++++  T   YI AYE+ITG 
Sbjct: 236 EYEP----GRAQKSFDKQFVREYLESIGWDKKPPAPTLPDDVVKNTELKYIEAYERITGN 291

Query: 293 KF 294
           KF
Sbjct: 292 KF 293


>gi|325067828|ref|ZP_08126501.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Actinomyces oris K20]
          Length = 316

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 95/300 (31%), Positives = 166/300 (55%), Gaps = 30/300 (10%)

Query: 9   IPELPNYYSGKVRENYF-LSDG------TRITIATDRLSAFDQNIAC-IPYKGEVLNQIT 60
           +P   +  SGKVR+ Y   SDG        + +A+DR+SA+D  +A  IP KG+VL  ++
Sbjct: 24  VPGWEHRSSGKVRDVYAPTSDGPWGGQDVLLVVASDRISAYDHILATPIPDKGKVLTALS 83

Query: 61  QYWFHHTSDICSNH--TLDYPDP---NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   +D+  NH  +LD P       ++ ++L+M+P+E + RGYL G    S L  Y+
Sbjct: 84  AWWFEQLADVVPNHLVSLDVPAQVAGRAMICRRLEMYPVECVARGYLTG----SGLVEYR 139

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
              R +    LP+ +++  +LP P+ TP  K+       D+ ++   ++   ++  +   
Sbjct: 140 Q-SRSVCGVALPEGLTEASRLPEPIFTPAAKAELGEH--DENVTFERVVQ--MVGDSAAT 194

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L+L+ R  ++A + G+IL D+K+E G D    +IL DE+ TPDSSR+W  + +E
Sbjct: 195 ALRETTLALYSRAAEIARDRGIILADTKFELGTDADGELILGDEVLTPDSSRFWPADAWE 254

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPY-RDN---IPDIPENIILRTSQTYIAAYEKITG 291
                 +TP   DK ++R+W+ +  + + RD     P +P++++ RT   Y+ AYE++TG
Sbjct: 255 PGR---VTP-SFDKQYVRDWLTSPASGWDRDGGQEPPALPDDVVERTRARYLEAYERLTG 310


>gi|257790035|ref|YP_003180641.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Eggerthella lenta DSM 2243]
 gi|317489478|ref|ZP_07947988.1| saicar synthetase [Eggerthella sp. 1_3_56FAA]
 gi|257473932|gb|ACV54252.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Eggerthella lenta DSM 2243]
 gi|316911407|gb|EFV33006.1| saicar synthetase [Eggerthella sp. 1_3_56FAA]
          Length = 292

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 159/294 (54%), Gaps = 32/294 (10%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVR+ Y L D   + +ATDR+SAFD  +   IP+KG VL Q++ +WF     +  NH +
Sbjct: 12  GKVRDLYDLGD-KLLLVATDRISAFDYILEDEIPHKGAVLTQLSCFWFELLDGVVENHLI 70

Query: 77  ---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
                          DY     ++ ++  MFP E IVRGYLAG   + L  + K G   +
Sbjct: 71  SSDVADLPEQFQPYADYLRGRFMLVKKADMFPAECIVRGYLAG---SGLKEYQKQGT--V 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LP+ + ++ KLP P+ TP+TK+       D+ IS   ++   I+  +    +   A
Sbjct: 126 CGIQLPEGLVNSSKLPEPIFTPSTKAE--IGDHDENISYERLVE--IIGEDDASQLRDLA 181

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L ++      A E G+I+ D+K+EFG    Q IILADE+ TPDSSR+W  + Y     EG
Sbjct: 182 LKVYTTARDHAAERGVIIADTKFEFGRLNGQ-IILADEVLTPDSSRFWPGDEYA----EG 236

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
                 DK F+R+W+    +  + N+P +P++II RTS+ YI AYEKITG  F+
Sbjct: 237 KDQPSFDKQFVRDWLNANWD-RQGNLPRLPQDIIDRTSEKYIQAYEKITGRTFV 289


>gi|227541026|ref|ZP_03971075.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glucuronolyticum ATCC 51866]
 gi|227183286|gb|EEI64258.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glucuronolyticum ATCC 51866]
          Length = 297

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/309 (33%), Positives = 165/309 (53%), Gaps = 46/309 (14%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           PEL  Y    +GKVRE Y + D T + + +DR+SA+D  + + IP KG VL  ++ Y+F 
Sbjct: 3   PELSAYEHFSAGKVREIYEVDDETLLLVTSDRISAYDYILDSEIPDKGRVLTAMSNYFFE 62

Query: 66  HTSDICSNHTLDYPD-----------PNVLVGQ-----QLQMFPIELIVRGYLAGNTKTS 109
           H         LD+P+           P  ++G+     +L M P E + RGYL G   ++
Sbjct: 63  H---------LDFPNHLAGPIDDERIPEEVLGRAMVCHKLNMLPFECVARGYLTG---SA 110

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
           L+ + + G     E  LPD + +  +LP P+ TP TK+       D+ +S   ++ +  L
Sbjct: 111 LVEYQEKGSVCGIE--LPDGLKEASRLPEPIFTPATKADYGEH--DENVSFEAVVEK--L 164

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
                  +    L L+ +G ++A+  G+I+ D+K+EFG+D+   + LADE+ TPDSSRYW
Sbjct: 165 GEKLATQLRDATLDLYTQGAEIAIAKGVIVADTKFEFGLDENGTLTLADEVLTPDSSRYW 224

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAA 285
           + +TY     EG      DK ++RNW+    + +     DN P +P +++  T + YI A
Sbjct: 225 DADTY----VEGKVQPSFDKQYLRNWLTGPDSGWDRASGDNPPSLPGSVVEATRERYIEA 280

Query: 286 YEKITGLKF 294
           YE+ITG KF
Sbjct: 281 YERITGTKF 289


>gi|227489432|ref|ZP_03919748.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glucuronolyticum ATCC 51867]
 gi|227090610|gb|EEI25922.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glucuronolyticum ATCC 51867]
          Length = 297

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/309 (33%), Positives = 165/309 (53%), Gaps = 46/309 (14%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           PEL  Y    +GKVRE Y + D T + + +DR+SA+D  + + IP KG VL  ++ Y+F 
Sbjct: 3   PELSAYEHFSAGKVREIYEVDDETLLLVTSDRISAYDYILDSEIPDKGRVLTAMSNYFFE 62

Query: 66  HTSDICSNHTLDYPD-----------PNVLVGQ-----QLQMFPIELIVRGYLAGNTKTS 109
           H         LD+P+           P  ++G+     +L M P E + RGYL G   ++
Sbjct: 63  H---------LDFPNHLAGPIDDQRIPEEVLGRAMVCHKLNMLPFECVARGYLTG---SA 110

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
           L+ + + G     E  LPD + +  +LP P+ TP TK+       D+ +S   ++ +  L
Sbjct: 111 LVEYQEKGSVCGIE--LPDGLKEASRLPEPIFTPATKADYGEH--DENVSFEAVVEK--L 164

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
                  +    L L+ +G ++A+  G+I+ D+K+EFG+D+   + LADE+ TPDSSRYW
Sbjct: 165 GEKLATQLRDATLDLYTQGAEIAIAKGVIVADTKFEFGLDENGTLTLADEVLTPDSSRYW 224

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAA 285
           + +TY     EG      DK ++RNW+    + +     DN P +P +++  T + YI A
Sbjct: 225 DADTY----VEGKVQPSFDKQYLRNWLTGPDSGWDRASGDNPPSLPGSVVEATRERYIEA 280

Query: 286 YEKITGLKF 294
           YE+ITG KF
Sbjct: 281 YERITGTKF 289


>gi|72163414|ref|YP_291071.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermobifida fusca YX]
 gi|123628549|sp|Q47KH4|PUR7_THEFY RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|71917146|gb|AAZ57048.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thermobifida fusca YX]
          Length = 307

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 156/297 (52%), Gaps = 27/297 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  + +A+DR+SAFD  +   IP KG +L Q++ +WF   
Sbjct: 13  VPGLTHLHTGKVRDLYATESGELVMVASDRVSAFDWVLPTEIPDKGRLLTQLSLWWFDQL 72

Query: 68  SDICSNHTL-DYPDPNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           SDI  NH + D P P          LV ++L M P+E + RGYL G+    L  +   G 
Sbjct: 73  SDIIDNHVISDTPPPGAPDDWAGRTLVCRRLDMVPVECVARGYLTGS---GLAEYTATGA 129

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
             +    LP+ + D  +L  P+ TP TK+       D+ +S   +  R        E + 
Sbjct: 130 --VCGVRLPEGLVDGSRLDPPIFTPATKAEVGEH--DENVSLETVAERHGPALA--ERLR 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L+L+ERG ++A E G++L D+K+EFG D   +++LADE+ TPDSSR+W  E +    
Sbjct: 184 EVTLALYERGREIAEERGILLADTKFEFGWDSDGSLVLADEVLTPDSSRFWPKEEW---- 239

Query: 239 REGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITG 291
           R G      DK  IR+W+ +  + +        P +P+ ++  T   YI  +E++TG
Sbjct: 240 RPGRPQPSFDKQIIRDWLSSAESGWDRTSETPPPPLPDTVVEHTRARYIEVFERLTG 296


>gi|269957903|ref|YP_003327692.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xylanimonas cellulosilytica DSM 15894]
 gi|269306584|gb|ACZ32134.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xylanimonas cellulosilytica DSM 15894]
          Length = 307

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 163/312 (52%), Gaps = 43/312 (13%)

Query: 10  PELPNY---YSGKVRENYFLSDGTR-------ITIATDRLSAFDQNIAC-IPYKGEVLNQ 58
           P+LP +   YSGKVR+ Y    G         + +A+DR+SA+D  +A  IP KG VL Q
Sbjct: 5   PDLPGWKHVYSGKVRDLYEPDLGAAHPLGDVVLVVASDRISAYDHVLATPIPGKGVVLTQ 64

Query: 59  ITQYWFHHTSDICSNHTL---------DYPDPNVLVG-----QQLQMFPIELIVRGYLAG 104
           ++ +WF   +D+  NH +         D   P  + G     ++L M+P+E +VRGYL G
Sbjct: 65  LSLWWFEQLADVVPNHVVSVEVSATPSDGLVPAAVAGRAMVCKRLDMYPVECVVRGYLTG 124

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
           +    L  +  +G+  +    LP  + D  +LP P+ TP TK+       + P S   ++
Sbjct: 125 S---GLAEYRSSGE--VTGLPLPAGLVDGSRLPEPIFTPATKAEVGEHDENVPFS--AVV 177

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTP 223
            R  L +    T+    L+++ER   +A E G+IL D+K EFG+D     ++L DE+ TP
Sbjct: 178 ER--LGQQTATTLRDLTLAVYERAEAIARERGIILADTKLEFGVDPATGAVVLGDEVLTP 235

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTS 279
           DSSR+W V+ +E     G      DK ++R+W+ +  + +     D  P +P +++  T 
Sbjct: 236 DSSRFWPVDGWEP----GRAQPSFDKQYVRDWLTSPASGWDRTGADAPPALPADVVEPTR 291

Query: 280 QTYIAAYEKITG 291
             Y+ AYE++TG
Sbjct: 292 ARYLEAYERLTG 303


>gi|269124467|ref|YP_003297837.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Thermomonospora curvata DSM 43183]
 gi|268309425|gb|ACY95799.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Thermomonospora curvata DSM 43183]
          Length = 285

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 97/297 (32%), Positives = 162/297 (54%), Gaps = 27/297 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           + + +SGKVR+ Y L  G  + +A D +SA+D  +   IP KG++L Q++ +WF   +D+
Sbjct: 1   MKHLHSGKVRDLYELPGGELLMVARDTISAYDFVLEPVIPDKGKILTQLSLWWFEQLADV 60

Query: 71  CSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
             NH +    P+          +V ++L+M P+E + RGYL G   + L  + ++G   +
Sbjct: 61  VPNHVISTELPDGAPAEWAGRAVVVRRLEMVPVECVARGYLTG---SGLKEYRRSGS--V 115

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LP+ + D  KLP P+ TPTTK++  A   D+P++  E++    +     E +    
Sbjct: 116 CGVPLPEGLVDGSKLPEPIFTPTTKAALGAH--DEPMTFAEVVS--AVGAEVAERLREVT 171

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           + ++ RG +LA E G+I+ D+K E G   +  ++LADE+ TPDSSR+W  + +      G
Sbjct: 172 VEIYRRGARLAAERGIIVADTKIELGWSPEGELVLADEVLTPDSSRFWPADRWAPG---G 228

Query: 242 ITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
             P   DK F+R+W+ +    +     D  P +P +I+ RT   YI AYE++TG  F
Sbjct: 229 PQP-SFDKQFVRDWLTSAEAGWDRASGDPPPPLPPHIVERTRAKYIEAYERLTGRAF 284


>gi|309811760|ref|ZP_07705536.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Dermacoccus sp. Ellin185]
 gi|308434283|gb|EFP58139.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Dermacoccus sp. Ellin185]
          Length = 297

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 99/304 (32%), Positives = 162/304 (53%), Gaps = 33/304 (10%)

Query: 11  ELPNY---YSGKVRENY--FLSDGT-----RITIATDRLSAFDQNIAC-IPYKGEVLNQI 59
           ELP Y   YSGKVR+ Y    +DG       + +A+DR+SAFD  ++  IP KG+VL Q+
Sbjct: 6   ELPGYAHVYSGKVRDLYAPLDADGKPRDDQVLLVASDRISAFDFILSTPIPDKGKVLTQL 65

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + +WF   +D+  NH +    P+ + G     ++L M P+E I R YL G     L  + 
Sbjct: 66  SLWWFEQMADLVPNHVVSTDVPDAVAGRAVLVERLDMVPLEAIARAYLTGG---GLAEYR 122

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
             G   +    LPD + D  KL  P+ TPT+K+       D+ ++ +E +   ++ R + 
Sbjct: 123 ATGA--VCGVALPDGLVDASKLETPIFTPTSKAE--IGDHDESMTFDEAVM--LVGRERA 176

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
           + +    + +  RG ++A E G+++ D+K EFG+     ++LADE+ TPDSSR+W     
Sbjct: 177 DEMRDLTVRILGRGNEIAAERGILIADTKVEFGVRADGTLVLADELLTPDSSRFWPA--- 233

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKIT 290
             S++ G      DK F+R+W+ +  + +     +  P +P++I+  T   YI AYE +T
Sbjct: 234 -ASWQPGRAQDSYDKQFVRDWLTSPASGWDKSSGEQPPALPDDIVAATRAKYIEAYEALT 292

Query: 291 GLKF 294
           G  F
Sbjct: 293 GRTF 296


>gi|328947392|ref|YP_004364729.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Treponema
           succinifaciens DSM 2489]
 gi|328447716|gb|AEB13432.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Treponema
           succinifaciens DSM 2489]
          Length = 281

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/292 (33%), Positives = 160/292 (54%), Gaps = 28/292 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           +  Y SGKVRE Y L DG  + + TDR+SAFD  +   I  KG+VLN +  +WF +T DI
Sbjct: 1   MKKYASGKVREVYDLEDGRMVIVTTDRISAFDVILPTMITDKGKVLNALANFWFDYTKDI 60

Query: 71  CSNHTL-----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH +     D P        +   ++ ++L+M P E+IVRGY+ G    S+   YK G
Sbjct: 61  VKNHMISSDLKDMPAEFQKPEFEGRTILVKKLKMIPYEVIVRGYMFG----SMYEAYKKG 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           +     +         +KL  P++TP+TK++E   G D  ++ + +  +  L       I
Sbjct: 117 E-PFLGHKFEKEYQQAEKLDEPIVTPSTKAAE---GHDINVTLDYM--KKDLGEELGTKI 170

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              AL+++++  + A +NG+I+ D+K+EFG+D+   ++L DE+ TPDSSR+W++  Y   
Sbjct: 171 EKAALAIYKKCYEHAYKNGIIIADTKFEFGLDENGELVLGDEVLTPDSSRFWDLSKY--- 227

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKI 289
            + G +P   DK F+R+W+         NI +IP +++ +TS  Y    +KI
Sbjct: 228 -KVGGSPASYDKQFVRDWLKENNLAGDPNIKEIPADVVAKTSAIYKECEKKI 278


>gi|295102303|emb|CBK99848.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Faecalibacterium prausnitzii L2-6]
          Length = 289

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 106/296 (35%), Positives = 169/296 (57%), Gaps = 35/296 (11%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRE Y   D + I +ATDR+SAFD  +   +  KG+VL Q++++WF +T D+  NH L
Sbjct: 10  GKVREIYDNGD-SLIMVATDRISAFDVILKNKVTNKGKVLTQMSKFWFDYTRDLLPNHML 68

Query: 77  D---------YPDPNV----LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
                     +  P      ++ ++L M P+E IVRGY+ G+   S   + K GK  +  
Sbjct: 69  SVDVKEMPEFFRQPQYEGRSMMCRKLTMLPVECIVRGYITGSGWAS---YQKTGK--VCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSS----ESASGCDQPISPNEIIHRGILTRNQWET-IS 178
             LP+ + +++KLP P+ TP+TK+     +     +Q I   E +  G     ++ T + 
Sbjct: 124 IQLPEGLKESEKLPEPIYTPSTKAEIGDHDENISYEQSIDVLEKLFPG--KGEEYATKLR 181

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y ++L+++  + AL  G+I+ D+K+EFG+D++ ++IL DE+ TPDSSR+W +E YE   
Sbjct: 182 DYTIALYKKCAEYALSRGIIIADTKFEFGLDEEGSVILGDEMLTPDSSRFWPLEGYEA-- 239

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
             G      DK F+RNW+L   NP  D+  D+P+++I +T   Y  AYE +TG K 
Sbjct: 240 --GHGQPSFDKQFVRNWLL--ANP--DSDYDLPQDVIDKTIAKYEEAYEMLTGKKL 289


>gi|238923898|ref|YP_002937414.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Eubacterium rectale ATCC 33656]
 gi|238875573|gb|ACR75280.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Eubacterium rectale ATCC 33656]
 gi|291524503|emb|CBK90090.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Eubacterium rectale DSM 17629]
          Length = 291

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 173/308 (56%), Gaps = 41/308 (13%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           + E   +  GKVRE Y   D + I +ATDR+SAFD  +   I  KG +L Q++++WF  T
Sbjct: 1   MQEFKPFKEGKVREVYDNGD-SLIMVATDRISAFDHILKNKITDKGAILTQMSKFWFEFT 59

Query: 68  SDICSNHTL-----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
            D+  NH +     D P+         N ++ ++L+M PIE IVRGY+ G   +   ++ 
Sbjct: 60  KDVVPNHMISVDAKDMPEFFGQDRFNGNSMLCKKLEMLPIECIVRGYITG---SGWASYQ 116

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH--------R 166
           +NG   +    LP+ + ++ KLP P+ TP+TK+       D+ IS  + +         +
Sbjct: 117 ENGT--VCGIRLPEGLVESDKLPEPIYTPSTKAD--LGDHDENISFEKSVEVLEKIYPEK 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
           G   R   E I  Y ++L+++  + AL  G+I+ D+K+EFG++++  ++LADE+ TPDSS
Sbjct: 173 G---REYAEKIRDYTIALYKKCAEYALTKGIIIADTKFEFGLNEQGEVVLADEMLTPDSS 229

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W ++ Y    + G      DK ++R+W+  + NP  DN   +P+ ++++T + Y  A+
Sbjct: 230 RFWPLDGY----KPGQGQPSFDKQYVRDWL--KANP--DNDLLLPDEVVVKTVEKYKEAF 281

Query: 287 EKITGLKF 294
           E +TG KF
Sbjct: 282 ELLTGSKF 289


>gi|296804288|ref|XP_002842996.1| phosphoribosyl-aminoimidazole-succinocarboxamide synthase
           [Arthroderma otae CBS 113480]
 gi|238845598|gb|EEQ35260.1| phosphoribosyl-aminoimidazole-succinocarboxamide synthase
           [Arthroderma otae CBS 113480]
          Length = 299

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 111/302 (36%), Positives = 169/302 (55%), Gaps = 33/302 (10%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWF------ 64
           LP    GKVR+ Y +SDGT + I+TDR+SAFD+ +   IP KG +L  +T YW       
Sbjct: 10  LPLVSRGKVRDIYQISDGTLLFISTDRISAFDELMENGIPNKGHILTALTVYWLKFLTGA 69

Query: 65  ------HHTS-DICSN---HTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
                 H  S DI +       +Y     LV ++L++FP+E IVRGYLAG   ++ L + 
Sbjct: 70  LPSLRTHLVSVDIPAGVPESAREYAKNRSLVVRRLKVFPVEAIVRGYLAG---SAWLEYQ 126

Query: 115 KNGKRKIYEYLLPDNMSDNQKLP-YPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
           ++G   ++   LP  + ++ K+P  P+ TP+TK+ +   G DQ I P++     I+    
Sbjct: 127 ESG--TVHGIPLPAGLVESDKIPDGPLFTPSTKAEQ--GGHDQNIHPDQAAD--IVGAAY 180

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVE 232
            E I + A+ L+E     AL+ G+I+ D+K+EFG D+  N I+L DE+ TPDSSR+W ++
Sbjct: 181 AEDIKAVAIRLYELASFHALQRGIIIADTKFEFGHDEVTNEIVLIDEVLTPDSSRFWSLD 240

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGL 292
            YE     G      DK F+R+W LT+          +P++++ +T Q YI AYE +TG 
Sbjct: 241 KYEP----GKPQDSFDKQFLRDW-LTKEGLKGKKGTVMPDDVVSKTEQKYIEAYEMLTGQ 295

Query: 293 KF 294
            F
Sbjct: 296 TF 297


>gi|291527928|emb|CBK93514.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Eubacterium rectale M104/1]
          Length = 291

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 173/308 (56%), Gaps = 41/308 (13%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           + E   +  GKVRE Y   D + I +ATDR+SAFD  +   I  KG +L Q++++WF  T
Sbjct: 1   MQEFKPFKEGKVREVYDNGD-SLIMVATDRISAFDHILKNKITDKGAILTQMSKFWFEFT 59

Query: 68  SDICSNHTL-----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
            D+  NH +     D P+         N ++ ++L+M PIE IVRGY+ G   +   ++ 
Sbjct: 60  KDVVPNHMISVDAKDMPEFFGQDRFNGNSMLCKKLEMLPIECIVRGYITG---SGWASYK 116

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH--------R 166
           +NG   +    LP+ + ++ KLP P+ TP+TK+       D+ IS  + +         +
Sbjct: 117 ENGT--VCGIRLPEGLVESDKLPEPIYTPSTKAD--LGDHDENISFEKSVEVLEKIYPEK 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
           G   R   E I  Y ++L+++  + AL  G+I+ D+K+EFG++++  ++LADE+ TPDSS
Sbjct: 173 G---REYAEKIRDYTIALYKKCAEYALTKGIIIADTKFEFGLNEQGEVVLADEMLTPDSS 229

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W ++ Y    + G      DK ++R+W+  + NP  DN   +P+ ++++T + Y  A+
Sbjct: 230 RFWPLDGY----KPGQGQPSFDKQYVRDWL--KANP--DNDLLLPDEVVVKTVEKYKEAF 281

Query: 287 EKITGLKF 294
           E +TG KF
Sbjct: 282 ELLTGSKF 289


>gi|302552512|ref|ZP_07304854.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces viridochromogenes DSM 40736]
 gi|302470130|gb|EFL33223.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces viridochromogenes DSM 40736]
          Length = 299

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 159/300 (53%), Gaps = 28/300 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVRE Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRELYQNEAGDLVMVASDRISAYDWVLPTEIPDKGRVLTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH L    P           LV + LQM P+E + RGYL G    S L  Y+   
Sbjct: 73  ADLVPNHVLSTELPAGAPADWEGRTLVCKSLQMVPVECVARGYLTG----SGLVEYEE-T 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP+ + D  +LP P+ TP TK++      D+ +S  E+  +  +  +    + 
Sbjct: 128 RTVCGLALPEGLVDGSELPAPIFTPATKAAVGEH--DENVSYEEVARQ--VGADTAARLR 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L+++ RG  +A E G+IL D+K+EFG D   +++LADE+ T DSSR+W  + ++   
Sbjct: 184 QATLAVYSRGRDIARERGIILADTKFEFGFD-GDDLVLADEVLTADSSRFWPADQWQP-- 240

Query: 239 REGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
             G      DK F+R+W+ +  + +        P +P+ ++  T   Y+ AYE++TG  +
Sbjct: 241 --GRAQPSYDKQFVRDWLTSAESGWDRKSEQPPPALPQQVVDATRAKYVEAYERLTGTSW 298


>gi|160896448|ref|YP_001562030.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Delftia
           acidovorans SPH-1]
 gi|160362032|gb|ABX33645.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Delftia
           acidovorans SPH-1]
          Length = 307

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 101/307 (32%), Positives = 161/307 (52%), Gaps = 28/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L  + I  LP    GKVR+NY + D   + +A+DRLSAFD  +   IP KGE+L Q+  +
Sbjct: 10  LHTSNIASLPLLARGKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGELLTQMALF 69

Query: 63  WFHHTSDICSNH-TLDYPD--------PNV----LVGQQLQMFPIELIVRGYLAGNTKTS 109
           WF     IC NH T + P+        P V    ++ ++L+   IE +VRGYLAG    S
Sbjct: 70  WFDKLGHICPNHLTGEAPESVVTPAEVPQVTGRSMLVKRLKPVLIEAVVRGYLAG----S 125

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
               Y+   R +    LP+ +++  KLP P+ TP  K+       D+ I+    +   ++
Sbjct: 126 GWKEYQE-SRSVCGVPLPEGLTNAAKLPEPIYTPAAKAE--MGDHDENITYERTVE--MV 180

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
                  I   A+ +++    +ALE G+I+ D+K+EFG+D+   ++L DE+ TPDSSRYW
Sbjct: 181 GEKLASQIRDTAIRIYKEAAAIALEKGMIIADTKFEFGLDENGELVLMDEVLTPDSSRYW 240

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWI---LTRCNPY--RDNIPDIPENIILRTSQTYIA 284
            VE Y ++   G  P   DK F+R+W+        P+  +   P +P+ +  +T+  Y  
Sbjct: 241 PVEGYAQALANGENPPSYDKQFVRDWLEQAQVNGKPWDKKAPAPRLPQEVTEKTAAKYRE 300

Query: 285 AYEKITG 291
           A +++T 
Sbjct: 301 ALQRLTA 307


>gi|300784098|ref|YP_003764389.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Amycolatopsis mediterranei U32]
 gi|299793612|gb|ADJ43987.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Amycolatopsis mediterranei U32]
          Length = 280

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 160/291 (54%), Gaps = 20/291 (6%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           + + ++GKVR+ Y L  G  + +A+DR+S +D ++   IP KG++LNQ++ +WF   +D+
Sbjct: 1   MKHIHAGKVRDLYELDGGDILLVASDRVSVYDVSLPTPIPDKGKLLNQLSAWWFDRMADV 60

Query: 71  CSNHTLDYPD-PNVLVGQQ-----LQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
             NH +   D P    G+      L+M  +E I RGYLAG     L  + ++G+  I   
Sbjct: 61  VPNHVVSTTDVPEEFAGRAMRCKPLKMIQVECIARGYLAG---LGLREYQRDGR--ISGV 115

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            LP  + +  KLP P+ TPTTK S++  G D+ ++ +E+++   +  +  + +    L +
Sbjct: 116 ALPPGLVEGDKLPEPIFTPTTKISDT--GHDEFMTFDEVLNE--IGEDTAKRLRELTLEI 171

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITP 244
           + +G + A + G+I+ D+K EFG D    + L DE+ T DSSR+W  + +E     G   
Sbjct: 172 YTKGAEHAAKQGVIIADTKLEFGFDADGTLTLGDEVLTSDSSRFWPADAWEP----GRPQ 227

Query: 245 IGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
              DK F+R+W  +         P+IP +I+ +T Q Y   YE+ITG  ++
Sbjct: 228 HAFDKQFVRDWSRSTGWDQTPPGPEIPADIVEQTRQRYTEVYERITGKTWV 278


>gi|229828812|ref|ZP_04454881.1| hypothetical protein GCWU000342_00895 [Shuttleworthia satelles DSM
           14600]
 gi|229791975|gb|EEP28089.1| hypothetical protein GCWU000342_00895 [Shuttleworthia satelles DSM
           14600]
          Length = 291

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 107/300 (35%), Positives = 166/300 (55%), Gaps = 31/300 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           + EL     GKVRE Y   D   I  ATDR+SAFD  +   I  KG VL Q++++WF ++
Sbjct: 1   MSELKPMMEGKVREVYDNGDSI-IMYATDRISAFDVILKNKITGKGAVLTQMSKFWFDYS 59

Query: 68  SDICSNHTL-----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           SDI  NH L     D P           V+  ++L M PIE IVRGY+ G+   S   + 
Sbjct: 60  SDIVKNHMLSTDTADMPAFFHKPEFAGRVMKCKKLTMLPIECIVRGYITGSGWAS---YK 116

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN-EIIHRGILTRNQ 173
           +NG   +    LP+ + ++ KLP P+ TP+TK+       + P   + EI+ R    + +
Sbjct: 117 ENGM--VCGIRLPEGLKESDKLPEPIYTPSTKAQYGLHDENIPYEKSVEILERLYPGKGE 174

Query: 174 W--ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEV 231
                I  Y L+L+++    AL  G+I+ D+K+EFG+D+   ++LADE+ TPDSSR+W +
Sbjct: 175 AYAAKIRDYTLALYKKCADYALTRGIIIADTKFEFGLDENGELVLADEMLTPDSSRFWPL 234

Query: 232 ETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           E Y+     G +    DK ++R+W+  + NP  D +  +P+++I +T   Y+ AYE +TG
Sbjct: 235 EGYQP----GQSQPSFDKQYVRDWL--KANPKSDYL--LPDDVISKTIDKYLEAYELLTG 286


>gi|30913218|sp|Q9RHX2|PUR7_CORAM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|6705960|dbj|BAA89448.1| 5'-phosphoribosyl-4-N-succinocarboxamide-5-amino imidazole synth
           etase [Corynebacterium ammoniagenes]
          Length = 295

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 159/301 (52%), Gaps = 28/301 (9%)

Query: 10  PELPNYY---SGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWF- 64
           P+L +Y    SGKVR+ Y + D T + + TDR+SA+D  +   IP KG VL   T ++F 
Sbjct: 3   PQLSDYQHVSSGKVRDIYEVDDNTLLMVVTDRISAYDFALEPAIPDKGRVLTATTMFFFD 62

Query: 65  ------HHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
                 H    I      +      ++ ++L M P E + RGYL G   + L  +  NG 
Sbjct: 63  AIDFPNHLAGPIDDARIPEEVLGRAIIVKKLNMLPFECVARGYLTG---SGLKEYNANGT 119

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
               E  LP+ + +  +LP P+ TP TK+ +     D+ +S   ++    L + + E + 
Sbjct: 120 VCGIE--LPEGLVEASRLPEPIFTPATKAEQGDH--DENVSFERVVQD--LGQERAEQLR 173

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L ++    K+A E G+IL D+K+EFG+D + N++L DE+ TPDSSRYW  +TY    
Sbjct: 174 DETLRIYSAAAKIAEEKGIILADTKFEFGLDSEGNLVLGDEVLTPDSSRYWPADTYA--- 230

Query: 239 REGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            EGI     DK ++RNW+ +  + +        P +P++I+  T   YI AYE+++G +F
Sbjct: 231 -EGIVQPSFDKQYVRNWLTSEESGWDVESETQPPVLPDDIVAATRLRYIEAYERLSGKRF 289

Query: 295 I 295
           I
Sbjct: 290 I 290


>gi|328883874|emb|CCA57113.1| Phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Streptomyces venezuelae ATCC 10712]
          Length = 302

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 97/297 (32%), Positives = 158/297 (53%), Gaps = 28/297 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLTHLHTGKVRDLYRNEAGDLVMVASDRMSAYDWVLPSEIPDKGRVLTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           SD+  +H L    P            V + L M P+E + RGYL G   + LL + ++  
Sbjct: 73  SDLVPHHVLSTEVPAGAPADWAGRTTVCKSLNMVPVECVARGYLTG---SGLLEYDES-- 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP+ +SD  +LP P+ TP TK++      D+ +S  E+  +  +       + 
Sbjct: 128 RTVCGLALPEGLSDGSELPAPIFTPATKAA--VGDHDENVSYEEVARQ--VGAETAALLR 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L+++ R   +A + G+IL D+K+EFG D  + ++LADE+ TPDSSR+W  + +E   
Sbjct: 184 QSTLAVYGRARDIARDRGIILADTKFEFGFDG-ETLVLADEVLTPDSSRFWPADQWEP-- 240

Query: 239 REGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITG 291
             G      DK F+RNW+ +  + +        P +P+ I+  TS  Y+ AYE +TG
Sbjct: 241 --GRAQPSYDKQFVRNWLTSPASGWDRRSEQPPPALPQEIVEATSAKYVEAYELLTG 295


>gi|256828123|ref|YP_003156851.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Desulfomicrobium baculatum DSM 4028]
 gi|256577299|gb|ACU88435.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Desulfomicrobium baculatum DSM 4028]
          Length = 299

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 107/312 (34%), Positives = 168/312 (53%), Gaps = 40/312 (12%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M+I++K  I E P    GKVR+ Y +   T + + TDR+SAFD  +   IPYKG VLNQI
Sbjct: 1   MKIVTKTKIREFPLLSRGKVRDIYEIDPQTLLIVTTDRMSAFDVIMNEPIPYKGVVLNQI 60

Query: 60  TQYWFHHTSDICSNHTL-----DYP----------DPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W     D+ +NH L     D+P          +   +V ++ +  PIE IVRGYL G
Sbjct: 61  TLFWMDAFKDLAANHLLATDVRDFPAALAPYADELEGRAVVVRKAKPLPIECIVRGYLTG 120

Query: 105 NTKTSLLTFYKNGKR--KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNE 162
           +        +K+ K    +  Y LP  + D+ KL  P+ TP+TK+   A   D+ I+  +
Sbjct: 121 SG-------FKDYKATGSVCGYKLPTGLVDSAKLETPLFTPSTKADLGAH--DENITLAD 171

Query: 163 I---IHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADE 219
               I  G+L +     I   +L+++ RG  LA + G+I+ D+K+EFG+++K +I+L DE
Sbjct: 172 AKSRIGEGLLKK-----IQELSLAIYSRGRDLAAQRGIIIADTKFEFGLNEK-DILLIDE 225

Query: 220 IHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTS 279
           + TPDSSR+W  + Y      G +    DK ++R+W+ +         P +P  +I  T 
Sbjct: 226 VMTPDSSRFWPADRY----VPGQSQPSFDKQYLRDWLSSTEWDKTPPPPALPAEVIAETQ 281

Query: 280 QTYIAAYEKITG 291
           + Y+ A+E +TG
Sbjct: 282 KKYLEAFELLTG 293


>gi|294630196|ref|ZP_06708756.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. e14]
 gi|292833529|gb|EFF91878.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. e14]
          Length = 299

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 98/301 (32%), Positives = 161/301 (53%), Gaps = 30/301 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVRE Y    G  + +A+DR+SA+D  +   IP KG VL +++ +WF   
Sbjct: 13  VPGLVHLHTGKVRELYRNEAGDLVMVASDRMSAYDWVLPTEIPDKGRVLTRLSLWWFERL 72

Query: 68  SDICSNHTL--DYPD-------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH +  D PD          LV + L+M P+E + RGYL G    S L  Y+   
Sbjct: 73  ADLVPNHVIGTDLPDGAPADWAGRTLVCKSLRMVPVECVARGYLTG----SGLAEYEQ-S 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETI 177
           R +    LP+ + D  +LP P+ TP TK+       D+ +S  E+  + G  T  +   +
Sbjct: 128 RTVCGLALPEGLVDGSELPAPIFTPATKAEVGEH--DENVSYEEVARQVGAETAAE---L 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A E G+IL D+K+EFG D  + ++LADE+ TPDSSR+W  + ++  
Sbjct: 183 RQATLAVYSRARDIARERGIILADTKFEFGFD-GETLVLADEVLTPDSSRFWPADQWQP- 240

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLK 293
              G      DK ++R+W+ +  + +        P +PE ++  T   Y+ AYE++TG  
Sbjct: 241 ---GRAQPSYDKQYVRDWLTSAESGWDRRSEQPPPPLPEKVVEATRAKYVEAYERLTGTS 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|326331891|ref|ZP_08198178.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Nocardioidaceae bacterium Broad-1]
 gi|325950388|gb|EGD42441.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Nocardioidaceae bacterium Broad-1]
          Length = 302

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 162/304 (53%), Gaps = 31/304 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDG----TRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYW 63
           IP   + +SGKVR+ Y L +G      + +A+DR+SAFD      IP KGE+L +++ +W
Sbjct: 12  IPGAKHLHSGKVRDLYELEEGPYAGQLLMVASDRISAFDHVFDTVIPDKGEILTKLSLWW 71

Query: 64  FHHTSDICSNHTL--DYP---DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           F    D+   H L  D P   +   +V Q+L M P+E + RGYL G   + L  +   G+
Sbjct: 72  FEQFEDLVPTHVLSTDVPAAVEGRAVVAQKLHMLPVECVARGYLTG---SGLREYEVTGE 128

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
             +    LP  + D  +L  P+ TP TK+       D+ ++  E I R ++  +    + 
Sbjct: 129 --VCGIRLPAGLVDGSRLTPPIFTPATKAE--LGDHDENVT-YEYISR-LIGEDDAAAVR 182

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKK----QNIILADEIHTPDSSRYWEVETY 234
              L++++R  ++A   GLIL D+K+EFG+ +     + I+LADE+ TPDSSRYW+   +
Sbjct: 183 RLTLAVYQRADEIARGCGLILADTKFEFGVRQDDLGIRTIVLADEVLTPDSSRYWDASQW 242

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKIT 290
                 G      DKD IR W+L+  + +        P++PE I+ RT   Y+ AYEK+T
Sbjct: 243 HP----GSAIPSFDKDVIRRWLLSPESGWDRAAGGPPPELPEEIVARTRAKYVEAYEKLT 298

Query: 291 GLKF 294
           G +F
Sbjct: 299 GHRF 302


>gi|291458205|ref|ZP_06597595.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291418738|gb|EFE92457.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 290

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 109/296 (36%), Positives = 166/296 (56%), Gaps = 38/296 (12%)

Query: 17  SGKVRENYFLSDGTRITIATDRLSAFD---QNIACIPYKGEVLNQITQYWFHHTSDICSN 73
           +GKVRE Y LS+   I +ATDR+SAFD   QN   IP KG +L Q++++WF +T ++  N
Sbjct: 9   AGKVREIYELSETRLIMVATDRISAFDIILQNE--IPGKGRILTQMSRFWFDYTKELLPN 66

Query: 74  H--TLDYPD-PNVLVGQ----------QLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
              ++D  D P     Q          +L+M PIE IVRGY+ G   +    + K+G   
Sbjct: 67  DFISVDPKDMPEFFQAQYFQGRSTLCEKLRMIPIECIVRGYITG---SGWENYKKDGT-- 121

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII---HRGILTRNQ--WE 175
           I    LP+ + + +KLP P+ TP+TK+       D+ IS  E I    +    + Q   E
Sbjct: 122 ICGRKLPEGLRECEKLPEPLYTPSTKAELGEH--DENISYEESIPHLEKSFPGQGQRIAE 179

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            I   +LS++++    AL  G+I+ D+K+EFG+D + N++LADE+ TPDSSR+W +  YE
Sbjct: 180 KIRDASLSIYQKCADYALSRGIIIADTKFEFGLDPEGNVVLADELLTPDSSRFWRLSEYE 239

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
                G      DK ++RNW+  + NP  +N   +PE ++ +T+  Y  AYE +TG
Sbjct: 240 P----GRGQSSFDKQYVRNWL--KENP--ENHGVLPEEVVTKTAALYAEAYEMLTG 287


>gi|325830044|ref|ZP_08163501.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Eggerthella sp. HGA1]
 gi|325487511|gb|EGC89949.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Eggerthella sp. HGA1]
          Length = 292

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 158/294 (53%), Gaps = 32/294 (10%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVR+ Y L D   + +ATDR+SAFD  +   IP+KG VL Q++ +WF     +  NH +
Sbjct: 12  GKVRDLYDLGD-KLLLVATDRISAFDYILEDEIPHKGAVLTQLSCFWFELLDGVVENHLI 70

Query: 77  ---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
                          DY     ++ ++  MFP E IVRGYLAG   + L  + K G   +
Sbjct: 71  SSDVADLPEQFQPYADYLRGRFMLVKKADMFPAECIVRGYLAG---SGLKEYQKQGT--V 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LP+ + ++ KLP P+ TP+TK+       D+ IS   ++   I+  +    +   A
Sbjct: 126 CGIQLPEGLVNSSKLPEPIFTPSTKAE--IGDHDENISYERLVE--IIGEDDASQLRDLA 181

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L ++      A E G+I+ D+K+EFG    Q IILADE+ TPDSSR+W  + Y     EG
Sbjct: 182 LKVYTTARDHAAERGVIIADTKFEFGRLNGQ-IILADEVLTPDSSRFWPGDEYA----EG 236

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
                 DK F+R+W+    +  + N P +P++II RTS+ YI AYEKITG  F+
Sbjct: 237 KDQPSFDKQFVRDWLNANWD-RQGNPPRLPQDIIDRTSEKYIQAYEKITGRTFV 289


>gi|183984877|ref|YP_001853168.1| phosphoribosylaminoimidazole- succinocarboxamide synthase, PurC
           [Mycobacterium marinum M]
 gi|229564406|sp|B2HH58|PUR7_MYCMM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|183178203|gb|ACC43313.1| phosphoribosylaminoimidazole- succinocarboxamide synthase, PurC
           [Mycobacterium marinum M]
          Length = 297

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 106/303 (34%), Positives = 164/303 (54%), Gaps = 34/303 (11%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           P+L +Y    SGKVRE Y + D   + +A+DR+SA+D  + + IP KG +L  ++ ++F 
Sbjct: 3   PQLSDYQHLASGKVRELYRVDDEHLLLVASDRISAYDYVLDSMIPDKGRILTAMSVFFFG 62

Query: 66  HTSDICSNHTLDYPD----PNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH    PD    P+ ++G+     QL+M P+E + RGYL G   + LL +  +
Sbjct: 63  LVD--APNHLAGPPDDPRIPDEVLGRALVVCQLEMLPVECVARGYLTG---SGLLDYQAS 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWE 175
           GK  +    LP  + +  K   P+ TP TK+       D+ IS  ++I   G +  NQ  
Sbjct: 118 GK--VCGIALPPGLVEASKFAEPLFTPATKAE--LGDHDENISFAQVIETVGGVRANQ-- 171

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L ++ +    AL  G+I+ D+K+EFG D+  N++LADEI TPDSSRYW  + Y 
Sbjct: 172 -LRDRTLQIYVKAADHALTRGIIIADTKFEFGADRDGNLLLADEIFTPDSSRYWPADEY- 229

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITG 291
              R G+     DK F+RNW+ +  + +        P +P++II  T + YI AYE+I+G
Sbjct: 230 ---RAGVVQNSFDKQFVRNWLTSAESGWDRGGDQPPPPLPDHIIAATRERYIEAYERISG 286

Query: 292 LKF 294
           L F
Sbjct: 287 LSF 289


>gi|295106284|emb|CBL03827.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gordonibacter pamelaeae 7-10-1-b]
          Length = 287

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 158/293 (53%), Gaps = 32/293 (10%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVR+ Y L D   + +ATDR+SAFD  +   IP+KG VL Q++ +WF     +  NH +
Sbjct: 9   GKVRDLYDLGD-KLLLVATDRISAFDYILEDEIPHKGAVLTQLSCFWFELLDGVVENHLI 67

Query: 77  ---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
                          DY     ++ ++  MFP E IVRGYLAG   + L  + K G    
Sbjct: 68  SADVADLPEQFRPYADYLRGRFMLVKKADMFPAECIVRGYLAG---SGLKEYQKQGTVCG 124

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
            E  LP+ + ++ KLP P+ TP+TK+       D+ IS   ++   I+  +    +   A
Sbjct: 125 IE--LPEGLVNSSKLPEPIFTPSTKAE--IGDHDENISFERLVE--IIGEDDASQLRDLA 178

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L ++      A E G+I+ D+K+EFG    Q IILADE+ TPDSSR+W  + Y     EG
Sbjct: 179 LKVYTTARDHAAERGVIIADTKFEFGRLNGQ-IILADEVLTPDSSRFWPGDEYA----EG 233

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
                 DK F+R+W+    +  + N P +P++II +TS+ YI AYE+ITG KF
Sbjct: 234 KDQPSFDKQFVRDWLTANWD-RQGNPPRLPQDIIDKTSEKYIQAYERITGRKF 285


>gi|257437896|ref|ZP_05613651.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Faecalibacterium prausnitzii A2-165]
 gi|257199556|gb|EEU97840.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Faecalibacterium prausnitzii A2-165]
          Length = 312

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 166/296 (56%), Gaps = 35/296 (11%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRE Y   D + I +ATDR+SAFD  +   +  KG+VL Q++++WF +T D+  NH L
Sbjct: 33  GKVREIYDNGD-SLIMVATDRISAFDVILKNKVTNKGKVLTQMSRFWFDYTRDVLPNHML 91

Query: 77  -----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
                D P+           +  ++L M PIE IVRGY+ G   +   ++ +NG   +  
Sbjct: 92  SVDTADMPEFFRTPAFEGRSMKCRKLTMLPIECIVRGYITG---SGWASYQQNGT--VCG 146

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTRNQ--WETIS 178
             LP+ + ++Q+LP P+ TP+TK+       D+ IS     E++ +      +     + 
Sbjct: 147 IRLPEGLQESQQLPEPIYTPSTKAE--IGDHDENISYEKSIEVLEKQFPGHGEDYATKLR 204

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y ++L+++    AL  G+I+ D+K+EFG+D+  N++L DE+ TPDSSR+W +E YE   
Sbjct: 205 DYTIALYKKCAAYALSRGIIIADTKFEFGLDENGNVVLGDEMLTPDSSRFWPLEGYEA-- 262

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
             G      DK F+RNW+  + NP  D+  D+P+++I +T   Y  AYE +TG K 
Sbjct: 263 --GHGQPSFDKQFVRNWL--KANP--DSNYDLPQDVIDKTIAKYEEAYELLTGKKL 312


>gi|329946169|ref|ZP_08293782.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328527767|gb|EGF54758.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 316

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 89/292 (30%), Positives = 158/292 (54%), Gaps = 30/292 (10%)

Query: 17  SGKVRENY-------FLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTS 68
           SGKVR+ Y       +      + +A+DR+SA+D  ++  IP KG VL  ++ +WF   +
Sbjct: 32  SGKVRDVYVPTAEGPWAGQDVLLVVASDRISAYDHILSTPIPDKGRVLTALSAWWFEQLA 91

Query: 69  DICSNH--TLDYPDP---NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           D+  NH  +LD PD      ++ ++L M+P+E + RGYL G+    L  + +N  R +  
Sbjct: 92  DVVPNHLVSLDVPDQVAGRAMICRRLDMYPVECVARGYLTGS---GLAEYQEN--RSVCG 146

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ +++  +LP P+ TP  K+       D+ ++   + H  ++       +    L+
Sbjct: 147 VPLPEGLTEASRLPEPIFTPAAKAELGEH--DENVTFERVTH--MVGETAATALRGTTLA 202

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           L+ R  ++A E G+IL D+K+E G D   +++L DE+ TPDSSR+W  + +E      +T
Sbjct: 203 LYTRAAQVAGERGIILADTKFELGTDASGSLVLGDEVLTPDSSRFWPADAWEPGR---VT 259

Query: 244 PIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITG 291
           P   DK ++R+W+ +  + +        P +P+ ++ RT   Y+ AYE++TG
Sbjct: 260 P-SFDKQYVRDWLTSSASGWDRGSGQEPPALPDVVVERTRARYLEAYERLTG 310


>gi|302535728|ref|ZP_07288070.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. C]
 gi|302444623|gb|EFL16439.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. C]
          Length = 300

 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 94/298 (31%), Positives = 157/298 (52%), Gaps = 29/298 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y   DG  + +A+DR+SA D  +   IP KG +L Q++ +WF   
Sbjct: 13  VPGLAHLHTGKVRDLYRDEDGNLVMVASDRISAADWVLPTEIPEKGRILTQLSLWWFEQL 72

Query: 68  SDICSNHTL--DYP-------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH L  D P       +   LV + L M P+E + RGYL G+    L  + +   
Sbjct: 73  ADLVPNHVLGTDLPAGAPADWEGRTLVCKSLDMVPVECVARGYLTGS---GLKEYVQT-- 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETI 177
           R +    LP+ + D  +LP P+ TP  K+       D+ +S  E+    G  T      +
Sbjct: 128 RTVCGLALPEGLVDGSELPAPIFTPAAKAE--VGDHDENVSYEEVARTTGAETAA---LL 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A E G+IL D+K+EFG D+   ++ ADE+ TPDSSR+W  + ++  
Sbjct: 183 RQTTLAVYGRARDIARERGIILADTKFEFGFDEDGTLVAADEVLTPDSSRFWPADQWQP- 241

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITG 291
              G T    DK ++R+W+ +  + +        P +P+ ++ +T   Y+ AYE++TG
Sbjct: 242 ---GRTQPSFDKQYVRDWLASPASGWDSKGELPPPVLPQEVVAQTRAKYVEAYERLTG 296


>gi|160894000|ref|ZP_02074779.1| hypothetical protein CLOL250_01555 [Clostridium sp. L2-50]
 gi|156864378|gb|EDO57809.1| hypothetical protein CLOL250_01555 [Clostridium sp. L2-50]
          Length = 290

 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 106/304 (34%), Positives = 168/304 (55%), Gaps = 39/304 (12%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFD---QNIACIPYKGEVLNQITQYWFH 65
           + E+     GKVRE Y   D + I +ATDR+S FD   +NI  +  KG VL Q++++WF 
Sbjct: 1   MQEMKPIKEGKVREIYDNGD-SLIMVATDRISCFDVILKNI--VTKKGTVLTQMSKFWFD 57

Query: 66  HTSDICSNHTL-----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLT 112
            T DI  NH +     D P        D N ++ ++L+M P+E IVRGY+ G   +   +
Sbjct: 58  MTEDILPNHMISVDVKDMPEFFRQEKFDGNSMMCKKLEMLPVECIVRGYITG---SGWAS 114

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS---PNEIIHRGIL 169
           + +NG   +    LP+ + ++ KLP P+ TP+TK+       D+ IS     E + +   
Sbjct: 115 YKENGT--VCGIKLPEGLKESDKLPEPIYTPSTKAE--IGDHDENISYEQSVEYLEKRFP 170

Query: 170 TRNQ--WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            + +     +  Y ++L+++  + AL  G+I+ D+K+EFG+D+  NI+L DE+ TPDSSR
Sbjct: 171 GKGEEYGAKLRDYTIALYKKCAEYALSRGIIIADTKFEFGLDENGNIVLGDEMLTPDSSR 230

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  E YE     G      DK F R+W+  + NP  DN  ++P+ I+ +T   Y+ AYE
Sbjct: 231 FWPAEGYEP----GHGQPSFDKQFARDWL--KANP--DNNWELPDEIVQKTIDKYLQAYE 282

Query: 288 KITG 291
            +TG
Sbjct: 283 LLTG 286


>gi|240172328|ref|ZP_04750987.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium kansasii ATCC 12478]
          Length = 297

 Score =  162 bits (409), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 108/303 (35%), Positives = 159/303 (52%), Gaps = 34/303 (11%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           P L +Y    SGKVRE Y + DG  + +ATDR+SA+D  + + IP KG +L  ++ ++F 
Sbjct: 3   PALSDYQHLASGKVREIYRIDDGHLLLVATDRISAYDYVLDSTIPDKGRILTAMSVFFFG 62

Query: 66  HTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH    PD +          LV ++L+M P+E + RGYL G   + LL +   
Sbjct: 63  LVD--TPNHLAGPPDDSRIPDEVLGRALVVRRLEMLPVECVARGYLTG---SGLLDYQAT 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWE 175
           GK  +    LP  + +  K   P+ TP TK++      D+ IS   +I   G +  NQ  
Sbjct: 118 GK--VCGIALPPGLVEASKFGAPLFTPATKAA--LGDHDENISFARVIEMVGGVRANQ-- 171

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L ++ +    AL  G+I+ D+K+EFGID   N++LADEI TPDSSRYW  + Y 
Sbjct: 172 -LRDRTLQIYVQAADHALRKGIIIADTKFEFGIDGDGNLLLADEIFTPDSSRYWPADEY- 229

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITG 291
              R G+     DK F+RNW+ +  + +        P +P  II  T + YI AYE+I+G
Sbjct: 230 ---RPGVVQTSFDKQFVRNWLTSPESGWDRGGDQPPPPLPSAIIEATRERYIEAYERISG 286

Query: 292 LKF 294
           L F
Sbjct: 287 LWF 289


>gi|332531646|ref|ZP_08407543.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Hylemonella gracilis ATCC 19624]
 gi|332039009|gb|EGI75438.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Hylemonella gracilis ATCC 19624]
          Length = 303

 Score =  162 bits (409), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 95/299 (31%), Positives = 158/299 (52%), Gaps = 28/299 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+NY + +   + +A+DR+SAFD  +   IP KGE+L ++  +WF     I
Sbjct: 13  LPLLARGKVRDNYAVGEDRILMVASDRISAFDVIMGEPIPGKGELLTKMALFWFDKLGHI 72

Query: 71  CSNH-------TLDYPDP------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       ++  PD         ++ Q+L+  P+E +VRGYLAG+        Y+  
Sbjct: 73  VPNHLTGAAPESVVQPDEVGQVRGRAMLVQRLKPIPVEAVVRGYLAGSGWKE----YQE- 127

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            + +    LP  + +  KLP P+ TP  K+       D+ IS  + +   ++       I
Sbjct: 128 SQAVCGVKLPAGLKNASKLPEPIYTPAHKAEMGEH--DENISFEKTVE--LIGAELAAKI 183

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              +++L+    ++AL+ G+I+ D+K+EFG+D +  ++L DE+ TPDSSRYW VE YE++
Sbjct: 184 RDVSIALYTTASEIALKRGIIIADTKFEFGLDPQGRLVLMDEVLTPDSSRYWPVEGYEQA 243

Query: 238 FREGITPIGLDKDFIRNWI---LTRCNPYRDN--IPDIPENIILRTSQTYIAAYEKITG 291
           F+ G  P   DK F+R+W+        P+      P +P  ++ +T+  Y  A  ++TG
Sbjct: 244 FKAGANPPSYDKQFLRDWLEQAQVDGKPWGKTPPAPALPAEVVAQTAAKYQEALTRLTG 302


>gi|163816124|ref|ZP_02207492.1| hypothetical protein COPEUT_02308 [Coprococcus eutactus ATCC 27759]
 gi|158448544|gb|EDP25539.1| hypothetical protein COPEUT_02308 [Coprococcus eutactus ATCC 27759]
          Length = 291

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 163/300 (54%), Gaps = 35/300 (11%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSD 69
           EL     GKVRE Y   D + I +ATDR+S FD  +   I  KG VL Q++++WF  T D
Sbjct: 3   ELKPIKEGKVREIYDNGD-SLIMVATDRISCFDVILDNVISKKGTVLTQMSKFWFDMTQD 61

Query: 70  ICSNHTL-----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH +     D P        D N ++ ++L+M PIE IVRGY+ G   +   ++ +N
Sbjct: 62  ILPNHMISVDVKDMPEFFQQEKFDGNSMMCRKLEMLPIECIVRGYITG---SGWASYKEN 118

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS-PNEIIHRGILTRNQWE 175
           G   +    LP+ + ++ KLP P+ TP+TK+       D+ IS    I H       + E
Sbjct: 119 GT--VCGIKLPEGLKESDKLPEPIYTPSTKAE--IGDHDENISYEQSIAHLEKYFPGKGE 174

Query: 176 TISS----YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEV 231
             +S    Y ++L+++  + AL  G+I+ D+K+EFG+D+  NI+L DE+ TPDSSR+W  
Sbjct: 175 EYASKLKEYTITLYKKCAEYALTRGIIIADTKFEFGLDENGNIVLGDEMLTPDSSRFWPA 234

Query: 232 ETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           + YE     G      DK F R+W+  + NP  D    +PE++  +T   Y+  YEK+TG
Sbjct: 235 DVYEP----GHGQPSFDKQFARDWL--KANP--DKGWKLPEDVAQKTIDIYLEGYEKLTG 286


>gi|303240574|ref|ZP_07327089.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acetivibrio cellulolyticus CD2]
 gi|302591811|gb|EFL61544.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acetivibrio cellulolyticus CD2]
          Length = 294

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 113/301 (37%), Positives = 161/301 (53%), Gaps = 34/301 (11%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSD 69
           +LP +  GKVR  Y L D   I I TDR+SAFD      IP KG+VLN I+++WF++T D
Sbjct: 10  KLPLHIKGKVRNVYDLGDKILI-IVTDRISAFDVVFPNLIPNKGKVLNSISEFWFNYTKD 68

Query: 70  ICSNHTL-----DYPDPNVLVGQQLQ----------MFPIELIVRGYLAGNTKTSLLTFY 114
           I  NH +      YP+      ++LQ          M   E IVRGYL G    S L  Y
Sbjct: 69  IVGNHVITTDVSQYPEGLSQFKEELQGRSMLVKKIKMVEAECIVRGYLEG----SGLKDY 124

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQ 173
           K     I    LP+ +    KLP P+ TP+TK+SE   G DQ +S  E+    G    NQ
Sbjct: 125 K-ATGSICGIKLPEGLRQGDKLPEPIFTPSTKASE---GHDQNVSFEELCKEIGTDLANQ 180

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
            +  S   ++L+ +  K A   G+IL D+K+EFG++  + +++ADE+ TPDSSR+W++  
Sbjct: 181 LKETS---IALYNKASKYAESKGIILADTKFEFGLEDGK-LVVADEMFTPDSSRFWDMNE 236

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLK 293
           YE     G      DK F+R +I +     +   P +P+++I  T   YI AYE++TG K
Sbjct: 237 YEP----GRPQKSFDKQFLREYIESTDWDKKPPAPVLPDDVIRNTELKYIEAYERLTGKK 292

Query: 294 F 294
            
Sbjct: 293 L 293


>gi|284048820|ref|YP_003399159.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidaminococcus fermentans DSM 20731]
 gi|283953041|gb|ADB47844.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidaminococcus fermentans DSM 20731]
          Length = 291

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 165/296 (55%), Gaps = 33/296 (11%)

Query: 17  SGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHT 75
           SGKVRE Y L D + I +A+DR+SAFD  +   I  KG VL Q++++WF +T DI  NH 
Sbjct: 9   SGKVREIYDLGD-SLIMVASDRISAFDHILKNTITDKGAVLTQMSKFWFDYTKDIIPNHM 67

Query: 76  L-----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           +     D P+           +  ++L M P+E IVRGY+ G+   S   + +NG   + 
Sbjct: 68  ISVDPADMPEFFRTPEFAGKSMKCRKLNMIPVECIVRGYITGSGWES---YKENGT--VC 122

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSS----ESASGCDQPISPNEIIHRGILTRNQWETIS 178
              +P+ + + QKLP P+ TP+TK+     +     DQ ++  E I  G       + I 
Sbjct: 123 GIKMPEGLKECQKLPEPLFTPSTKAELGDHDENITEDQCVTYLEKIFPGKGAEYT-KAIK 181

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              ++L+++    A E G+I+ D+K+EFG+++K  ++L DE+ TPDSSR+W +E YE   
Sbjct: 182 DATIALYKKCADYAYERGIIIADTKFEFGLNEKGEVVLGDEMLTPDSSRFWPLEGYEA-- 239

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
             G      DK F+R+W+  + NP  D +  +P+++I +T   Y  AYE +TG KF
Sbjct: 240 --GKGQPSYDKQFVRDWL--KANPDSDYL--LPQDVIDKTIAKYKEAYEMLTGKKF 289


>gi|332671723|ref|YP_004454731.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cellulomonas fimi ATCC 484]
 gi|332340761|gb|AEE47344.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cellulomonas fimi ATCC 484]
          Length = 309

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 100/318 (31%), Positives = 163/318 (51%), Gaps = 41/318 (12%)

Query: 1   MRILSKAYIPELPNY---YSGKVRENYFLSDGTR-------------ITIATDRLSAFDQ 44
           M + + A    LP +   YSGKVR+ Y   DGT              + +A+DR+SA+D 
Sbjct: 1   MPVTADATATTLPGWAHTYSGKVRDLY-APDGTEAGAAIRAEHGDVVLVVASDRVSAYDH 59

Query: 45  NI-ACIPYKGEVLNQITQYWFHHTSDICSNHTLDYPDPNVLVG-----QQLQMFPIELIV 98
            +   IP KG VL Q++ +WF   +D+  NH +    P  + G     ++L MFP+E + 
Sbjct: 60  VLQPGIPDKGVVLTQLSLWWFEQLADLVPNHVVSTDVPAAVAGRAMVCRRLSMFPVECVA 119

Query: 99  RGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPI 158
           RGYL G+    L+ +  +G  ++    LP  + D  +LP P+ TP TK+       + P 
Sbjct: 120 RGYLTGS---GLVEYRASG--EVTGIPLPAGLVDGSRLPEPIFTPATKAELGEHDENVPF 174

Query: 159 SPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILA 217
           S   ++ +  L ++   T+    L+++ R   +A E G+IL D+K EFG D     + L 
Sbjct: 175 S--TVVAQ--LGQDAATTLRDLTLAVYARAEAIARERGVILADTKLEFGTDPTTGAVTLG 230

Query: 218 DEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPEN 273
           DE+ TPDSSR+W  +++E     G      DK F+R+W+ +  + +        P +P +
Sbjct: 231 DEVLTPDSSRFWPADSWEP----GRAQPSFDKQFVRDWLTSPASGWDRASDVPPPALPAD 286

Query: 274 IILRTSQTYIAAYEKITG 291
           ++ RT   Y+ AYE++TG
Sbjct: 287 VVARTRARYLEAYERLTG 304


>gi|300790860|ref|YP_003771151.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Amycolatopsis mediterranei U32]
 gi|299800374|gb|ADJ50749.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Amycolatopsis mediterranei U32]
          Length = 334

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/298 (31%), Positives = 158/298 (53%), Gaps = 26/298 (8%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
           +P L    +GKVR+ Y + D   + +A+DR+SAF++     +P KG VL  ++ +WF   
Sbjct: 4   LPTLERLATGKVRDLYAVGDEHLLVVASDRISAFERVFPTSVPGKGRVLTAMSVFWFRQL 63

Query: 68  SDICSNHTLDYPDP--------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
           +D+  NH +    P          L+ ++L M P+E +VRGYL G        + ++G+ 
Sbjct: 64  ADVLPNHLVTCEGPLIPEAVRGRALLVERLDMLPVEAVVRGYLTGRGYAD---YRRSGQ- 119

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGC-DQPISPNEIIHRGILTRNQWETIS 178
            +    LP  ++++ +LP P+ TP+TK+     GC D+ I     +   +L R     + 
Sbjct: 120 -VCGLALPPGLAESARLPEPIFTPSTKAPR---GCKDENIDFGRCVS--VLGRALAGEVR 173

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
             +L L+ RG   A E GL+L D+K+EFGI     ++LADE+ TPDS+RYW  + ++   
Sbjct: 174 EASLELYRRGAARAAEQGLLLADTKFEFGIGAGGGLVLADELLTPDSARYWLADGHQP-- 231

Query: 239 REGITPIGLDKDFIRNWILTRCNPYR--DNIPDIPENIILRTSQTYIAAYEKITGLKF 294
             G+     DK  +R+W++   + +     +P +P  ++  T   YI AY++ITGL  
Sbjct: 232 --GVPQPSFDKQHVRDWLVDPVSGWDCVSPLPPLPPEVVTATRDRYIEAYQRITGLSL 287


>gi|220927841|ref|YP_002504750.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium cellulolyticum H10]
 gi|219998169|gb|ACL74770.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium cellulolyticum H10]
          Length = 298

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 108/303 (35%), Positives = 157/303 (51%), Gaps = 32/303 (10%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           LP +  GKVR  Y L D   I + TDR+SAFD      IP KG VLN I+ +WF  T D+
Sbjct: 11  LPLFVKGKVRNVYDLGDQLLIVV-TDRISAFDVVFDELIPNKGTVLNSISAFWFDFTKDV 69

Query: 71  CSNHTL-----DYPDP----------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
             NH +      YP              ++ +++QM P E IVRGYL G   + L  + K
Sbjct: 70  IGNHVITTDVSKYPKELSAFKDELQGRSMLVKKVQMLPAECIVRGYLEG---SGLKEYQK 126

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
            G   +    LP  +    KLP P+ TP+TK SE   G D  +S  E++   I T    +
Sbjct: 127 TGT--VCGIKLPSGLKQADKLPEPIFTPSTKESE---GHDINVS-FEVLCEKIGT-EMAQ 179

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +L L+E+  K A   GLIL D+K+EFG+   + +++ DE+ TPDSSR+W  + Y+
Sbjct: 180 KLKDASLKLYEKASKHAESKGLILADTKFEFGMLDGE-LVVGDEMFTPDSSRFWARDEYQ 238

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
                G      DK ++R ++       +   P++P+ +I +T + YI AYE+ITG KF 
Sbjct: 239 P----GRAQKSFDKQYLREYLENITWDKQPPAPELPQEVIRKTEEKYIEAYERITGKKFQ 294

Query: 296 ADN 298
            D 
Sbjct: 295 GDK 297


>gi|118616338|ref|YP_904670.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium ulcerans Agy99]
 gi|166230826|sp|A0PLI0|PUR7_MYCUA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|118568448|gb|ABL03199.1| phosphoribosylaminoimidazole- succinocarboxamide synthase, PurC
           [Mycobacterium ulcerans Agy99]
          Length = 297

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 106/303 (34%), Positives = 163/303 (53%), Gaps = 34/303 (11%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           P+L +Y    SGKVRE Y + D   + +A+DR+SA+D  + + IP KG +L  ++ ++F 
Sbjct: 3   PQLSDYQHLASGKVRELYRVDDEHLLVVASDRISAYDYVLDSMIPDKGRILTAMSVFFFG 62

Query: 66  HTSDICSNHTLDYPD----PNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH    PD    P+ ++G+     QL+M P+E + RGYL G   + LL +  +
Sbjct: 63  LVD--APNHLAGPPDDPRIPDEVLGRALVVRQLEMLPVECVARGYLTG---SGLLDYQAS 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWE 175
           GK  +    LP  +    K   P+ TP TK+       D+ IS  ++I   G +  NQ  
Sbjct: 118 GK--VCGIALPPGLVGASKFAEPLFTPATKAE--LGDHDENISFAQVIETVGGVRANQ-- 171

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L ++ +    AL  G+I+ D+K+EFG D+  N++LADEI TPDSSRYW  + Y 
Sbjct: 172 -LRDRTLQIYVKAADHALTRGVIIADTKFEFGADRDGNLLLADEIFTPDSSRYWPADEY- 229

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITG 291
              R G+     DK F+RNW+ +  + +        P +P++II  T + YI AYE+I+G
Sbjct: 230 ---RAGVVQNSFDKQFVRNWLTSAESGWDRGGDQPPPPLPDHIIEATRERYIEAYERISG 286

Query: 292 LKF 294
           L F
Sbjct: 287 LGF 289


>gi|296118913|ref|ZP_06837486.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium ammoniagenes DSM 20306]
 gi|295968011|gb|EFG81263.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium ammoniagenes DSM 20306]
          Length = 295

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 157/301 (52%), Gaps = 28/301 (9%)

Query: 10  PELPNYY---SGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWF- 64
           P+L +Y    SGKVR+ Y + D T + + TDR+SA+D  +   IP KG VL   + ++F 
Sbjct: 3   PQLSDYQHLSSGKVRDIYQVDDNTLLMVVTDRISAYDFALEPAIPDKGRVLTATSMFFFD 62

Query: 65  ------HHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
                 H    I      +      +V Q+LQM P E + RGYL G   + L  +  NG 
Sbjct: 63  AIDFPNHLAGPIDDERIPEEVLGRAIVVQKLQMLPFECVARGYLTG---SGLKEYNANGT 119

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
               E  LPD + +  +LP P+ TP TK+ +     D+ ++   ++    L + + E + 
Sbjct: 120 VCGIE--LPDGLVEASRLPEPIFTPATKAEQGDH--DENVTFERVVQD--LGQERAEQLR 173

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L ++    ++A   G+IL D+K+EFG+D   N++L DE+ TPDSSRYW  +TY    
Sbjct: 174 DETLRIYSAAAQIAEAKGIILADTKFEFGLDADGNLVLGDEVLTPDSSRYWPADTYA--- 230

Query: 239 REGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            EG+     DK ++RNW+ +  + +        P +P+ ++  T   YI AYE+++G +F
Sbjct: 231 -EGVVQPSFDKQYVRNWLTSEESGWDVESETPPPTLPDEVVAATRLRYIEAYERLSGKRF 289

Query: 295 I 295
           +
Sbjct: 290 V 290


>gi|229824685|ref|ZP_04450754.1| hypothetical protein GCWU000182_00033 [Abiotrophia defectiva ATCC
           49176]
 gi|229791014|gb|EEP27128.1| hypothetical protein GCWU000182_00033 [Abiotrophia defectiva ATCC
           49176]
          Length = 297

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 107/314 (34%), Positives = 172/314 (54%), Gaps = 43/314 (13%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQIT 60
           R + K Y P       GK+RE Y + D + I +ATDR+SAFD  +   I  KG +L Q++
Sbjct: 4   RKIMKEYTP----VKEGKIREVYDIGD-SLIMVATDRISAFDHILKNKISDKGAILTQMS 58

Query: 61  QYWFHHTSDICSNHTL-----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTK 107
           ++WF  T DI  NH L     D P+         N +  ++L+M P+E IVRGY+ G   
Sbjct: 59  KFWFDFTKDILPNHMLSVDVNDMPEFFRKPEFTGNSMKVKKLRMLPLECIVRGYITG--- 115

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
           +   ++ +NG   +    LP+ +S+++KLP P+ TP+TK+       D+ IS  + I   
Sbjct: 116 SGWASYKENGT--VCGIKLPEGLSESEKLPEPIYTPSTKAEIGLH--DENISYEQSIE-- 169

Query: 168 ILTRNQWETISSYAL-------SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEI 220
           +L +        YAL       +L+++    AL  G+I+ D+K+EFG+D+  NI++ DE+
Sbjct: 170 VLEKEFPGKGEEYALKLKEATIALYKKCADYALSKGIIIADTKFEFGLDENDNIVIGDEM 229

Query: 221 HTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQ 280
            TPDSSR+W +E     F+ G      DK F+R+W+  + NP  D +  +P+ +I +T +
Sbjct: 230 LTPDSSRFWPLE----GFKVGAGQPSYDKQFVRDWL--KANPDSDYL--LPDEVIEKTIE 281

Query: 281 TYIAAYEKITGLKF 294
            Y  A++ +TG  F
Sbjct: 282 KYKEAFKLLTGEDF 295


>gi|305680418|ref|ZP_07403226.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium matruchotii ATCC 14266]
 gi|305659949|gb|EFM49448.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium matruchotii ATCC 14266]
          Length = 311

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 98/301 (32%), Positives = 166/301 (55%), Gaps = 30/301 (9%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           PEL  Y    +GKVRE Y + D T + + +DR+SA+D  +   IP KG VL  ++ Y+F 
Sbjct: 17  PELSQYNHVSAGKVREIYEIDDDTLLMVVSDRISAYDHILDPEIPDKGRVLTAMSMYFFD 76

Query: 66  HTSDICSNHTLDYPDPNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           H  D  ++   D  D  +        +V ++L+M P E +VRGYL G+     L      
Sbjct: 77  HI-DFPNHLAGDIDDMRIPEEVLGRAIVCKKLKMLPFECVVRGYLTGSGYKEYLA----- 130

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ + ++ KLP P+ TP TK+       D+ ++  +++ +  L   +   +
Sbjct: 131 TGSVCGIPLPEGLVESSKLPEPIFTPATKAD--LGDHDENVTFEQVVEK--LGERRATEL 186

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              +++++++  +LA   G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW +E YE  
Sbjct: 187 RDASINIYKQAAELAEAKGIILADTKFEFGVDRDGTLVLADEVLTPDSSRYWPLEGYEP- 245

Query: 238 FREGITPIGLDKDFIRNWIL-TRCNPYRDN---IPDIPENIILRTSQTYIAAYEKITGLK 293
              G      DK ++RNW+  ++C+   D+    P +P +++  T + Y+ A+E+ITG K
Sbjct: 246 ---GKVQPSFDKQYVRNWLTSSKCDWQVDSNATPPPLPGSVVEATRERYVEAFERITGEK 302

Query: 294 F 294
           F
Sbjct: 303 F 303


>gi|213966224|ref|ZP_03394409.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium amycolatum SK46]
 gi|213951159|gb|EEB62556.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium amycolatum SK46]
          Length = 297

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 98/302 (32%), Positives = 162/302 (53%), Gaps = 32/302 (10%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           PEL +Y    +GKVRE Y +   T + + +DR+SAFD  +   IP KG VL  ++ ++F 
Sbjct: 3   PELSSYNHLSAGKVREIYEIDPETLLLVVSDRISAFDHILETPIPDKGRVLTAMSVFFFD 62

Query: 66  HTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH     D            LV ++L M P E + RGYL G   + L+ + +N
Sbjct: 63  EID--FPNHMAGPADDERIPEECLGRALVCKKLDMLPFECVARGYLTG---SGLVEYKEN 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP+ + +  KLP PV TP TK+       D+ +S + ++    L + + E 
Sbjct: 118 GT--VCGIELPEGLVEGSKLPEPVFTPATKAELGEH--DENVSFDAVVES--LGQKRAEE 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L ++ +  +LA + G+IL D+K+EFG+D   N++LADE+ TPDSSRYW  ++Y+ 
Sbjct: 172 LRDATLRIYTQAAELAAKRGIILADTKFEFGLDSDGNLVLADEVLTPDSSRYWPADSYQ- 230

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITGL 292
              EG      DK ++RNW+    + ++ +     P +P +++  T + Y+ AYE+++G 
Sbjct: 231 ---EGSVNPSFDKQYVRNWLTCSKSGWKKDEGTPPPALPGSVVEATRERYVEAYERLSGR 287

Query: 293 KF 294
           +F
Sbjct: 288 RF 289


>gi|302331406|gb|ADL21600.1| Phosphoribosylaminoimidazole-succino carboxamide synthase
           [Corynebacterium pseudotuberculosis 1002]
          Length = 297

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 160/301 (53%), Gaps = 30/301 (9%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           PEL  Y    +GKVRE Y + D   + + +DR+SA+D  +   IP KG VL  ++ Y+F 
Sbjct: 3   PELSQYTHVSAGKVREIYEIDDERLLMVVSDRISAYDHILDPEIPDKGRVLTAMSMYFFD 62

Query: 66  HTSDICSNHTLDYPDPNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           H  D  ++      DP +        LV ++L+M P E + RGYL G   + L  + + G
Sbjct: 63  HI-DFPNHLAGSIDDPAIPEEVLGRALVCKKLKMLPFECVARGYLTG---SGLKEYQQTG 118

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           K    E  LP+ + +  KLP P+ TP TK+       D+ +S + ++ +  L   +   +
Sbjct: 119 KVCGIE--LPEGLVEASKLPSPIFTPATKAD--FGDHDENVSFDAVVDK--LGEARANEL 172

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            +  L ++     +A   G+IL D+K+EFG+D+  N++LADE  TPDSSRYW  + YE  
Sbjct: 173 RAVTLKIYSEAAAIAESRGIILADTKFEFGLDEDGNLVLADEALTPDSSRYWPADGYE-- 230

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGLK 293
             EG   +  DK ++RNW+    + +  +     P +P +++  T + Y+ A+E ITG K
Sbjct: 231 --EGKAQLSFDKQYVRNWLTGPKSGWSTDSLSPPPSLPGSVVEATRERYVEAFESITGKK 288

Query: 294 F 294
           F
Sbjct: 289 F 289


>gi|288942240|ref|YP_003444480.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Allochromatium vinosum DSM 180]
 gi|288897612|gb|ADC63448.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Allochromatium vinosum DSM 180]
          Length = 293

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 103/306 (33%), Positives = 157/306 (51%), Gaps = 28/306 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +P L     GKVR+ Y + D   + +A+DRLSAFD  +   IP KGEVL ++
Sbjct: 1   MPALYQSNLPHLELIARGKVRDLYRIDDDHLLVVASDRLSAFDVVLPDPIPGKGEVLARL 60

Query: 60  TQYWFHHTSDICSNHTLDYP------DPNVL--------VGQQLQMFPIELIVRGYLAGN 105
           +++WF  T+DI  NH  D P      DP  L        V ++ +  P+E IVRGYL G+
Sbjct: 61  SRFWFGRTADIIPNHLTDIPVSAVVTDPQALAELGDRAMVVRRFKPLPVEAIVRGYLIGS 120

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                 T        +    LP  +    +LP P+ TP+TK+   A   D+ +     + 
Sbjct: 121 GWKDYQT-----TGSVCGIALPPGLRQADRLPEPIFTPSTKAELGAH--DENVDFAHTVD 173

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             ++ R   E +   +L+++ R    ALE GLI+ D+K+EFG+D    + L DE  TPDS
Sbjct: 174 --LIGRELAERVRDASLAIYTRCAAYALERGLIIADTKFEFGLDDDGRLYLIDEALTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  + Y+     G++P   DK F+R+++ T         P +P  II RT+  Y  A
Sbjct: 232 SRFWPADDYQP----GMSPPSFDKQFVRDYLETLDWDKTAPGPALPPEIIERTAAKYREA 287

Query: 286 YEKITG 291
            E++T 
Sbjct: 288 EERLTA 293


>gi|227506360|ref|ZP_03936409.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Corynebacterium striatum ATCC 6940]
 gi|227197011|gb|EEI77059.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Corynebacterium striatum ATCC 6940]
          Length = 289

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 93/300 (31%), Positives = 164/300 (54%), Gaps = 28/300 (9%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWF- 64
           PEL +Y    SGKVR+ Y + + T + + +DR+SA+D ++   IP KG VL   ++++F 
Sbjct: 3   PELSSYKHLASGKVRDIYDVDENTLLMVVSDRISAYDHSLDPAIPDKGRVLTATSKFFFD 62

Query: 65  ------HHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
                 H    +      +      +V ++L M P E + RGYL G   + L  + ++G 
Sbjct: 63  VIDFPNHLAGPLDDERIPEEVLGRAMVVKKLDMLPFECVARGYLTG---SGLKEYKESGT 119

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
             +    LP+ +++  +LP P+ TP TK+ +     D+ +S + ++ +  L + + E + 
Sbjct: 120 --VCGIELPEGLTEASRLPEPIFTPATKAEQGEH--DENVSFDAVVAK--LGKERAEELR 173

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
           +  L ++    ++A E G+IL D+K+EFG+D+   +ILADE+ TPDSSRYW  +TYE   
Sbjct: 174 AATLRIYSEAARIAEEKGIILADTKFEFGMDENGTLILADEVLTPDSSRYWPADTYE--- 230

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGLKF 294
            EG      DK ++RNW+ +  + +        P +P++++  T   Y+ AYE+++G  F
Sbjct: 231 -EGKVQPSFDKQYVRNWLTSPESGWDQAADTTPPHLPDDVVEATRARYVEAYERLSGNSF 289


>gi|330923922|ref|XP_003300429.1| hypothetical protein PTT_11676 [Pyrenophora teres f. teres 0-1]
 gi|311325438|gb|EFQ91481.1| hypothetical protein PTT_11676 [Pyrenophora teres f. teres 0-1]
          Length = 301

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/299 (33%), Positives = 161/299 (53%), Gaps = 32/299 (10%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSD 69
           +LP   SGKVR+ Y + D T + +A+DR+SA+D  +   IP KG +L  ++ YWFH+   
Sbjct: 14  KLPKVASGKVRDLYAIDDDTLLFVASDRISAYDVIMENGIPGKGALLTAMSIYWFHYLPT 73

Query: 70  IC---SNHTLDYPDPNVLVGQ-----------QLQMFPIELIVRGYLAGNTKTSLLTFYK 115
                  H L    P  L  Q           +L++ PIE IVRGY+ G+  +    + K
Sbjct: 74  QVPGLKTHFLSSSLPAPLSDQPDLKDRSMQVRRLRILPIESIVRGYITGSGWSE---YAK 130

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTRN 172
            G   +    LP  + + QKLP P+ TP+TK+     G D+ ISP    E+I    + + 
Sbjct: 131 LGT--VNGIKLPAGLIEGQKLPEPLWTPSTKAD--VGGKDENISPEKARELIGDATVAKK 186

Query: 173 QWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVE 232
               +   +L++++   K A E G+IL D+K+EFG+D+   ++L DE+ TPDSSR+W  E
Sbjct: 187 ----VEELSLAIYQAAAKRAEEVGIILADTKFEFGVDEGGEVVLVDEVLTPDSSRFWPKE 242

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           ++E +   G      DK F+R+W+       ++ +  +PE+++ RT+  Y  A EK+TG
Sbjct: 243 SWESNL--GRAQPSFDKQFLRDWLTDNGLKGKEGV-KVPEDVVERTAAKYREACEKLTG 298


>gi|254384075|ref|ZP_04999420.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. Mg1]
 gi|194342965|gb|EDX23931.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. Mg1]
          Length = 300

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/300 (31%), Positives = 151/300 (50%), Gaps = 27/300 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y   DG  + +A+DR+SAFD  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRDLYRDEDGNLVMVASDRMSAFDWVLPTEIPDKGRVLTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
            D+  NH +    P           L+   L M P+E + RGYL G    S L  Y    
Sbjct: 73  RDLVPNHVISTELPAGAPADWAGRTLICTSLDMVPVECVARGYLTG----SGLVEYDQ-T 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP+ + +  +LP P+ TP  K+       D+ +S  E+             + 
Sbjct: 128 RTVCGLALPEGLVNGSELPAPIFTPAAKAEVGEH--DENVSYEEVAR--TTGPETAALLR 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L+++ R   +A E G+IL D+K+EFG DK   ++  DE+ TPDSSR+W  + +E   
Sbjct: 184 QTTLAVYGRARDIARERGIILADTKFEFGFDKDGRLVAGDEVLTPDSSRFWPADQWEP-- 241

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITGLKF 294
             G      DK F+R+W+ +  + +        P +P+ ++ +T   Y+ AYE++TGL +
Sbjct: 242 --GRAQPSYDKQFVRDWLASPASGWDRKGELPPPALPQEVVEQTRAKYVEAYERLTGLAW 299


>gi|15828193|ref|NP_302456.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium leprae TN]
 gi|221230670|ref|YP_002504086.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium leprae Br4923]
 gi|2811063|sp|O08361|PUR7_MYCLE RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|254783968|sp|B8ZSW0|PUR7_MYCLB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|2076622|emb|CAB08411.1| PurC [Mycobacterium leprae]
 gi|13093747|emb|CAC31183.1| phosphoribosylaminoimidazole-succinocarboxamide [Mycobacterium
           leprae]
 gi|219933777|emb|CAR72325.1| phosphoribosylaminoimidazole-succinocarboxamide [Mycobacterium
           leprae Br4923]
          Length = 297

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 159/293 (54%), Gaps = 31/293 (10%)

Query: 17  SGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           SGKVRE Y + D   + +A+DR+SAFD  + + IP KG +L  ++ ++F        NH 
Sbjct: 13  SGKVREIYRIDDEHLLMVASDRISAFDYVLDSTIPDKGRILTAMSVFFFSFVD--APNHL 70

Query: 76  LDYPD-PNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLL 126
              PD P +        LV +QL M P+E + RGYL G   + LL +   GK  +    L
Sbjct: 71  AGPPDDPRIPEEVLGRALVVRQLDMLPMECVARGYLTG---SGLLDYQATGK--VCGIPL 125

Query: 127 PDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETISSYALSLF 185
           P  + +  +   P+ TP  K+       D+ IS + +I   G++  NQ   +    L ++
Sbjct: 126 PPGLVEASRFAAPLFTPAMKAVLGEH--DENISFSRMIEMVGVVRANQ---LRDRTLQIY 180

Query: 186 ERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPI 245
            +    AL+ G+I+ D+K+EFGID+  N++LADEI TPDSSRYW V+ Y    R G+   
Sbjct: 181 LQAADHALKTGIIIADTKFEFGIDRDGNLLLADEIFTPDSSRYWSVDDY----RVGVVQR 236

Query: 246 GLDKDFIRNWILTRCNPYRD----NIPDIPENIILRTSQTYIAAYEKITGLKF 294
             DK F+RNW+++  + +      + P +P++II  T   Y+  YE+I+G+ F
Sbjct: 237 SFDKQFVRNWLVSPESGWVRAGALSPPSLPDDIIEATRLCYVEVYERISGMSF 289


>gi|94969285|ref|YP_591333.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Koribacter versatilis Ellin345]
 gi|94551335|gb|ABF41259.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Candidatus Koribacter versatilis Ellin345]
          Length = 318

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 164/305 (53%), Gaps = 31/305 (10%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQ 61
           +L    IPEL  Y SGKVR+ Y +     + IA+DR+SAFD  +A  IP KG VL QI+ 
Sbjct: 25  VLLHTDIPELELYASGKVRDIYKVDSDHLLFIASDRISAFDYVLASGIPEKGRVLTQISL 84

Query: 62  YWFHHTSDICSNHTL-----DYPDP----------NVLVGQQLQMFPIELIVRGYLAGNT 106
           +WF    +I  NH +      +P              ++ Q  QM  +E +VRGYL+G  
Sbjct: 85  FWFDFLKNIVDNHLVTADVNKFPAELKAHEAQLHGRSMLVQHAQMIQVECVVRGYLSG-- 142

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    + K+G     E  LP  + ++ KLP P+ TP TK+    +G D+ IS + ++  
Sbjct: 143 -SGWKEYKKDGAVCGIE--LPKGLQESDKLPEPIFTPATKAQ---TGHDENISFDRMVQ- 195

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            +   +  E +   ++ +++     AL  G+I+ D+K+EFG+  K  ++LADE+ TPDSS
Sbjct: 196 -VTGGDLSEKLREVSIKIYKAAADYALTKGIIIADTKFEFGMTPK-GLVLADEVLTPDSS 253

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W V+ Y    + G+T    DK ++R+++       +   P +PE +  +TS+ Y+ AY
Sbjct: 254 RFWPVDKY----KPGMTQESFDKQYVRDYLEDIKWNKQPPAPGLPEEVQAKTSEKYVEAY 309

Query: 287 EKITG 291
            ++TG
Sbjct: 310 RRLTG 314


>gi|256380864|ref|YP_003104524.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinosynnema mirum DSM 43827]
 gi|255925167|gb|ACU40678.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Actinosynnema mirum DSM 43827]
          Length = 295

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/302 (29%), Positives = 160/302 (52%), Gaps = 29/302 (9%)

Query: 9   IPELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWF 64
           +P+L +Y    +GKVR  + + D   + +A+DR+SA+D  ++  IP KG VL  ++ +WF
Sbjct: 1   MPQLADYPVIATGKVRSVHAVDDELLLFVASDRISAYDHVLSTPIPDKGRVLTAMSVFWF 60

Query: 65  HHTSDICSNHTLDYPDPNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
              +D+  NH + + DP +        L+ ++L M  +E + RGYL G   + ++ + + 
Sbjct: 61  DKLADLAPNHLVAWDDPRIPAEVRGRALLVRRLDMVQVECVARGYLTG---SGMVEYRET 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP+ + +  +L  P+ TP TK+   A   +   +  E +  G L     E 
Sbjct: 118 GS--VCGVPLPEGLVEASELAEPIFTPATKAELGAHDENVSFAHVESVVGGALA----EE 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + +  L ++    + A   G++L D+K+EFG+D+   ++LADE+ TPDSSRYW  ++Y+ 
Sbjct: 172 LRARTLQVYSAAREHARSRGVVLADTKFEFGVDRAGTLVLADEVLTPDSSRYWPADSYQA 231

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGL 292
               G      DK ++R+W+ +  + +        P +P  ++  T   Y+ AYE+ITGL
Sbjct: 232 ----GRVQPSFDKQYVRDWLTSAESGWDRKSDAPPPALPAEVVAATRARYVEAYERITGL 287

Query: 293 KF 294
            F
Sbjct: 288 SF 289


>gi|41406712|ref|NP_959548.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|41395062|gb|AAS02931.1| PurC [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 296

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 108/304 (35%), Positives = 162/304 (53%), Gaps = 34/304 (11%)

Query: 9   IPELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWF 64
           +P L +Y    SGKVRE Y + D   + +ATDR+SA+D  + + IP KG +L  ++ ++F
Sbjct: 1   MPALSDYQHLASGKVRELYRVDDEHLLLVATDRISAYDFVLDSTIPDKGRILTAMSVFFF 60

Query: 65  HHTSDICSNHTLDYPD-PNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
                   NH    PD P +        LV +QL+M P+E + RGYL G   + LL +  
Sbjct: 61  GLVD--APNHLAGPPDDPRIPDEVLGRALVVRQLEMLPVECVARGYLTG---SGLLDYQA 115

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQW 174
            GK  +    LP  + +  K   P+ TP TK++      D+ IS   +I   G +  NQ 
Sbjct: 116 TGK--VCGIALPPGLVEASKFAEPLFTPATKAA--LGDHDENISFARVIEMVGGVRANQ- 170

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +    L ++ +    AL  G+I+ D+K+EFG D   N++LADEI TPDSSRYW  + Y
Sbjct: 171 --LRDRTLQIYVQAADHALRKGIIIADTKFEFGTDPDGNLLLADEIFTPDSSRYWPADEY 228

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKIT 290
               R G+     DK F+RNW+ +  + +     +  P +P++II  T   YI AYE+I+
Sbjct: 229 ----RVGVPQTSFDKQFVRNWLTSPESGWDRHGTEPPPPLPDHIIEATRNRYIEAYERIS 284

Query: 291 GLKF 294
           GL+F
Sbjct: 285 GLRF 288


>gi|225022177|ref|ZP_03711369.1| hypothetical protein CORMATOL_02211 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224945110|gb|EEG26319.1| hypothetical protein CORMATOL_02211 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 297

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 98/301 (32%), Positives = 166/301 (55%), Gaps = 30/301 (9%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           PEL  Y    +GKVRE Y + D T + + +DR+SA+D  +   IP KG VL  ++ Y+F 
Sbjct: 3   PELSQYNHVSAGKVREIYEIDDDTLLMVVSDRISAYDHILDPEIPDKGRVLTAMSMYFFD 62

Query: 66  HTSDICSNHTLDYPDPNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           H  D  ++   D  D  +        +V ++L+M P E +VRGYL G+     L      
Sbjct: 63  HI-DFPNHLAGDIDDMRIPEEVLGRAIVCKKLKMLPFECVVRGYLTGSGYKEYL-----A 116

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ + ++ KLP P+ TP TK+       D+ ++  +++ +  L   +   +
Sbjct: 117 TGSVCGIPLPEGLVESSKLPEPIFTPATKAD--LGDHDENVTFEQVVEK--LGERRATEL 172

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              +++++++  +LA   G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW +E YE  
Sbjct: 173 RDASINIYKQAAELAEAKGIILADTKFEFGVDQDGTLVLADEVLTPDSSRYWPLEGYEP- 231

Query: 238 FREGITPIGLDKDFIRNWIL-TRCNPYRDN---IPDIPENIILRTSQTYIAAYEKITGLK 293
              G      DK ++RNW+  ++C+   D+    P +P +++  T + Y+ A+E+ITG K
Sbjct: 232 ---GKVQPSFDKQYVRNWLTSSKCDWQVDSNATPPPLPGSVVEATRERYVEAFERITGEK 288

Query: 294 F 294
           F
Sbjct: 289 F 289


>gi|118466397|ref|YP_880000.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium avium 104]
 gi|254773663|ref|ZP_05215179.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium avium subsp. avium ATCC 25291]
 gi|118167684|gb|ABK68581.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium avium 104]
          Length = 296

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 107/304 (35%), Positives = 163/304 (53%), Gaps = 34/304 (11%)

Query: 9   IPELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWF 64
           +P L +Y    SGKVRE Y + D   + +ATDR+SA+D  + + IP KG +L  ++ ++F
Sbjct: 1   MPALSDYQHLVSGKVRELYRVDDEHLLLVATDRISAYDFVLDSTIPDKGRILTAMSVFFF 60

Query: 65  HHTSDICSNHTLDYPD----PNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYK 115
                   NH    PD    P+ ++G+     QL+M P+E + RGYL G   + LL +  
Sbjct: 61  GLVD--APNHLAGPPDDPRIPDEVLGRALVVRQLEMLPVECVARGYLTG---SGLLDYQA 115

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQW 174
            GK  +    LP  + +  K   P+ TP TK++      D+ IS   +I   G +  NQ 
Sbjct: 116 TGK--VCGIALPPGLVEASKFAEPLFTPATKAA--LGDHDENISFARVIEMVGGVRANQ- 170

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +    L ++ +    AL  G+I+ D+K+EFG D   N++LADEI TPDSSRYW  + Y
Sbjct: 171 --LRDRTLQIYVQAADHALRKGIIIADTKFEFGTDPDGNLLLADEIFTPDSSRYWPADEY 228

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKIT 290
               R G+     DK F+RNW+ +  + +     +  P +P++II  T   YI AYE+I+
Sbjct: 229 ----RVGVPQTSFDKQFVRNWLTSPESGWDRHGTEPPPPLPDHIIEATRNRYIEAYERIS 284

Query: 291 GLKF 294
           GL+F
Sbjct: 285 GLRF 288


>gi|295093433|emb|CBK82524.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Coprococcus sp. ART55/1]
          Length = 291

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 107/300 (35%), Positives = 163/300 (54%), Gaps = 35/300 (11%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSD 69
           EL     GKVRE Y   D + I +ATDR+S FD  +   I  KG VL Q++++WF  T D
Sbjct: 3   ELKPIKEGKVREIYDNGD-SLIMVATDRISCFDVILDNVISKKGTVLTQMSKFWFDMTQD 61

Query: 70  ICSNHTL-----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH +     D P        D N ++ ++L+M PIE IVRGY+ G   +   ++ +N
Sbjct: 62  ILPNHMISVDVKDMPEFFQQEKFDGNSMMCRKLEMLPIECIVRGYITG---SGWASYKEN 118

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS-PNEIIHRGILTRNQWE 175
           G   +    LP+ + ++ KLP P+ TP+TK+       D+ IS    I H       + E
Sbjct: 119 GT--VCGIKLPEGLKESDKLPEPIYTPSTKAE--IGDHDENISYEQSIAHLEKYFPGKGE 174

Query: 176 TISS----YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEV 231
             +S    Y ++L+++  + AL  G+I+ D+K+EFG+D+  NI+L DE+ TPDSSR+W  
Sbjct: 175 EYASKLKEYTITLYKKCAEYALTRGIIIADTKFEFGLDENGNIVLGDEMLTPDSSRFWPA 234

Query: 232 ETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           + YE     G      DK F R+W+  + NP  D    +P+++  +T   Y+  YEK+TG
Sbjct: 235 DVYEP----GHGQPSFDKQFARDWL--KANP--DKGWKLPDDVAQKTIDIYLEGYEKLTG 286


>gi|297563358|ref|YP_003682332.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296847806|gb|ADH69826.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
          Length = 278

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 160/290 (55%), Gaps = 25/290 (8%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNH 74
           +SGKVR+ Y   D   I +A+DR+S +D  +   IP KG+VL Q++ +WF   +D+  NH
Sbjct: 5   HSGKVRDVYADGDDL-ILVASDRVSVYDVVLPTPIPDKGKVLTQLSLWWFEQLADVVPNH 63

Query: 75  TLDYPD-PNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            +   D P    G     Q+L M P+E I RGYLAG     L  + K G   +    L +
Sbjct: 64  IISATDVPEEWAGRAVRCQKLTMLPVEWIARGYLAG---LGLKEYEKQGT--VSGIKLSE 118

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETISSYALSLFER 187
            + +  KLP P+ TPTTK++E   G D+ I+  +++   G  T ++  T++   L +++R
Sbjct: 119 GLVEASKLPEPIFTPTTKATE---GHDEFITFADVVEEIGQETADRLRTVT---LDVYKR 172

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G ++A E G+I+ D+K EFG      ++LADE+ T DSSR+W  + ++     G      
Sbjct: 173 GAEIAAERGIIIADTKLEFGRAADGTLVLADEVLTSDSSRFWPADDWQP----GRPQHAF 228

Query: 248 DKDFIRNWILTRCNPYRDNI-PDIPENIILRTSQTYIAAYEKITGLKFIA 296
           DK F+R+W  T  +  R    P+IP+ I+  T   YI  YE+ITG ++ A
Sbjct: 229 DKQFVRDWSSTVTDWDRTPPGPEIPDEIVEATQARYIEVYERITGKRWEA 278


>gi|315634587|ref|ZP_07889871.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Aggregatibacter segnis ATCC 33393]
 gi|315476535|gb|EFU67283.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Aggregatibacter segnis ATCC 33393]
          Length = 286

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 152/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAHI 65

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH               D      +V ++L    IE IVRGYL G   + L  + + G
Sbjct: 66  MPNHFTGDSVYDVLPKAEADLVKERAVVCKRLTPIKIESIVRGYLTG---SGLKDYKQTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I   +LP  + +  KLP P+ TP++K  E     D  IS  E     ++ ++    +
Sbjct: 123 T--ICGLVLPKGLIEASKLPEPIFTPSSK--EEIGNHDINISYAEC--EKLIGKDLAAQV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+    K AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W VETY+  
Sbjct: 177 KEKAIALYTEAAKYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVETYQ-- 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EG  P   DK FIR+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 235 --EGTNPPSFDKQFIRDWLENSGWNKQPPAPKVPSDVIQKTVDKYQEALDLLT 285


>gi|312215083|emb|CBX95036.1| similar to phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Leptosphaeria maculans]
          Length = 302

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 99/299 (33%), Positives = 163/299 (54%), Gaps = 29/299 (9%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWF----- 64
           +LP   SGKVR+ Y + D T + +A+DR+SA+D  +   IP KG +L  ++ YWF     
Sbjct: 14  KLPKVASGKVRDLYAIDDATLLFVASDRISAYDVIMENGIPGKGALLTAMSIYWFNYLPT 73

Query: 65  -------HHTSDICSNHTLDYPDPNVLVGQQLQ-----MFPIELIVRGYLAGNTKTSLLT 112
                  H  S+         P+   L G+ +Q     + PIE IVRGY+ G+  +    
Sbjct: 74  QVPGLKTHFLSNDLPAPLSSLPEAASLKGRSMQVRRLRILPIESIVRGYITGSGWSE--- 130

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRN 172
           + K+G   +    LP  + + QKLP P+ TP+TK+     G D+ ISP E   + I   N
Sbjct: 131 YKKSGT--VNGIALPKGLLEGQKLPEPLWTPSTKAE--LGGKDENISP-EQARKTIADEN 185

Query: 173 QWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVE 232
               +   +L++++     A   G++L D+K+EFG+D++  ++L DE+ TPDSSR+W  +
Sbjct: 186 VAAKVEELSLAIYKAAAARAEAVGIVLADTKFEFGLDEEGQVVLVDEVLTPDSSRFWPKD 245

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           T+E++   G      DK F+R+W+ +     ++ +  +P++I+ +T+  Y  AYEKITG
Sbjct: 246 TWEQNL--GRAQPSFDKQFLRDWLTSNGLKGKEGV-TVPQDIVEKTAAKYREAYEKITG 301


>gi|293115517|ref|ZP_05791882.2| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Butyrivibrio crossotus DSM 2876]
 gi|292809545|gb|EFF68750.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Butyrivibrio crossotus DSM 2876]
          Length = 296

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/299 (34%), Positives = 166/299 (55%), Gaps = 35/299 (11%)

Query: 15  YYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSN 73
           +  GKVRE Y   D + I +ATDR+SAFD  +   I  KG +L Q++++WF  T DI  N
Sbjct: 12  FKEGKVREVYDNGD-SLIMVATDRISAFDNILKNKITDKGAILTQMSKFWFDFTKDIVPN 70

Query: 74  HTL-----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           H +     D P+         N ++ ++L+M PIE IVRGY+ G   +   ++ +NG   
Sbjct: 71  HMISVDNKDMPEFFQKDEFKGNSMMCKKLEMLPIECIVRGYITG---SGWASYKENGT-- 125

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH--RGILTRNQWE--- 175
           +    LP+ + ++ KLP P+ TP+TK+       D+ IS  + +   + I      E   
Sbjct: 126 VCGIKLPEGLKESDKLPEPIYTPSTKAEIGLH--DENISYEQSVEVLKKIYPEKGEEYAA 183

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            I  Y ++L+++    AL  G+I+ D+K+EFG+++K  +++ DE+ TPDSSR+W +E YE
Sbjct: 184 KIKEYTIALYKKCADYALSKGIIIADTKFEFGLNEKGEVVIGDEMLTPDSSRFWPLEGYE 243

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
                G +    DK F+R+W+  + NP  DN   +PE ++ +T   Y  A+  +TG +F
Sbjct: 244 A----GKSQPSYDKQFVRDWL--KANP--DNDLLLPEEVVKKTVDKYKEAFALLTGKEF 294


>gi|298528260|ref|ZP_07015664.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511912|gb|EFI35814.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 304

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 168/309 (54%), Gaps = 34/309 (11%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQI 59
           M+++++  I E P    GKVR+ Y L   T + + TDR+SAFD  ++  IPYKG VLNQI
Sbjct: 1   MQVVTQTSITEFPLISRGKVRDIYELDPDTLLIVTTDRMSAFDVVMSQPIPYKGAVLNQI 60

Query: 60  TQYWFHHTSDICSNHTL-----DYPDP-----NVLVGQQLQM-----FPIELIVRGYLAG 104
           T +W     D+  NH +     D+P+P       L G+ + +      PIE IVRGY+ G
Sbjct: 61  TLFWMDMFKDLVDNHLISSNVEDFPEPLKPYSEELRGRSVMVRRAAPLPIECIVRGYITG 120

Query: 105 NTKTSLLTFYKNGKR--KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNE 162
           +        +K+ +R  ++  Y LP  + ++QKL  P+ TP+TK+   A   D+ I   +
Sbjct: 121 SG-------WKDYQRTGQVCGYTLPQGLVESQKLEEPLFTPSTKA--EAGAHDENIDMKQ 171

Query: 163 IIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHT 222
              +  + +   + +   +LS++ +  + A + G+++ D+K+EFG  +   I+L DE+ T
Sbjct: 172 AGEK--IGQEMLQQVQELSLSIYGQAREYAEKKGILIADTKFEFGT-RDGRIMLIDEVLT 228

Query: 223 PDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTY 282
           PDSSR+W  +TY    + G      DK ++R+W+           PD+PE II  T++ Y
Sbjct: 229 PDSSRFWPADTY----KPGQGQSSFDKQYLRDWLERSGWNKNPPPPDLPEEIINETTKKY 284

Query: 283 IAAYEKITG 291
           + AY+ +TG
Sbjct: 285 LLAYKLLTG 293


>gi|290967734|ref|ZP_06559289.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Megasphaera genomosp. type_1 str. 28L]
 gi|290782250|gb|EFD94823.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Megasphaera genomosp. type_1 str. 28L]
          Length = 291

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 106/303 (34%), Positives = 158/303 (52%), Gaps = 31/303 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           + E   + SGKVRE Y + D   I +ATDR+SAFD  +   I  KG +L Q++++WF  T
Sbjct: 1   MKEYKPFKSGKVREVYDIGDSI-IMVATDRISAFDHILKNKITEKGAILTQMSKFWFDLT 59

Query: 68  SDICSNHT-----LDYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
            DI  NH       D P+         N +  ++L M P+E IVRGY+ G+  T   T  
Sbjct: 60  KDIVPNHMESVDNHDMPEFFQQKQFIGNSMKCKKLTMIPMECIVRGYITGSGWTGYQT-- 117

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL---TR 171
                KI    LP  + ++QKLP P+ TP+TK+       +        I         R
Sbjct: 118 ---DGKICGISLPQGLQESQKLPEPLFTPSTKAELGEHDENVSFETGAAILEKTFPGKGR 174

Query: 172 NQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEV 231
                I  Y L+L+++    AL  G+I+ D+K+EFG+D+  NIIL DE+ TPDSSR+W +
Sbjct: 175 EYASKIRDYTLALYKKCADYALHRGIIIADTKFEFGLDENGNIILGDEMLTPDSSRFWPL 234

Query: 232 ETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           + Y      G +    DK F+R+W+  + +P  D +  +P+ II +T + Y  AYE + G
Sbjct: 235 DGY----TPGKSQPSYDKQFVRDWL--KVHPDSDYL--LPQEIIDKTIEKYKEAYELLCG 286

Query: 292 LKF 294
            K+
Sbjct: 287 KKW 289


>gi|222832159|gb|EEE70636.1| predicted protein [Populus trichocarpa]
          Length = 286

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 156/293 (53%), Gaps = 28/293 (9%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNH-T 75
           GKVR+NY + D   + +A+DRLSAFD  +   IP KGE+L Q+  +WF     IC NH T
Sbjct: 3   GKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGELLTQMALFWFDKLGHICPNHLT 62

Query: 76  LDYPD--------PNV----LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
            + P+        P V    ++ ++L+   IE +VRGYLAG    S    Y+   R +  
Sbjct: 63  GEAPESVVTPAEVPQVTGRSMLVKRLKPVLIEAVVRGYLAG----SGWKEYQE-SRSVCG 117

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ +++  KLP P+ TP  K+       D+ I+    +   ++       I   A+ 
Sbjct: 118 VPLPEGLTNAAKLPEPIYTPAAKAE--MGDHDENITYERTVE--MVGEKLASQIRDTAIR 173

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           +++    +ALE G+I+ D+K+EFG+D+   ++L DE+ TPDSSRYW VE Y ++   G  
Sbjct: 174 IYKEAAAIALEKGMIIADTKFEFGLDENGELVLMDEVLTPDSSRYWPVEGYAQALANGEN 233

Query: 244 PIGLDKDFIRNWI---LTRCNPYRDNIPD--IPENIILRTSQTYIAAYEKITG 291
           P   DK F+R+W+        P+  + P   +P+ +  +T+  Y  A +++T 
Sbjct: 234 PPSYDKQFVRDWLEQAQVNGKPWDKSAPAPRLPQEVTEKTAAKYREALQRLTA 286


>gi|145222208|ref|YP_001132886.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium gilvum PYR-GCK]
 gi|189038227|sp|A4T7K2|PUR7_MYCGI RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|145214694|gb|ABP44098.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium gilvum PYR-GCK]
          Length = 297

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 104/302 (34%), Positives = 157/302 (51%), Gaps = 32/302 (10%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           P L +Y    SGKVRE Y + D   + +ATDR+SA+D  +   IP KG VL  ++ ++F 
Sbjct: 3   PALSDYQHLASGKVRELYRVDDRHLLFVATDRISAYDFILDSEIPDKGRVLTAMSVFFFG 62

Query: 66  HTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH    PD            LV +QL M P+E + RGYL G   + L+ + K 
Sbjct: 63  LVD--SPNHLAGPPDDERIPEEVLGRALVVRQLDMLPVEAVARGYLTG---SGLIDYQKT 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP  + +  K   P+ TP TK+       D  I+ ++++   ++   + E 
Sbjct: 118 GS--VCGIPLPSGLVEASKFDEPLFTPATKADLGEH--DVNITYDDVVE--LIGAERAEQ 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L+++++G   AL NG+I+ D+K+EFGID    + LADE+ TPDSSRYW  + Y  
Sbjct: 172 LRERTLAVYQQGADHALSNGIIVADTKFEFGIDADGELTLADEVFTPDSSRYWRADDYA- 230

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGL 292
              EG      DK F+RNW+    + +  N     P +P +I+  T   YI AYE+I+GL
Sbjct: 231 ---EGQVQNSFDKQFVRNWLTGPDSGWDRNGDQAPPPLPPDIVAATRARYIEAYERISGL 287

Query: 293 KF 294
           +F
Sbjct: 288 RF 289


>gi|238916397|ref|YP_002929914.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Eubacterium eligens ATCC 27750]
 gi|259546867|sp|C4Z3J8|PUR7_EUBE2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|238871757|gb|ACR71467.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Eubacterium eligens ATCC 27750]
          Length = 296

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 97/298 (32%), Positives = 170/298 (57%), Gaps = 35/298 (11%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVRE Y   D   + +ATDR+SAFD  +   +  KG +L Q++++WF +T D+ +NH
Sbjct: 12  YEGKVREVYDCDD-KLVMVATDRISAFDHILKNKVTEKGAILTQMSKFWFDYTKDVVANH 70

Query: 75  TL-----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
            +     D P+           ++ ++L M P+E IVRGY+ G   +   ++ +NG   +
Sbjct: 71  MVSVDVNDMPEFFHKDEYIGRSMLCKKLTMLPVECIVRGYITG---SGWASYKENGT--V 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTRN-QWET- 176
               LP+ + +++KLP P+ TP+TK+       D+ IS     E++ +    +  ++ T 
Sbjct: 126 CGIKLPEGLKESEKLPEPIYTPSTKAE--IGDHDENISFEKSIEVLEKQFPGKGLEYATK 183

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           I    ++L+++  + AL  G+I+ D+K+EFG+D+   +++ DE+ TPDSSR+W +E YE 
Sbjct: 184 IKDATITLYKKCAEYALSKGIIIADTKFEFGLDENGEVVIGDEMLTPDSSRFWPLEGYEA 243

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
               G +    DK F+R+W+  + NP  D +  +P+++I +T + Y  AY+ +TG  F
Sbjct: 244 ----GKSQPSYDKQFVRDWL--KANPDSDYL--LPDDVIEKTVEKYKEAYKLLTGKDF 293


>gi|119718556|ref|YP_925521.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nocardioides sp. JS614]
 gi|119539217|gb|ABL83834.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nocardioides sp. JS614]
          Length = 284

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 157/297 (52%), Gaps = 25/297 (8%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
           IP   + +SGKVR+ Y L  G  + +A+DR+S FD  +   IP KGE+L +++ +WF   
Sbjct: 2   IPGATHLHSGKVRDLYELPGGELLMVASDRISIFDFVLDTTIPDKGEILTRMSLWWFDRL 61

Query: 68  SDICSNHTL--DYPDPNV----LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           +D+  NH L  D P P V    +V ++L M+P+E + RGYL G   + L+ +  +G   +
Sbjct: 62  ADLVPNHVLSTDVP-PEVRGRAVVCERLAMYPVECVARGYLTG---SGLVDYRASGA--V 115

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LP  + D  +LP PV TP TK+       D+ +S + +   G +  ++   +    
Sbjct: 116 CGIALPAGLVDGSRLPEPVFTPATKAELGEH--DENVSYDAVA--GTVGADRAAELRDLT 171

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L ++ R   +A E G+IL D+K EFG       +LADE+ TPDSSR+W    +E     G
Sbjct: 172 LRVYARAESIARERGIILADTKLEFGARPDGTTVLADEVLTPDSSRFWPAAEWEP----G 227

Query: 242 ITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
                 DK  +RNW L+  + +     +  P +P  ++ RT   Y+ A+E +TG ++
Sbjct: 228 HAQPSYDKQIVRNWALSPESGWDRSSGEAPPPLPAEVVERTRSRYVEAFELLTGERW 284


>gi|91790458|ref|YP_551410.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polaromonas sp. JS666]
 gi|122967235|sp|Q122N0|PUR7_POLSJ RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|91699683|gb|ABE46512.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polaromonas sp. JS666]
          Length = 302

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 96/307 (31%), Positives = 159/307 (51%), Gaps = 28/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L  + +  LP    GKVR+NY +     + +A+DRLSAFD  +   IP KG +L Q+  +
Sbjct: 5   LHTSALTSLPLLARGKVRDNYAVGQDRLLMVASDRLSAFDVILGEPIPGKGALLTQMALF 64

Query: 63  WFHHTSDICSNH-TLDYPD--------PNV----LVGQQLQMFPIELIVRGYLAGNTKTS 109
           WF     +C NH T + P+        P V    ++ ++L+  P+E +VRGYLAG+    
Sbjct: 65  WFAKLGHLCPNHLTGEAPESVVTAAELPQVTGRSMLVKRLKPLPVEAVVRGYLAGSGWKE 124

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
               Y+   + +    LP  + +  KLP P+ TP  K+       D+ IS  ++    ++
Sbjct: 125 ----YQE-SQSVCGVPLPAGLKNAGKLPEPIFTPAAKAEVGEH--DENISYEQV--EKVV 175

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
                  I   ++ +++     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSRYW
Sbjct: 176 GPELAAQIKKISIEIYKTAAAFALTKGIIIADTKFEFGLDENGTLTLMDEVLTPDSSRYW 235

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWI-LTRCN--PYRDN--IPDIPENIILRTSQTYIA 284
            +E YE ++  G+ P   DK F+R+W+   R N  P+      P +P +++ +T+  Y  
Sbjct: 236 PIEGYEAAYAAGLNPPSYDKQFVRDWLEAVRINGKPWDKTPPSPQLPPDVVAKTAAKYQE 295

Query: 285 AYEKITG 291
           A  ++ G
Sbjct: 296 ALTRLAG 302


>gi|134103572|ref|YP_001109233.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Saccharopolyspora erythraea NRRL 2338]
 gi|291008067|ref|ZP_06566040.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Saccharopolyspora erythraea NRRL 2338]
 gi|166230841|sp|A4FQI3|PUR7_SACEN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|133916195|emb|CAM06308.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Saccharopolyspora erythraea NRRL 2338]
          Length = 297

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 95/300 (31%), Positives = 159/300 (53%), Gaps = 28/300 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + + P   +GKVR+ + + D   + +A+DR+SAFD  ++  IP KG VL  ++ +WF+  
Sbjct: 4   LADYPQIAAGKVRQLHAVDDEHLLLVASDRISAFDHVLSTPIPDKGRVLTAMSVFWFNLL 63

Query: 68  SDICSNHTLDYPDPNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR 119
           SD+  NH + + DP +        L+ ++L+M  +E + RGYL G   + LL + + G  
Sbjct: 64  SDVVPNHLVAWDDPRIPAEVRGRALLVRRLEMLQVECVARGYLTG---SGLLDYQRTGA- 119

Query: 120 KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISS 179
            +   +LP+ +++  +LP P+ TP TK+   A   D+ +S   +     + +     +  
Sbjct: 120 -VCGVVLPEGLTEASRLPEPIFTPATKAELGAH--DENVSFEAVAE--AVGQELAAELRE 174

Query: 180 YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFR 239
             L ++ R  + A E G+IL D+K+EFG+     ++L DE+ TPDSSRYW  + YE    
Sbjct: 175 LTLRVYGRAAEHARERGVILADTKFEFGVAGGGALVLGDEVLTPDSSRYWPADGYEP--- 231

Query: 240 EGITPIGLDKDFIRNWILTRCNPYRDNIP-----DIPENIILRTSQTYIAAYEKITGLKF 294
            G      DK ++RNW LT      D         +P++++  T   Y+ AYE+ITGL  
Sbjct: 232 -GKVQPSFDKQYVRNW-LTSAESGWDRASDTPPPPLPDDVVAATRARYVEAYERITGLDL 289


>gi|253577820|ref|ZP_04855092.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850138|gb|EES78096.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ruminococcus sp. 5_1_39BFAA]
          Length = 294

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 107/305 (35%), Positives = 166/305 (54%), Gaps = 35/305 (11%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           + E+     GKVRE Y   D + I +ATDR+S FD  +   +  KG VL Q++++WF  T
Sbjct: 6   MQEMKPIKEGKVREIYDNGD-SLIMVATDRISCFDVILNNQVTKKGTVLTQMSKFWFDMT 64

Query: 68  SDICSNHTL-----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
            DI  NH +     D P        D N ++ ++L+M PIE IVRGY+ G+   S   + 
Sbjct: 65  EDILPNHMISVDVKDMPEFFQQEKFDGNSMMCRKLEMLPIECIVRGYITGSGWES---YK 121

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS-PNEIIHRGILTRNQ 173
           K GK  +    LP+ + ++ KLP P+ TP+TK+       D+ IS    I H       +
Sbjct: 122 KTGK--VCGIELPEGLKESDKLPEPIYTPSTKAE--IGDHDENISYEQSIAHLEKYFPGR 177

Query: 174 WETISSY----ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
            E +++      ++L+++  + AL  G+I+ D+K+EFG+DK  N+++ DE+ TPDSSR+W
Sbjct: 178 GEELAAKLRDNTIALYKKCAEYALSKGIIIADTKFEFGLDKDGNMVIGDEMLTPDSSRFW 237

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKI 289
             E YE     G      DK F R+W+  + NP  DN   +P++I+ +T   Y+  YE +
Sbjct: 238 PAEGYEP----GHGQPSFDKQFARDWL--KANP--DNDWTLPQDIVDKTIGKYLQGYEML 289

Query: 290 TGLKF 294
           TG K 
Sbjct: 290 TGKKL 294


>gi|296392673|ref|YP_003657557.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Segniliparus rotundus DSM 44985]
 gi|296179820|gb|ADG96726.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Segniliparus rotundus DSM 44985]
          Length = 295

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 98/302 (32%), Positives = 160/302 (52%), Gaps = 34/302 (11%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + E P+ +SGKVR+ Y + D   + +A+DR+SA+D  ++  IP KG VL  ++ Y+F   
Sbjct: 5   LAEYPHVHSGKVRDLYAVDDEHLLFVASDRVSAYDHVLSTPIPDKGRVLTALSVYFFDTL 64

Query: 68  SDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           S   +NH    PD            LV ++L+M P+E +VRG+L G   +    + + G 
Sbjct: 65  S--AANHLAGPPDDERIPHEVLGRALVVRRLRMVPVECVVRGFLTG---SGWAEYQQEGS 119

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
             +    LP  + +N +L  P+ TPTTK+       D+ IS  ++  +  +  +    + 
Sbjct: 120 --VSGVALPPGLRENARLEPPIFTPTTKAELGEH--DESISLEKVAEQ--VGTDLAHRLR 173

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
             AL +F    +   + GL LVD+K+EFG+D +  ++LADE  TPDSSRYW  E+   S 
Sbjct: 174 DAALGIFRSAARHVADRGLTLVDTKFEFGLDPQGQLVLADEALTPDSSRYWPAESPGTS- 232

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITGLKF 294
                   LDK F+RNW+ +  + +  +     P +P++++  T   Y+  YE++TGL F
Sbjct: 233 --------LDKQFVRNWLTSPESGWSKSGGTAPPALPDDVVAATRARYVQLYEQVTGLSF 284

Query: 295 IA 296
            A
Sbjct: 285 AA 286


>gi|15607920|ref|NP_215294.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis H37Rv]
 gi|15840195|ref|NP_335232.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis CDC1551]
 gi|31791968|ref|NP_854461.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium bovis AF2122/97]
 gi|121636704|ref|YP_976927.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|148660557|ref|YP_001282080.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis H37Ra]
 gi|148821985|ref|YP_001286740.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis F11]
 gi|167968881|ref|ZP_02551158.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis H37Ra]
 gi|215402570|ref|ZP_03414751.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis 02_1987]
 gi|215410346|ref|ZP_03419154.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis 94_M4241A]
 gi|215426032|ref|ZP_03423951.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis T92]
 gi|215426036|ref|ZP_03423955.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis T92]
 gi|215429630|ref|ZP_03427549.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis EAS054]
 gi|215444913|ref|ZP_03431665.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis T85]
 gi|218752438|ref|ZP_03531234.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis GM 1503]
 gi|219556640|ref|ZP_03535716.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis T17]
 gi|224989176|ref|YP_002643863.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253797726|ref|YP_003030727.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis KZN 1435]
 gi|254231094|ref|ZP_04924421.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis C]
 gi|254363722|ref|ZP_04979768.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis str. Haarlem]
 gi|254549748|ref|ZP_05140195.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis '98-R604 INH-RIF-EM']
 gi|260185672|ref|ZP_05763146.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis CPHL_A]
 gi|260199795|ref|ZP_05767286.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis T46]
 gi|260203969|ref|ZP_05771460.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis K85]
 gi|289442183|ref|ZP_06431927.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis T46]
 gi|289446345|ref|ZP_06436089.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis CPHL_A]
 gi|289553037|ref|ZP_06442247.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis KZN 605]
 gi|289568732|ref|ZP_06448959.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis T17]
 gi|289573399|ref|ZP_06453626.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis K85]
 gi|289744504|ref|ZP_06503882.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis 02_1987]
 gi|289749289|ref|ZP_06508667.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purc
           [Mycobacterium tuberculosis T92]
 gi|289749294|ref|ZP_06508672.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purc
           [Mycobacterium tuberculosis T92]
 gi|289752828|ref|ZP_06512206.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis EAS054]
 gi|289756868|ref|ZP_06516246.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purc
           [Mycobacterium tuberculosis T85]
 gi|289760908|ref|ZP_06520286.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis GM 1503]
 gi|294996257|ref|ZP_06801948.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis 210]
 gi|297633290|ref|ZP_06951070.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis KZN 4207]
 gi|297730273|ref|ZP_06959391.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis KZN R506]
 gi|298524270|ref|ZP_07011679.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purc
           [Mycobacterium tuberculosis 94_M4241A]
 gi|306774898|ref|ZP_07413235.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu001]
 gi|306781371|ref|ZP_07419708.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu002]
 gi|306783440|ref|ZP_07421762.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu003]
 gi|306787811|ref|ZP_07426133.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu004]
 gi|306792184|ref|ZP_07430486.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu005]
 gi|306796545|ref|ZP_07434847.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu006]
 gi|306802405|ref|ZP_07439073.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu008]
 gi|306806613|ref|ZP_07443281.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu007]
 gi|306966809|ref|ZP_07479470.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu009]
 gi|306971003|ref|ZP_07483664.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu010]
 gi|307078734|ref|ZP_07487904.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu011]
 gi|307083296|ref|ZP_07492409.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu012]
 gi|313657598|ref|ZP_07814478.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis KZN V2475]
 gi|61230085|sp|P0A5T4|PUR7_MYCTU RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|61230086|sp|P0A5T5|PUR7_MYCBO RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|166230821|sp|A1KGR3|PUR7_MYCBP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|166230825|sp|A5U0G8|PUR7_MYCTA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|254783967|sp|C1ALB6|PUR7_MYCBT RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|1550658|emb|CAB02370.1| PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE PURC
           (SAICAR SYNTHETASE) [Mycobacterium tuberculosis H37Rv]
 gi|13880350|gb|AAK45046.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis CDC1551]
 gi|31617555|emb|CAD93665.1| PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE PURC
           (SAICAR SYNTHETASE) [Mycobacterium bovis AF2122/97]
 gi|121492351|emb|CAL70818.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|124600153|gb|EAY59163.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis C]
 gi|134149236|gb|EBA41281.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis str. Haarlem]
 gi|148504709|gb|ABQ72518.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis H37Ra]
 gi|148720512|gb|ABR05137.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis F11]
 gi|224772289|dbj|BAH25095.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253319228|gb|ACT23831.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis KZN 1435]
 gi|289415102|gb|EFD12342.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis T46]
 gi|289419303|gb|EFD16504.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis CPHL_A]
 gi|289437669|gb|EFD20162.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis KZN 605]
 gi|289537830|gb|EFD42408.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis K85]
 gi|289542486|gb|EFD46134.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis T17]
 gi|289685032|gb|EFD52520.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis 02_1987]
 gi|289689876|gb|EFD57305.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purc
           [Mycobacterium tuberculosis T92]
 gi|289689881|gb|EFD57310.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purc
           [Mycobacterium tuberculosis T92]
 gi|289693415|gb|EFD60844.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium tuberculosis EAS054]
 gi|289708414|gb|EFD72430.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis GM 1503]
 gi|289712432|gb|EFD76444.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purc
           [Mycobacterium tuberculosis T85]
 gi|298494064|gb|EFI29358.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purc
           [Mycobacterium tuberculosis 94_M4241A]
 gi|308216563|gb|EFO75962.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu001]
 gi|308325821|gb|EFP14672.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu002]
 gi|308331774|gb|EFP20625.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu003]
 gi|308335562|gb|EFP24413.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu004]
 gi|308339330|gb|EFP28181.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu005]
 gi|308343042|gb|EFP31893.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu006]
 gi|308346927|gb|EFP35778.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu007]
 gi|308350867|gb|EFP39718.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu008]
 gi|308355506|gb|EFP44357.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu009]
 gi|308359458|gb|EFP48309.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu010]
 gi|308363365|gb|EFP52216.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu011]
 gi|308367002|gb|EFP55853.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis SUMu012]
 gi|323720811|gb|EGB29881.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis CDC1551A]
 gi|326904999|gb|EGE51932.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis W-148]
 gi|328457505|gb|AEB02928.1| phosphoribosylaminoimidazole-succinocarboxamide synthase purC
           [Mycobacterium tuberculosis KZN 4207]
          Length = 297

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 105/303 (34%), Positives = 161/303 (53%), Gaps = 34/303 (11%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           P L +Y    SGKVRE Y + D   + +A+DR+SA+D  + + IP KG VL  ++ ++F 
Sbjct: 3   PALSDYQHVASGKVREIYRVDDEHLLLVASDRISAYDYVLDSTIPDKGRVLTAMSAFFFG 62

Query: 66  HTSDICSNHTLDYPD----PNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH    PD    P+ ++G+     +L+M P+E + RGYL G   + LL +   
Sbjct: 63  LVD--APNHLAGPPDDPRIPDEVLGRALVVRRLEMLPVECVARGYLTG---SGLLDYQAT 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWE 175
           GK  +    LP  + +  +   P+ TP TK++      D+ IS + ++   G L  NQ  
Sbjct: 118 GK--VCGIALPPGLVEASRFATPLFTPATKAA--LGDHDENISFDRVVEMVGALRANQ-- 171

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L  + +    AL  G+I+ D+K+EFGID+  N++LADEI TPDSSRYW  + Y 
Sbjct: 172 -LRDRTLQTYVQAADHALTRGIIIADTKFEFGIDRHGNLLLADEIFTPDSSRYWPADDY- 229

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITG 291
              R G+     DK F+R+W+    + +        P +PE+I+  T   YI AYE+I+ 
Sbjct: 230 ---RAGVVQTSFDKQFVRSWLTGSESGWDRGSDRPPPPLPEHIVEATRARYINAYERISE 286

Query: 292 LKF 294
           LKF
Sbjct: 287 LKF 289


>gi|152968042|ref|YP_001363826.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Kineococcus radiotolerans SRS30216]
 gi|151362559|gb|ABS05562.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Kineococcus radiotolerans SRS30216]
          Length = 295

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 95/294 (32%), Positives = 152/294 (51%), Gaps = 27/294 (9%)

Query: 16  YSGKVRENYFLS---DGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDIC 71
           YSGKVR+ Y  S   DGT + +A+DR+SA+D  + + +P KG+VL  ++ +WF   +D+ 
Sbjct: 16  YSGKVRDLYVPSAGRDGTVLVVASDRISAYDHVLTSTVPDKGKVLTALSLWWFEQLADVV 75

Query: 72  SNHTLDYPDPNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLL 126
            +H L    P  + G+     +L MFP+E + RGYL G    S L  Y+     +    L
Sbjct: 76  PHHVLSTDVPAAVAGRAMVCRELDMFPVECVARGYLTG----SGLVEYR-ASSTVCGLEL 130

Query: 127 PDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFE 186
           P  + D  +L  P+ TP TK+       D+ +S   +             + +  L+++ 
Sbjct: 131 PPGLVDGSRLAEPIFTPATKAEVGEH--DENVSFEHVAATIGADAAA--ELRALTLAVYR 186

Query: 187 RGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIG 246
           R   LA E G++L D+K EFG      + L DE+ TPDSSR+W  E++E     G     
Sbjct: 187 RAEGLARERGIVLADTKLEFGTADGVTV-LGDEVLTPDSSRFWPAESWEP----GRAQPS 241

Query: 247 LDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
            DK F+R+W+ +  + +        P++P  ++ +T   Y+ AYE++TGL F A
Sbjct: 242 FDKQFVRDWLTSPASGWDPKGTGAPPELPAEVVEKTRARYVDAYERLTGLSFTA 295


>gi|45190824|ref|NP_985078.1| AER221Wp [Ashbya gossypii ATCC 10895]
 gi|44983866|gb|AAS52902.1| AER221Wp [Ashbya gossypii ATCC 10895]
          Length = 302

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 165/305 (54%), Gaps = 36/305 (11%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWF------ 64
           LP    GKVR+ Y +   T + +ATDR+SA+D  +A  IP KG +L +++++WF      
Sbjct: 12  LPLVARGKVRDIYEVDQETLLFVATDRISAYDVIMANAIPDKGVLLTRLSEFWFKFLEKD 71

Query: 65  --HHTSDICSNHTLDYPDP------------NVLVGQQLQMFPIELIVRGYLAGNTKTSL 110
             +H    C       PD               L+ Q+ ++ P+E+IVRGY+ G   ++ 
Sbjct: 72  VRNHLRAPCEGLFGGLPDALTSPEYRSQLEGRSLLVQRYRLIPLEVIVRGYITG---SAW 128

Query: 111 LTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILT 170
             + + G   ++   LP  + ++++LP P+ TP+TK+ + A   D+ ISP +     ++ 
Sbjct: 129 KEYQERGT--VHGLALPAGLRESEELPEPMFTPSTKAEQGAH--DENISPAQAAD--LIG 182

Query: 171 RNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYW 229
           +   + +++ A+ L+ +  K A E G+I+ D+K+EFGID K   I+L DE+ TPDSSR+W
Sbjct: 183 QELCDRVAALAIRLYSKCKKYARERGIIIADTKFEFGIDDKSGEIVLVDEVLTPDSSRFW 242

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKI 289
               YE     G      DK F+RNW+ +      D +  +PE I+ RT + Y+ AYE +
Sbjct: 243 NAANYEV----GKPQDSYDKQFLRNWLTSNKLNGVDGV-SMPEEIVTRTKEKYVEAYEAL 297

Query: 290 TGLKF 294
           TG K+
Sbjct: 298 TGAKW 302


>gi|213405597|ref|XP_002173570.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Schizosaccharomyces japonicus yFS275]
 gi|212001617|gb|EEB07277.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Schizosaccharomyces japonicus yFS275]
          Length = 300

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 98/298 (32%), Positives = 163/298 (54%), Gaps = 33/298 (11%)

Query: 17  SGKVRENYFLSD--GTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWF-----HHTS 68
           SGKVR+ Y   +   T   +ATDR+SAFD  +   IP KG++L +I+++WF     H  +
Sbjct: 18  SGKVRDIYECQEDLSTLYFVATDRISAFDVIMENGIPDKGKILTKISEFWFNVLKPHTAT 77

Query: 69  DICSNHTLDYPDPNVLVGQQLQ----------MFPIELIVRGYLAGNTKTSLLTFYKNGK 118
            + ++     P        QL+          + PIE IVRGY+ G+  +    + K+G 
Sbjct: 78  HLVTSEWDKMPAVAAPFADQLKDRTMLVRRYKVLPIEAIVRGYITGSAWSE---YKKSGT 134

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
             ++   +P+ M ++Q  P P+ TP+TK++E   G D+ I P+++  + I+  +    ++
Sbjct: 135 --VHGMPMPEGMQESQAFPEPLFTPSTKAAE---GHDENIHPDQV--KDIIGADLAAKVA 187

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
             ++ L++     A E G+I+ D+K+EFG+D++ N+IL DE+ TPDSSR+W    Y    
Sbjct: 188 ELSVKLYKVARDTAKEKGIIIADTKFEFGVDEQNNVILVDEVLTPDSSRFWLAADYAV-- 245

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
             G      DK ++RNW++      +  +  +PENI+  T Q YI AYE I G K++A
Sbjct: 246 --GKPQESFDKQYLRNWLIAENVRGKPGV-KLPENIVSSTRQKYIEAYEMICGKKWVA 300


>gi|297159124|gb|ADI08836.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces bingchenggensis BCW-1]
          Length = 306

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 102/307 (33%), Positives = 162/307 (52%), Gaps = 35/307 (11%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRDLYRNEKGDLVMVASDRMSAYDWVLPTEIPDKGRVLTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
            D+  NH L    P           LV Q L M P+E + RGYL G    S LT Y+   
Sbjct: 73  IDVVPNHVLSTEVPEGAPADWAGRTLVCQSLSMLPVECVARGYLTG----SGLTEYRE-S 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETI 177
           R +    LP+ ++D  +LP P+ TP TK+       D+ +   E+  R G  T  Q   +
Sbjct: 128 RTVCGIALPEGLADGSELPSPIFTPATKAEVGEH--DENVPYEEVARRVGTETATQ---L 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN------IILADEIHTPDSSRYWEV 231
               L+++ RG  +A + G+IL D+K+EFG    +       ++LADE+ TPDSSR+W  
Sbjct: 183 RQATLAVYNRGRDIARDRGIILADTKFEFGHALAEGGADGHELVLADEVLTPDSSRFWPA 242

Query: 232 ETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYE 287
           + ++     G      DK F+R+W+ +  + +  +     P +PE I+ RT   Y+ AYE
Sbjct: 243 DQWQP----GRPQPSFDKQFVRDWLTSAASGWDRHSEQPPPPLPEEIVERTRAKYVEAYE 298

Query: 288 KITGLKF 294
           ++TG+++
Sbjct: 299 RLTGIRW 305


>gi|296413674|ref|XP_002836534.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295630361|emb|CAZ80725.1| unnamed protein product [Tuber melanosporum]
          Length = 300

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 166/297 (55%), Gaps = 31/297 (10%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT-SD 69
           LP    GKVR+ Y LS    + +ATDR+SA+D  +   IP KG++L  ++++WF     D
Sbjct: 12  LPLLAQGKVRDVYTLSSDHLLFVATDRISAYDVIMKNGIPNKGKLLTALSEFWFTTVLKD 71

Query: 70  ICSNH----TLDYPDPNV-----------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           +  NH    ++++    +           +V ++L++FP+E IVRGYL G   ++ + + 
Sbjct: 72  VGLNHFVSSSMEFLPEKLQKYSAQLKGRSMVVKRLKIFPVEAIVRGYLTG---SAWIEYK 128

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           K+G   ++   +P+ M ++Q    P+ TP+TK+++     D+ I P++     ++     
Sbjct: 129 KSGT--VHGIRVPEGMVESQAFEKPLFTPSTKAAQGKH--DENIHPDKTAQ--LVGHEYA 182

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
           + I   +L+L+ +    A E G+I+ D+K+EFG+D+  N++L DE+ TPDSSR+W     
Sbjct: 183 KEIEKLSLALYTKARDYAAERGIIIADTKFEFGLDEDGNVVLVDEVLTPDSSRFW----L 238

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
             ++R G +    DK F+RNW+       R  I  +P+ I+L TS+ Y  AYE +TG
Sbjct: 239 SSAYRAGRSQDSYDKQFLRNWLTESGVKGRPGIV-MPDEIVLETSKKYHEAYELLTG 294


>gi|262200838|ref|YP_003272046.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase [Gordonia
           bronchialis DSM 43247]
 gi|262084185|gb|ACY20153.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase [Gordonia
           bronchialis DSM 43247]
          Length = 299

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 105/303 (34%), Positives = 156/303 (51%), Gaps = 34/303 (11%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFH 65
           P+L +Y    SGKVRE Y +   T + +A+DR+SA+D  ++  I  KG +L  ++ +WF 
Sbjct: 3   PDLQSYRHLASGKVREIYEIDSDTLLLVASDRISAYDHILSPAIGDKGRILTAMSFFWFD 62

Query: 66  HTSDICSNHTLDYPD----PNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH    P     P   VG+     +L M  +E + RGYL G   + LL +  +
Sbjct: 63  VLG--VPNHLAGGPTDERIPAEAVGRSMVVRRLPMVQVECVARGYLTG---SGLLDYQAS 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP  + +  KLP P+ TP TK+ +     D+ IS   ++ +    R   E 
Sbjct: 118 GA--VCGIALPAGLGEASKLPEPIFTPATKAEQGEH--DENISFEHVVAQEGAQRA--EA 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L ++ RG ++A E G+IL D+K+EFG+     ++LADE+ TPDSSRYWE  TY  
Sbjct: 172 LRQATLDIYSRGAEIAAERGIILADTKFEFGLGDDGELVLADEVLTPDSSRYWEAATY-- 229

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI-----PDIPENIILRTSQTYIAAYEKITG 291
             R G      DK  +RNW LT  +   D       P +P++++ RT Q YI AYE I+ 
Sbjct: 230 --RPGEVQPSFDKQIVRNW-LTGLDSGWDRASDTPPPALPDDVVARTRQRYIEAYEWISQ 286

Query: 292 LKF 294
             F
Sbjct: 287 RSF 289


>gi|239930319|ref|ZP_04687272.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces ghanaensis ATCC 14672]
 gi|291438664|ref|ZP_06578054.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces ghanaensis ATCC 14672]
 gi|291341559|gb|EFE68515.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces ghanaensis ATCC 14672]
          Length = 299

 Score =  159 bits (401), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 95/300 (31%), Positives = 157/300 (52%), Gaps = 28/300 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVRE Y    G  + +A+DR+SA+D  +   IP KG +L Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRELYRNEAGDLVMVASDRISAYDWVLPTEIPDKGRILTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  +H L    P           LV + L M P+E + RGYL G    S L  Y N  
Sbjct: 73  ADLLPHHVLSTEVPAGAPDDWAGRTLVCKSLNMVPVECVARGYLTG----SGLAEY-NES 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP+ + D  +LP P+ TP TK++      D+ +S  E+  +  +  +    + 
Sbjct: 128 RTVCGLALPEGLVDGSELPAPIFTPATKAAVGEH--DENVSYEEVARQ--VGADTAARLR 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L+ + R   +A E G+IL D+K+EFG D  +++++ADE+ TPDSSR+W  E +E   
Sbjct: 184 QATLAAYSRARDVARERGIILADTKFEFGFDG-ESLVIADEVLTPDSSRFWPAEQWEP-- 240

Query: 239 REGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
             G      DK ++R+W+ +  + +        P +P  ++  T   Y+ AYE++TG  +
Sbjct: 241 --GRAQPSYDKQYVRDWLTSAESGWDRRGEQPPPPLPRQVVDATRAKYVEAYERLTGTAW 298


>gi|297563555|ref|YP_003682529.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296848003|gb|ADH70023.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
          Length = 301

 Score =  159 bits (401), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 95/296 (32%), Positives = 154/296 (52%), Gaps = 27/296 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           L + ++GKVRE Y  +DG+ + +A+DR+SA+D  +   IP KG +L Q++ +WF     +
Sbjct: 16  LTHLHTGKVRELYAAADGSLVMVASDRVSAYDWVLPTEIPGKGRLLTQLSLWWFDQLGGL 75

Query: 71  CSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
             NH +    P           LV ++L M P+E + RGYL G   + L  +  +G   +
Sbjct: 76  VPNHVVSDVLPEGAPADWAGRTLVCRRLDMVPVECVARGYLTG---SGLEEYRADGT--V 130

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LPD + D  +LP P+ TP TK+       D+ +S   +             +    
Sbjct: 131 CGIALPDGLVDGSELPEPIFTPATKAE--VGDHDENVSFEAVAAAHGAGLAA--ELRDLT 186

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L ++ RG +LA E G+IL D+K+E+G D    ++LADE+ TPDSSRYW  +T+      G
Sbjct: 187 LRVYGRGRELARERGIILADTKFEYGRDASGELVLADEVFTPDSSRYWPADTWAP----G 242

Query: 242 ITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLK 293
                 DK  +R+W+ +  + +        P++PE+++ RT   Y+  YE++TG K
Sbjct: 243 GPQTSFDKQVLRDWLRSPESGWDRASETPPPELPEHVVQRTLDRYVEIYERLTGTK 298


>gi|300859150|ref|YP_003784133.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Corynebacterium pseudotuberculosis FRC41]
 gi|300686604|gb|ADK29526.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Corynebacterium pseudotuberculosis FRC41]
 gi|302206844|gb|ADL11186.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium pseudotuberculosis C231]
 gi|308277096|gb|ADO26995.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium pseudotuberculosis I19]
          Length = 297

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 159/301 (52%), Gaps = 30/301 (9%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           PEL  Y    +GKVRE Y + D   + + +DR+SA+D  +   IP KG VL  ++ Y+F 
Sbjct: 3   PELSQYTHVSAGKVREIYEIDDERLLMVVSDRISAYDHILDPEIPDKGRVLTAMSMYFFD 62

Query: 66  HTSDICSNHTLDYPDPNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           H  D  ++      DP +        LV ++L+M P E + RGYL G   + L  + + G
Sbjct: 63  HI-DFPNHLAGSIDDPAIPEEVLGRALVCKKLKMLPFECVARGYLTG---SGLKEYQQTG 118

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           K    E  LP+ + +  KLP P+ TP TK+       D+ +S + ++ +  L   +   +
Sbjct: 119 KVCGIE--LPEGLVEASKLPSPIFTPATKAD--FGDHDENVSFDAVVDK--LGEARANEL 172

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            +  L ++     +A   G+IL D+K+EFG+D+  N++LADE  TPDSSRYW  + YE  
Sbjct: 173 RAVTLKIYSEAAAIAESRGIILADTKFEFGLDEDGNLVLADEALTPDSSRYWPADGYE-- 230

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGLK 293
             EG      DK ++RNW+    + +  +     P +P +++  T + Y+ A+E ITG K
Sbjct: 231 --EGKAQPSFDKQYVRNWLTGPKSGWSTDSLSPPPSLPGSVVEATRERYVEAFESITGKK 288

Query: 294 F 294
           F
Sbjct: 289 F 289


>gi|260589211|ref|ZP_05855124.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Blautia
           hansenii DSM 20583]
 gi|260540292|gb|EEX20861.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Blautia
           hansenii DSM 20583]
          Length = 289

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 100/299 (33%), Positives = 168/299 (56%), Gaps = 35/299 (11%)

Query: 15  YYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSN 73
           +  GKVR+ Y + +   +  ATDR+SAFD  +   +  KG VL +++++WF  T DI  N
Sbjct: 7   FKEGKVRQVYDIGE-ELVIYATDRISAFDYILKNTVTNKGVVLTKMSKFWFDFTKDIVPN 65

Query: 74  HTL-----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           H +     D P+         + ++ ++L+M P+E IVRGY+ G+   S   + KNG   
Sbjct: 66  HMISTDVKDMPEFFQQPEFEGHTMLCRKLEMLPVECIVRGYITGSGWES---YQKNGT-- 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTRNQ--WE 175
           +    LP+ + ++ KLP P+ TPTTK+       D+ +S     E + +    R Q   E
Sbjct: 121 VCGIKLPEGLQESDKLPEPIYTPTTKAE--IGDHDEHVSFEDTVETLEKLYPGRGQEYAE 178

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            I  Y ++L+++  + AL   +I+ D+K+EFG+D+  +++L DE+ TPDSSR+W +E Y 
Sbjct: 179 KIRDYTIALYKKCAEYALTKNIIIADTKFEFGLDENGDVVLGDEMLTPDSSRFWPLEGY- 237

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
              + G      DK ++R+W+  + NP  D +  +PE +I +T + Y+ AYE ++G KF
Sbjct: 238 ---KPGQGQPSFDKQYVRDWL--KANPESDFL--LPEEVIDKTVEKYVEAYELLSGEKF 289


>gi|325680639|ref|ZP_08160180.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Ruminococcus albus 8]
 gi|324107669|gb|EGC01944.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Ruminococcus albus 8]
          Length = 287

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 102/296 (34%), Positives = 156/296 (52%), Gaps = 40/296 (13%)

Query: 17  SGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNHT 75
           SGKVRE Y   +G  + + TDR+SAFD  + + IP KG+ LNQI  YWF  T DI  NH 
Sbjct: 6   SGKVREVYETDEGQLVMVTTDRISAFDVILNSTIPNKGKALNQIALYWFDLTKDIIPNHI 65

Query: 76  L-----DYPD----------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN---- 116
           +     D P+             ++ ++L+M P E IVRGY+ G    S+   YK     
Sbjct: 66  VSAELSDMPNLFAYDKENYQGRTILTKKLKMLPYEFIVRGYMFG----SMWAEYKENKTF 121

Query: 117 -GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
            GK    EY+        QKL  P++TP+ K++E   G D+ I+ + +  R  +   +  
Sbjct: 122 CGKPVEGEYV------QAQKLAEPIVTPSVKNNE---GHDENITMDRL--RAEIGAEEAN 170

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            I+   + ++ +  + A + GLI+ D+K+EFG D+   + L DE+ TPDSSR+W  E Y 
Sbjct: 171 RIADICVKIYNKCYEDAKKKGLIIADTKFEFGYDENGVLTLGDEVMTPDSSRFWAAEDY- 229

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
              + G++P   DK F+R+W++          P++P  I+ +T+  Y   Y KITG
Sbjct: 230 ---KTGVSPRSYDKQFVRDWLIENKLNGVTPAPELPAEIVEKTAALYKECYTKITG 282


>gi|251792206|ref|YP_003006926.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Aggregatibacter aphrophilus NJ8700]
 gi|247533593|gb|ACS96839.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Aggregatibacter aphrophilus NJ8700]
          Length = 286

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L +I+ +WF+  + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTKISNFWFNKLAHI 65

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH               D      +V ++L    IE IVRGYL G   + L  + + G
Sbjct: 66  MPNHFTGDSVYDVLPKAEADLVKDRAVVCKRLTPIKIESIVRGYLTG---SGLKDYKQTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP  + +  KLP P+ TP++K  E     D  IS  E     ++ ++    +
Sbjct: 123 T--ICGLELPKGLVEASKLPEPIFTPSSK--EEIGNHDINISYAEC--EKLIGKDLAAQV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+    K AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY+  
Sbjct: 177 KEKAIALYTEAAKYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVKTYQ-- 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EG  P   DK FIR+W+       +   P +P N+I +T   Y  A + +T
Sbjct: 235 --EGTNPPSFDKQFIRDWLENSGWNKQPPAPKVPANVIQKTVDKYQEALDLLT 285


>gi|331082625|ref|ZP_08331748.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330400244|gb|EGG79886.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 289

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 100/299 (33%), Positives = 168/299 (56%), Gaps = 35/299 (11%)

Query: 15  YYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSN 73
           +  GKVR+ Y + +   +  ATDR+SAFD  +   +  KG VL +++++WF  T DI  N
Sbjct: 7   FKEGKVRQVYDIGE-ELVIYATDRISAFDYILKNTVTNKGVVLTKMSKFWFDFTKDIVPN 65

Query: 74  HTL-----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
           H +     D P+         + ++ ++L+M P+E IVRGY+ G+   S   + KNG   
Sbjct: 66  HMISTDVKDMPEFFQQPEFEGHTMLCRKLEMLPVECIVRGYITGSGWES---YQKNGT-- 120

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTRNQ--WE 175
           +    LP+ + ++ KLP P+ TPTTK+       D+ +S     E + +    R Q   E
Sbjct: 121 VCGIKLPEGLQESDKLPEPIYTPTTKAE--IGDHDEHVSFEDTVETLEKLYPGRGQEYAE 178

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            I  Y ++L+++  + AL   +I+ D+K+EFG+D+  +++L DE+ TPDSSR+W +E Y 
Sbjct: 179 KIRDYTIALYKKCAEYALTKNIIIADTKFEFGLDENGDVVLGDEMLTPDSSRFWPLEGY- 237

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
              + G      DK ++R+W+  + NP  D +  +PE +I +T + Y+ AYE ++G KF
Sbjct: 238 ---KPGQGQPSFDKQYVRDWL--KANPESDFL--LPEEVINKTVEKYVEAYELLSGEKF 289


>gi|332288624|ref|YP_004419476.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gallibacterium anatis UMN179]
 gi|330431520|gb|AEC16579.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gallibacterium anatis UMN179]
          Length = 286

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 104/293 (35%), Positives = 154/293 (52%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAHI 65

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYL G   + L  + K G
Sbjct: 66  MPNHFTGDTVYDVLPEAEAKAIEKRAVVCKRLTPIKIESIVRGYLTG---SGLKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP  + +  KLP P+ TP++K  E     D  IS  E     ++ ++    +
Sbjct: 123 S--ICGLALPKGLVEASKLPEPIFTPSSK--EEIGNHDINISYAEC--EKLIGKDLAAQV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V++Y+  
Sbjct: 177 KEKAIALYTTAAQYALTKGIIICDTKFEFGLDENGVLTLMDEVLTPDSSRFWSVDSYQ-- 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EGI P   DK FIRNW+       +   P +P+ II +T   Y  A++ +T
Sbjct: 235 --EGINPPSFDKQFIRNWLENSGWNKQPPAPKVPQEIIDQTVAKYQEAFDLLT 285


>gi|120406086|ref|YP_955915.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium vanbaalenii PYR-1]
 gi|166230827|sp|A1TFF9|PUR7_MYCVP RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|119958904|gb|ABM15909.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium vanbaalenii PYR-1]
          Length = 301

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 106/305 (34%), Positives = 159/305 (52%), Gaps = 34/305 (11%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           P L +Y    SGKVRE Y +  G  + +ATDR+SA+D  +   IP KG VL  ++ ++F 
Sbjct: 3   PALTDYQHLASGKVRELYRIDGGHLLFVATDRISAYDHILKSEIPDKGRVLTAMSVFFFD 62

Query: 66  HTSDIC--SNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + S     SNH    PD            LV +QL+M P+E + RGYL G   + L+ + 
Sbjct: 63  YLSRTAAVSNHLAGPPDDERIPEEVLGRALVVEQLEMLPVEAVARGYLTG---SGLIDYQ 119

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           + G   +    LP  + +  +   P+ TP TK+       D  IS ++++  G++   + 
Sbjct: 120 QTGT--VCGIALPSGLVEASRFDEPLFTPATKAELGEH--DVNISFDDVV--GLIGAERA 173

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
           E +    L  + +G   AL  G+I+ D+K+EFG+D +  + LADE+ TPDSSRYW  + Y
Sbjct: 174 EELRDRTLRTYSQGAAHALTRGIIVADTKFEFGVDARGELKLADEVFTPDSSRYWRADDY 233

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPD-----IPENIILRTSQTYIAAYEKI 289
                EG      DK F+RNW LT  +   D   D     +P +I+  T   YI AYE+I
Sbjct: 234 A----EGQVQNSFDKQFVRNW-LTGPDSGWDRHGDQPPPPLPPDIVDATRARYIEAYERI 288

Query: 290 TGLKF 294
           +GL+F
Sbjct: 289 SGLRF 293


>gi|227834009|ref|YP_002835716.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Corynebacterium aurimucosum ATCC 700975]
 gi|227455025|gb|ACP33778.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Corynebacterium aurimucosum ATCC 700975]
          Length = 288

 Score =  158 bits (400), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 160/298 (53%), Gaps = 28/298 (9%)

Query: 10  PELPNYY---SGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFH 65
           PEL +Y    SGKVR+ Y + D T + + +DR+SA+D  +   IP KG VL   ++++F 
Sbjct: 6   PELSSYAHIASGKVRDIYEIDDSTLLMVVSDRISAYDHALEPAIPDKGRVLTATSKFFFD 65

Query: 66  HTSDICSNHTLDYPD----PNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
               +  NH     D    P  ++G     Q+L M P E + RGYL G   + L  +  +
Sbjct: 66  VI--VFPNHLAGPLDDERIPEEVLGRAMVVQKLDMLPFECVARGYLTG---SGLKEYQAS 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G     E  LP+ +++  +LP P+ TP TK+ +     D+ +S + ++ +  L R + E 
Sbjct: 121 GSVCGVE--LPEGLTEASRLPEPIFTPATKAEQGDH--DENVSFDVVVDK--LGRERAEE 174

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L ++     LA E G+IL D+K+EFG+DK   ++LADE+ TPDSSRYW  +TYE 
Sbjct: 175 LREATLRIYAEAAALAEEKGIILADTKFEFGVDKHGTLVLADEVLTPDSSRYWPADTYE- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
              EG      DK ++R+W+           P +P++++  T   Y+ A+E+++G  F
Sbjct: 234 ---EGKVQPSFDKQYVRDWLTNSGWDKESTPPRLPDDVVQATRARYVEAFERLSGTTF 288


>gi|167835599|ref|ZP_02462482.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia thailandensis MSMB43]
          Length = 296

 Score =  158 bits (400), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 152/305 (49%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVL----VGQ---------QLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH        V+    VGQ         +L+   +E +VRGYLAG  
Sbjct: 61  ANFWFDKLAHIVPNHLTGVAPETVVAADEVGQVKGRAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   GK  +    LP  +S+ QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 119 -SGWKDYQATGK--VCGVELPAGLSNAQKLPEPIFTPAAKAEMGHH--DENISFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELAATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDEHGKLFLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    R G  P   DK F+R+W+  +        P +P++++ +TS  Y  A 
Sbjct: 232 RFWPADEY----RVGTNPPSFDKQFVRDWLEAQNWSKEPPAPKLPDDVVAKTSAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|297539566|ref|YP_003675335.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylotenera sp. 301]
 gi|297258913|gb|ADI30758.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylotenera sp. 301]
          Length = 300

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 96/305 (31%), Positives = 160/305 (52%), Gaps = 30/305 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
           I  L   + GKVR+ Y +   T + ++TDRLSAFD  +   I  KG +L Q+  +WF   
Sbjct: 10  IQSLKRIHQGKVRDIYDIDADTMLLVSTDRLSAFDVILPTGIANKGAMLTQMANFWFEKL 69

Query: 68  SDICSNHTLDYPDPNVLVG---------------QQLQMFPIELIVRGYLAGNTKTSLLT 112
            ++  NH L   DP  +V                ++L+  PIE IVRGYL G+       
Sbjct: 70  KNVVPNH-LTGIDPKSVVSNVAEQAQLGSRAVVVKKLKALPIEAIVRGYLVGSGWKE--- 125

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRN 172
            YK  K  +    LP  + +  KLP P+ TP++K++      D+ IS  +     ++ ++
Sbjct: 126 -YK-AKGTVCGIELPAGLQEASKLPTPIFTPSSKAAVGEH--DENISLQQCAD--LIGKD 179

Query: 173 QWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVE 232
             E ++  A++L+++  + AL  G+I+ D+K+EFG+D    + + DE+ TPDSSR+W  +
Sbjct: 180 MAEQVAKVAIALYQQAAEYALTRGIIIADTKFEFGLDANGVLHVMDEVLTPDSSRFWPAD 239

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGL 292
           +Y      G  P   DK F+R+W+ +         P +P ++  +TS+ Y+ A+E++TG 
Sbjct: 240 SYAV----GSNPPSYDKQFVRDWLESTGWNKVAPAPALPADVAQKTSEKYMEAFERLTGH 295

Query: 293 KFIAD 297
             +AD
Sbjct: 296 PLVAD 300


>gi|255325898|ref|ZP_05366990.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium tuberculostearicum SK141]
 gi|255297110|gb|EET76435.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium tuberculostearicum SK141]
          Length = 300

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 97/306 (31%), Positives = 161/306 (52%), Gaps = 32/306 (10%)

Query: 6   KAYIPELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
           K   PEL +Y    SGKVR+ Y + + T + + +DR+SA+D  +   IP KG VL   ++
Sbjct: 2   KVMRPELSSYTHLASGKVRDIYDVDENTLLMVVSDRISAYDHALEPAIPDKGRVLTATSK 61

Query: 62  YWFHHTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLT 112
           ++F        NH     D            +V ++L M P E + RG+L G   + L  
Sbjct: 62  FFFDSID--FPNHLAGPLDDERIPAECLGRAMVVKKLDMLPFECVARGFLTG---SGLKE 116

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRN 172
           +  NG     E  LP+ + +  +LP P+ TP TK+ +     D+ +S + ++ +  L  +
Sbjct: 117 YKANGTVCGIE--LPEGLVEASRLPEPIFTPATKAEQGEH--DENVSFDVVVDK--LGAD 170

Query: 173 QWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVE 232
           + E + +  L ++     LA E G+IL D+K+EFG+DK   ++LADE+ TPDSSRYW  +
Sbjct: 171 RAEELRAATLRIYSEAATLAEEKGIILADTKFEFGLDKDGTLVLADEVLTPDSSRYWPAD 230

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEK 288
           +Y     EG      DK ++RNW+ +  + +        P +P++++  T   YI AYE+
Sbjct: 231 SY----VEGEVQPSFDKQYVRNWLTSDASGWDQAADGTPPQLPDDVVSATRLRYIEAYER 286

Query: 289 ITGLKF 294
           ++G +F
Sbjct: 287 LSGERF 292


>gi|262183504|ref|ZP_06042925.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium aurimucosum ATCC 700975]
          Length = 285

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 98/298 (32%), Positives = 160/298 (53%), Gaps = 28/298 (9%)

Query: 10  PELPNYY---SGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFH 65
           PEL +Y    SGKVR+ Y + D T + + +DR+SA+D  +   IP KG VL   ++++F 
Sbjct: 3   PELSSYAHIASGKVRDIYEIDDSTLLMVVSDRISAYDHALEPAIPDKGRVLTATSKFFFD 62

Query: 66  HTSDICSNHTLDYPD----PNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
               +  NH     D    P  ++G     Q+L M P E + RGYL G   + L  +  +
Sbjct: 63  VI--VFPNHLAGPLDDERIPEEVLGRAMVVQKLDMLPFECVARGYLTG---SGLKEYQAS 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP+ +++  +LP P+ TP TK+ +     D+ +S + ++ +  L R + E 
Sbjct: 118 GS--VCGVELPEGLTEASRLPEPIFTPATKAEQGDH--DENVSFDVVVDK--LGRERAEE 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L ++     LA E G+IL D+K+EFG+DK   ++LADE+ TPDSSRYW  +TYE 
Sbjct: 172 LREATLRIYAEAAALAEEKGIILADTKFEFGVDKHGTLVLADEVLTPDSSRYWPADTYE- 230

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
              EG      DK ++R+W+           P +P++++  T   Y+ A+E+++G  F
Sbjct: 231 ---EGKVQPSFDKQYVRDWLTNSGWDKESTPPRLPDDVVQATRARYVEAFERLSGTTF 285


>gi|325107818|ref|YP_004268886.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Planctomyces brasiliensis DSM 5305]
 gi|324968086|gb|ADY58864.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Planctomyces brasiliensis DSM 5305]
          Length = 302

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 106/318 (33%), Positives = 172/318 (54%), Gaps = 41/318 (12%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ I  LP   SGKVR+ Y L D   I +ATDR+SAFD  +   IP KG +L Q+
Sbjct: 1   MSTLLQSEIAGLPKR-SGKVRDVYDLGDSLLI-VATDRISAFDWILPNGIPEKGRILTQL 58

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVL----------------VGQQLQMFPIELIVRGYLA 103
           + +WF        NH +   DP++L                + ++ ++ PIE +VRGYLA
Sbjct: 59  SLHWFKLLG--VENHLIST-DPSLLPLPPGTDVDALQGRSMIVRKSEVIPIECVVRGYLA 115

Query: 104 GNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEI 163
           G   +  + + KN  R +    LP  + +++KLP P+ TP+TK+ E   G D PIS   +
Sbjct: 116 G---SGWVDYQKN--RTVSGVELPAGLQESEKLPEPIFTPSTKAEE---GHDMPISLEAV 167

Query: 164 IHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGI-----DKKQNIILAD 218
             +  +  +  E +   +++++++    A E+GLIL D+K+EFG      +++  IIL D
Sbjct: 168 SEQ--IGGDVAEDLKQRSIAIYQKAADYAREHGLILADTKFEFGFWKATPEEQPRIILID 225

Query: 219 EIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRT 278
           E+ TPDSSRYW  + YE     G +    DK ++R+W+L          P +P++++  T
Sbjct: 226 EVLTPDSSRYWPADDYEV----GRSQNSFDKQYVRDWLLQTDWDRNSPPPQLPDDVVANT 281

Query: 279 SQTYIAAYEKITGLKFIA 296
           +  Y  AY+ +TG +F++
Sbjct: 282 AAKYREAYQLLTGREFVS 299


>gi|167768589|ref|ZP_02440642.1| hypothetical protein CLOSS21_03148 [Clostridium sp. SS2/1]
 gi|317497927|ref|ZP_07956236.1| saicar synthetase [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167710113|gb|EDS20692.1| hypothetical protein CLOSS21_03148 [Clostridium sp. SS2/1]
 gi|291560544|emb|CBL39344.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [butyrate-producing bacterium SSC/2]
 gi|316894806|gb|EFV16979.1| saicar synthetase [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 288

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 165/302 (54%), Gaps = 36/302 (11%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + E+     GKVRE Y   D + I +ATDR+S FD  +   +  KG VL Q++++WF  T
Sbjct: 1   MKEMKPIKEGKVREIYDNGD-SLIMVATDRISCFDVILKNDVTKKGTVLTQMSKFWFDLT 59

Query: 68  SDICSNHTL-----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
            DI  NH +     D P        D N ++ ++L M PIE IVRGY+ G   +   ++ 
Sbjct: 60  KDIVPNHMISVDVKDMPEFFQQEKYDGNSMMCKKLTMLPIECIVRGYITG---SGWASYQ 116

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTR 171
           +NG   +    LP+ + ++ KLP P+ TP+TK+       D+ IS     E++ +    +
Sbjct: 117 ENGT--VCGIKLPEGLKESDKLPEPIYTPSTKAE--IGDHDENISFERSIEVLEKEFPGK 172

Query: 172 NQ--WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
            Q   E +    ++L+++    ALE+G+I+ D+K+EFG+D+  NI++ DE+ TPDSSR+W
Sbjct: 173 GQEYAEQLRDKTIALYKKCADYALEHGIIIADTKFEFGLDENGNIVIGDEMLTPDSSRFW 232

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKI 289
             + YE     G      DK F R+W+ +  + ++     +P++I+ +T   Y  AYE +
Sbjct: 233 PADEYEP----GHGQPSFDKQFARDWLKSNEHDWK-----LPQDIVDKTIDKYFQAYEML 283

Query: 290 TG 291
           TG
Sbjct: 284 TG 285


>gi|294054680|ref|YP_003548338.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Coraliomargarita akajimensis DSM 45221]
 gi|293614013|gb|ADE54168.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Coraliomargarita akajimensis DSM 45221]
          Length = 305

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 160/294 (54%), Gaps = 30/294 (10%)

Query: 13  PNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDIC 71
           P   SGKVRE + + D   + +ATDR+SAFD  +   +P KG +L QI+ YWF   S + 
Sbjct: 24  PLVASGKVREIFDMGDAL-LMVATDRVSAFDVIMNEGLPGKGALLTQISLYWFERASSLV 82

Query: 72  SNHTLD------------YPD--PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
            +H +D            +P+     ++ ++L+  PIE +VRGYL+G+   +    Y++ 
Sbjct: 83  QHHLVDNHAERIADLAKDFPELEHRSMIVKKLKPLPIEAVVRGYLSGSGWKA----YQS- 137

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
           + K++EY LP+ + ++ +LP  V TPTTK+   ASG D PI   E     ++  + ++ +
Sbjct: 138 EGKLFEYRLPEGLQESSQLPKAVFTPTTKA---ASGHDMPIDCAEAAE--LIGADLFKQV 192

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              +L L+E G   A + G+IL D+K+EFG D+   + L DE+ TPDSSRYW  E+Y   
Sbjct: 193 HDLSLELYEMGVARANQAGIILADTKFEFGTDESGALYLIDEVLTPDSSRYWPKESYAPG 252

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
              G  P   DK F+R+++ +         P + E ++  T   Y+ A+  I G
Sbjct: 253 ---GAQP-SFDKQFVRDYLESLDWDKSPPPPALSEAVLKGTLDRYVEAFLTIVG 302


>gi|38234494|ref|NP_940261.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium diphtheriae NCTC 13129]
 gi|81829865|sp|Q6NFG4|PUR7_CORDI RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|38200757|emb|CAE50461.1| Putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium diphtheriae]
          Length = 297

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 162/301 (53%), Gaps = 30/301 (9%)

Query: 10  PELPNYY---SGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           PEL  Y    +GKVRE Y + D   + + +DR+SA+D  +   IP KG VL  ++ Y+FH
Sbjct: 3   PELSQYTHVSAGKVREIYEVDDERLLMVVSDRISAYDHILEPEIPDKGRVLTAMSMYFFH 62

Query: 66  HTSDICSNHTLDYPDPNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
           +  D  ++      DP +        +V ++L+M P E + RGYL G   + L  + + G
Sbjct: 63  NI-DFPNHLAGPIDDPAIPEEVLGRAMVCKKLKMLPFECVARGYLTG---SGLKEYQETG 118

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
                E  LP+ + +  KLP P+ TP TK+       D+ +S + ++ +  L   +   +
Sbjct: 119 TVCGVE--LPEGLVEASKLPEPIFTPATKAE--LGDHDENVSFDVVVEK--LGEARANEL 172

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L ++     LA E G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW  + YE  
Sbjct: 173 RDATLRIYSEAAALAEERGIILADTKFEFGLDEDGRLVLADEVLTPDSSRYWPADGYE-- 230

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYR-DNI---PDIPENIILRTSQTYIAAYEKITGLK 293
             EG      DK ++RNW+    + +  D++   P +P +++  T + Y+ A+E+ITG K
Sbjct: 231 --EGKVQPSFDKQYVRNWLTGPKSGWSTDDVTPPPSLPGSVVEATRERYVEAFERITGKK 288

Query: 294 F 294
           F
Sbjct: 289 F 289


>gi|166030782|ref|ZP_02233611.1| hypothetical protein DORFOR_00456 [Dorea formicigenerans ATCC
           27755]
 gi|166029364|gb|EDR48121.1| hypothetical protein DORFOR_00456 [Dorea formicigenerans ATCC
           27755]
          Length = 287

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 162/296 (54%), Gaps = 35/296 (11%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRE Y   D + I +ATDR+S FD  +   +  KG VL Q++++WF+ T DI  NH +
Sbjct: 7   GKVREIYDNGD-SLIMVATDRISCFDVILNNVVTKKGTVLTQMSKFWFNLTKDIIPNHMI 65

Query: 77  -----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
                D P        D N ++ ++L+M PIE IVRGY+ G   +   ++ +NG   +  
Sbjct: 66  STNVKDMPEFFQKPEFDGNSMMCRKLEMLPIECIVRGYITG---SGWASYKENGT--VCG 120

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS-PNEIIHRGILTRNQWE----TIS 178
             LP+ + ++ KLP P+ TP+TK+       D+ IS    I H       + E     + 
Sbjct: 121 ITLPEGLKESDKLPEPIYTPSTKAE--IGDHDENISYEQSIAHLEKYFPGKGEEYAKKLR 178

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y ++L+++    AL  G+I+ D+K+EFG+D+  N++L DE+ TPDSSR+W  + YE   
Sbjct: 179 DYTIALYKKCADYALTRGIIIADTKFEFGLDENGNMVLGDEMLTPDSSRFWPADGYEP-- 236

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
             G      DK F R+W+  + NP  DN   +P+ I+ +T   Y+ +YE +TG K 
Sbjct: 237 --GHGQPSFDKQFARDWL--KANP--DNDWTLPDEIVEKTIDKYLQSYEMLTGEKL 286


>gi|308178294|ref|YP_003917700.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Arthrobacter arilaitensis Re117]
 gi|307745757|emb|CBT76729.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Arthrobacter arilaitensis Re117]
          Length = 301

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 160/300 (53%), Gaps = 31/300 (10%)

Query: 14  NYYSGKVRENYF-----LSDGTRI-TIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHH 66
           ++YSGKVR+ Y        D  R+  +A+DR+SA+D  ++  IP KG+VL Q++ +WF  
Sbjct: 16  HFYSGKVRDLYVPAGVAFDDTDRVLVVASDRISAYDFVLSSEIPDKGKVLTQLSLWWFEQ 75

Query: 67  TSDICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
             D  +NH +    P  + G     ++L M+PIE I RGYL G    S L  Y N  + +
Sbjct: 76  LGDF-ANHVISTEVPAAVAGRAMVCKKLDMYPIECIARGYLTG----SGLAEY-NVSQTV 129

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
            E  LP+ + D  +L   + TP+ K+       D+ IS  + + R  +     E +    
Sbjct: 130 CELPLPEGLVDGSRLSPALFTPSAKAE--VGEHDENISFAQTVER--VGTEVSEALREKT 185

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWEVETYEKSFRE 240
           ++L+E+  K+A   G+IL D+K EFG D     I L DE+ TPDSSR+W+ ++Y    + 
Sbjct: 186 VALYEQAEKIARTRGIILADTKVEFGADPATGEITLGDEVLTPDSSRFWDAQSY----KP 241

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGLKFIA 296
           G +    DK F+R+W+ +  + +  N     P +P  II +T   YI A+E++TG  F A
Sbjct: 242 GQSQASFDKQFVRDWLTSAESGWDKNSGEEPPQLPAEIIEKTRARYIEAFERLTGSAFTA 301


>gi|1144522|gb|AAB41456.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Mycobacterium tuberculosis H37Rv]
          Length = 297

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 106/303 (34%), Positives = 160/303 (52%), Gaps = 34/303 (11%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           P L +Y    SGKVRE Y + D   + +A+DR+SA+D  + + IP KG VL  ++ ++F 
Sbjct: 3   PALSDYQHVASGKVREIYRVDDEHLLLVASDRISAYDYVLDSTIPDKGRVLTAMSAFFFG 62

Query: 66  HTSDICSNHTLDYPD-PNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH    PD P +        LV ++L+M P+E + RGYL G   + LL +   
Sbjct: 63  LVD--APNHLAGPPDDPRIPDEVLGRALVVRRLEMLPVECVARGYLTG---SGLLDYQAT 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWE 175
           GK  +    LP  + +  +   P+ TP TK++      D+ IS + ++   G L  NQ  
Sbjct: 118 GK--VCGIRLPPGLVEASRFATPLFTPATKAA--LGDHDENISFDRVVEMVGPLRANQ-- 171

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L  + +    AL  G+I+ D+K+EFGID+  N++LADEI TPDSSRYW  + Y 
Sbjct: 172 -LRDRTLQTYVQAADHALTRGIIIADTKFEFGIDRHGNLLLADEIFTPDSSRYWPADDY- 229

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITG 291
              R G+     DK F+R+W+    + +        P +PE+I+  T   YI AYE+I+ 
Sbjct: 230 ---RAGVVQTSFDKQFVRSWLTGSESGWDRGSDRPPPPLPEHIVEATRARYINAYERISE 286

Query: 292 LKF 294
           LKF
Sbjct: 287 LKF 289


>gi|34495620|ref|NP_899835.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chromobacterium violaceum ATCC 12472]
 gi|39931753|sp|Q7P1P8|PUR7_CHRVO RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|34101475|gb|AAQ57844.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Chromobacterium violaceum ATCC 12472]
          Length = 284

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 154/294 (52%), Gaps = 27/294 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + IATDRLSAFD  +   IP KG++L  I+ +WF    D+
Sbjct: 4   LKKIYSGKVRDLYEIDDQRMLMIATDRLSAFDVILDDPIPAKGQILTAISNFWFDKLKDV 63

Query: 71  CSNH-TLDYPD--------PNV----LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH T D P+        P V    +V ++L+  PIE +VRGYLAG   +    + ++G
Sbjct: 64  VPNHLTGDQPEDVVAAADLPQVEGRAVVAKRLKAVPIEAVVRGYLAG---SGWKEYRQSG 120

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP  + +  KLP P+ TP+TK++      D+ IS  +     I+       +
Sbjct: 121 S--VCGIALPAGLKEADKLPEPIFTPSTKAA--VGDHDENISFAQC--EAIVGAELAAKV 174

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L++   + A   G+I+ D+K+EFG+D+   + L DE  TPDSSR+W  ++Y+  
Sbjct: 175 RDTAILLYQTAAEYAATRGIIICDTKFEFGLDENGTLTLMDEALTPDSSRFWPADSYQP- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
              G  P   DK F+R+W+       +   P +P ++  +T+  Y  A EK+ G
Sbjct: 234 ---GSNPPSFDKQFVRDWLEASGWNKQAPAPAVPLDVREKTAAKYREALEKLAG 284


>gi|134279733|ref|ZP_01766445.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 305]
 gi|167718304|ref|ZP_02401540.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei DM98]
 gi|217419506|ref|ZP_03451012.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 576]
 gi|134248933|gb|EBA49015.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 305]
 gi|217396810|gb|EEC36826.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 576]
          Length = 296

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 149/305 (48%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY L +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYALGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFP-------------IELIVRGYLAGNT 106
             +WF   + I  NH        V+   +++                +E +VRGYLAG  
Sbjct: 61  ANFWFDRLAHIVPNHLTGVAPETVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   GK  +    LP  +S+ QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 119 -SGWKDYQATGK--VCGVELPAGLSNAQKLPEPIFTPAAKAE--MGHHDENISFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDEHGELFLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    R G  P   DK F+R+W+  +        P +P++++ +TS  Y  A 
Sbjct: 232 RFWPADEY----RVGTNPPSFDKQFVRDWLEAQNWNKEPPAPKLPDDVVAKTSAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|225026762|ref|ZP_03715954.1| hypothetical protein EUBHAL_01014 [Eubacterium hallii DSM 3353]
 gi|224955881|gb|EEG37090.1| hypothetical protein EUBHAL_01014 [Eubacterium hallii DSM 3353]
          Length = 294

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/298 (33%), Positives = 169/298 (56%), Gaps = 35/298 (11%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRE Y   D + I  ATDR+SAFD  +   +  KG +L Q++++WF+ T +   NH +
Sbjct: 13  GKVREVYDNGD-SLIIAATDRISAFDVILKNEVKDKGAILTQMSKFWFNLTENTVPNHMI 71

Query: 77  -----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
                D P+           ++ ++L+MFP+E IVRGY+ G   +   ++ +NG   +  
Sbjct: 72  STDVKDMPEFFQNEKYAGRSMMCKKLEMFPVECIVRGYITG---SGWASYQENGT--VCG 126

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTRNQW--ETIS 178
             LP+ + +++KLP P+ TP+TK+       D+ +S +   EI+ +    +  +    + 
Sbjct: 127 IKLPEGLQESEKLPEPIYTPSTKAD--LGDHDENVSYDKTVEILEKLYPGKGNYYANILK 184

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y +SL+++  + A E G+I+ D+K+EFG+D++  +++ DE+ TPDSSR+W  E YE   
Sbjct: 185 EYTISLYKKCAEYAWEKGIIIADTKFEFGLDEQGRVVIGDEMLTPDSSRFWPREGYEA-- 242

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
             G      DK F+R+W+  + NP  D+  D+PE +I +T   Y  AYE++TG  F A
Sbjct: 243 --GKGQPSYDKQFVRDWL--KQNP--DSDYDLPEEVIDKTVAKYKEAYEQLTGEPFEA 294


>gi|218133949|ref|ZP_03462753.1| hypothetical protein BACPEC_01838 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991324|gb|EEC57330.1| hypothetical protein BACPEC_01838 [Bacteroides pectinophilus ATCC
           43243]
          Length = 292

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 98/298 (32%), Positives = 169/298 (56%), Gaps = 35/298 (11%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNH 74
           Y GKVRE Y   D   + +ATDR+SAFD  +   +  KG +L Q++++WF +T D+ +NH
Sbjct: 8   YEGKVREVYDCED-KLVMVATDRISAFDHILKNKVTDKGAILTQMSRFWFDYTKDVVANH 66

Query: 75  TL-----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
            +     D P+           ++ ++L M PIE IVRGY+ G   +   ++ +NG   +
Sbjct: 67  MVSVDVNDMPEFFHKDEYIGRSMLCKKLTMLPIECIVRGYITG---SGWASYKENGT--V 121

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTRN-QWET- 176
               LP+ + +++KLP P+ TP+TK+       D+ IS     E++ +    +  ++ T 
Sbjct: 122 CGIKLPEGLKESEKLPEPIYTPSTKAE--IGDHDENISFEKSIEVLEKKFPGKGLEYATK 179

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           I    ++L+++  + AL  G+I+ D+K+EFG+D+   +++ DE+ TPDSSR+W +E YE 
Sbjct: 180 IKDATITLYKKCAEYALSKGIIIADTKFEFGLDENGEVVIGDEMLTPDSSRFWPLEGYEP 239

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
               G      DK F+R+W+  + NP  D +  +P+++I +T + Y  AY+ +TG  F
Sbjct: 240 ----GKGQPSYDKQFVRDWL--KANPDSDYL--LPDDVIDKTVEKYKEAYKLLTGKDF 289


>gi|83721421|ref|YP_441222.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia thailandensis E264]
 gi|167579979|ref|ZP_02372853.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia thailandensis TXDOH]
 gi|167618049|ref|ZP_02386680.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia thailandensis Bt4]
 gi|257140112|ref|ZP_05588374.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia thailandensis E264]
 gi|83655246|gb|ABC39309.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia thailandensis E264]
          Length = 296

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/305 (32%), Positives = 149/305 (48%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFP-------------IELIVRGYLAGNT 106
             +WF   + I  NH        V+   +++                +E +VRGYLAG  
Sbjct: 61  ANFWFDKLAHIVPNHLTGVAPETVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   GK  +    LP  +S+ QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 119 -SGWKDYQATGK--VCGVELPAGLSNAQKLPEPIFTPAAKAE--MGHHDENISFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELAATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDEHGKLFLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    R G  P   DK F+R+W+  +        P +P++++ +TS  Y  A 
Sbjct: 232 RFWPADEY----RVGTNPPSFDKQFVRDWLEAQNWSKEPPAPKLPDDVVAKTSAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|260913668|ref|ZP_05920144.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Pasteurella dagmatis ATCC 43325]
 gi|260632207|gb|EEX50382.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Pasteurella dagmatis ATCC 43325]
          Length = 286

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF+  + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAHI 65

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH               D      +V ++L    IE IVRGYL G   + L  + K G
Sbjct: 66  MPNHFTGDSVYDVLPREEADLVKERSVVCKRLNPIKIESIVRGYLTG---SGLKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP+ + +  KLP P+ TP++K+       D  IS  E     ++       +
Sbjct: 123 T--ICGLSLPEGLVEASKLPEPIFTPSSKAE--VGDHDINISYEEC--EKLIGAELAAQV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L++   + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY+  
Sbjct: 177 KEKAITLYKVAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQ-- 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EGI P   DK FIR+W+           P +P  +I +T   Y  A + +T
Sbjct: 235 --EGINPPSFDKQFIRDWLQNSGWNKEPPAPKVPAEVIQKTVDKYQEALDLLT 285


>gi|254296308|ref|ZP_04963765.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 406e]
 gi|157805679|gb|EDO82849.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 406e]
          Length = 296

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 149/305 (48%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY L +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYALGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFP-------------IELIVRGYLAGNT 106
             +WF   + I  NH        V+   +++                +E +VRGYLAG  
Sbjct: 61  ANFWFDRLAHIVPNHLTGVAPETVVAADEVEQVKERAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   GK  +    LP  +S+ QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 119 -SGWKDYQATGK--VCGVELPAGLSNAQKLPEPIFTPAAKAE--MGHHDENISFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDEHGELFLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    R G  P   DK F+R+W+  +        P +P++++ +TS  Y  A 
Sbjct: 232 RFWPADEY----RVGTNPPSFDKQFVRDWLEAQNWNKAPPAPKLPDDVVAKTSAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|53718438|ref|YP_107424.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei K96243]
 gi|53725039|ref|YP_102125.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei ATCC 23344]
 gi|67641172|ref|ZP_00439956.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia mallei GB8 horse 4]
 gi|76809072|ref|YP_332411.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 1710b]
 gi|121601218|ref|YP_991942.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei SAVP1]
 gi|124385389|ref|YP_001028388.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei NCTC 10229]
 gi|126440287|ref|YP_001057888.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 668]
 gi|126448933|ref|YP_001079621.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei NCTC 10247]
 gi|126455088|ref|YP_001065123.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 1106a]
 gi|167002690|ref|ZP_02268480.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia mallei PRL-20]
 gi|167737352|ref|ZP_02410126.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 14]
 gi|167814475|ref|ZP_02446155.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 91]
 gi|167822940|ref|ZP_02454411.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 9]
 gi|167844508|ref|ZP_02470016.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei B7210]
 gi|167893035|ref|ZP_02480437.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 7894]
 gi|167901495|ref|ZP_02488700.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei NCTC 13177]
 gi|167909741|ref|ZP_02496832.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 112]
 gi|167917763|ref|ZP_02504854.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei BCC215]
 gi|226199426|ref|ZP_03794984.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei Pakistan 9]
 gi|237811037|ref|YP_002895488.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei MSHR346]
 gi|242315411|ref|ZP_04814427.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 1106b]
 gi|254176803|ref|ZP_04883460.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei ATCC 10399]
 gi|254181612|ref|ZP_04888209.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 1655]
 gi|254187570|ref|ZP_04894082.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254196707|ref|ZP_04903131.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei S13]
 gi|254203805|ref|ZP_04910165.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei FMH]
 gi|254208783|ref|ZP_04915131.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei JHU]
 gi|254260906|ref|ZP_04951960.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 1710a]
 gi|254360164|ref|ZP_04976434.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei 2002721280]
 gi|52208852|emb|CAH34791.1| 5'-phosphoribosyl-4-N-succinocarboxamide-5-amino imidazole
           synthetase [Burkholderia pseudomallei K96243]
 gi|52428462|gb|AAU49055.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei ATCC 23344]
 gi|76578525|gb|ABA48000.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 1710b]
 gi|121230028|gb|ABM52546.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei SAVP1]
 gi|124293409|gb|ABN02678.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia mallei NCTC 10229]
 gi|126219780|gb|ABN83286.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 668]
 gi|126228730|gb|ABN92270.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 1106a]
 gi|126241803|gb|ABO04896.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia mallei NCTC 10247]
 gi|147745317|gb|EDK52397.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei FMH]
 gi|147750659|gb|EDK57728.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei JHU]
 gi|148029404|gb|EDK87309.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei 2002721280]
 gi|157935250|gb|EDO90920.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei Pasteur 52237]
 gi|160697844|gb|EDP87814.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia mallei ATCC 10399]
 gi|169653450|gb|EDS86143.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei S13]
 gi|184212150|gb|EDU09193.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia pseudomallei 1655]
 gi|225928502|gb|EEH24531.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei Pakistan 9]
 gi|237502859|gb|ACQ95177.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei MSHR346]
 gi|238522045|gb|EEP85492.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia mallei GB8 horse 4]
 gi|242138650|gb|EES25052.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 1106b]
 gi|243061681|gb|EES43867.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia mallei PRL-20]
 gi|254219595|gb|EET08979.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderia pseudomallei 1710a]
          Length = 296

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 149/305 (48%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY L +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYALGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFP-------------IELIVRGYLAGNT 106
             +WF   + I  NH        V+   +++                +E +VRGYLAG  
Sbjct: 61  ANFWFDRLAHIVPNHLTGVAPETVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   GK  +    LP  +S+ QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 119 -SGWKDYQATGK--VCGVELPAGLSNAQKLPEPIFTPAAKAEMGHH--DENISFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDEHGELFLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y    R G  P   DK F+R+W+  +        P +P++++ +TS  Y  A 
Sbjct: 232 RFWPADEY----RVGTNPPSFDKQFVRDWLEAQNWNKAPPAPKLPDDVVAKTSAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|74318686|ref|YP_316426.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Thiobacillus denitrificans ATCC 25259]
 gi|74058181|gb|AAZ98621.1| phosphoribosylaminoimidazole-succinocarboxamide (SAICAR) synthetase
           [Thiobacillus denitrificans ATCC 25259]
          Length = 665

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 97/304 (31%), Positives = 154/304 (50%), Gaps = 31/304 (10%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQY 62
           L +++I  LP  + GKVR+ Y + D   + + TDRLSAFD  +   IP KGEVL +++ +
Sbjct: 374 LFESHIASLPLIHRGKVRDIYAVGDDKLLIVTTDRLSAFDVVMPTPIPGKGEVLTRVSAF 433

Query: 63  WFHHTSDICSNHTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTS 109
           WF     +  N TL             D      +V Q+L+  PIE IVRGYL G+    
Sbjct: 434 WFDKLRAVVPNQTLAIAPEAVVAEDEKDQVAGRAIVVQKLKALPIEAIVRGYLVGSG--- 490

Query: 110 LLTFYKNGKRK--IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
               +K  +R   +    LP  +    +LP P+ TP+TK++  A   D+ I+  ++  R 
Sbjct: 491 ----WKEYQRSQSVCGIALPAGLMQADRLPEPIFTPSTKAALGAH--DENIAFEQMAER- 543

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +       +   +L+L++   + A   G+I+ D+K+EFG+D    ++  DE  TPDSSR
Sbjct: 544 -IGAELAAQVRDVSLALYQAAAEYARTRGIIIADTKFEFGLDAAGQLMWIDEALTPDSSR 602

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + Y    R G  P   DK F+R+W+       +   P +P +I+ RTS+ Y  A  
Sbjct: 603 FWPADQY----RPGSNPPSFDKQFVRDWLEASGWNKQAPGPALPADIVARTSEKYREAMV 658

Query: 288 KITG 291
           ++ G
Sbjct: 659 RLLG 662


>gi|255281495|ref|ZP_05346050.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Bryantella
           formatexigens DSM 14469]
 gi|255267983|gb|EET61188.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Bryantella
           formatexigens DSM 14469]
          Length = 291

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 105/303 (34%), Positives = 163/303 (53%), Gaps = 35/303 (11%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSD 69
           E+     GKVRE Y   D + I +ATDR+S FD  +   +  KG VL Q++++WF+ T D
Sbjct: 5   EMKPIKEGKVREIYDNGD-SLIMVATDRISCFDVILNNTVTKKGTVLTQMSKFWFNMTED 63

Query: 70  ICSNHTL-----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH +     D P        D N ++ ++L+M PIE IVRGY+ G   +   ++ +N
Sbjct: 64  ILPNHMISTDVNDMPEFFRQPRFDGNSMMCKKLEMLPIECIVRGYITG---SGWASYKEN 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS-PNEIIHRGILTRNQWE 175
           G   +    LP+ + ++ KLP P+ TP+TK+       D+ IS    I H       + E
Sbjct: 121 GT--VCGIRLPEGLKESDKLPEPIYTPSTKAE--IGDHDENISFEQSIAHLEKYFPGKGE 176

Query: 176 ----TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEV 231
                +    ++L+++    AL  G+I+ D+K+EFG+D+  N+++ DE+ TPDSSR+W  
Sbjct: 177 EYAVKLRDCTIALYKKCADYALSRGIIIADTKFEFGLDENGNLVIGDEMLTPDSSRFWPA 236

Query: 232 ETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           E YE     G      DK F R+W+  + NP  D    +PE+I+ +T   Y+ AYE +TG
Sbjct: 237 EGYEP----GHGQPSFDKQFARDWL--KANPGNDWT--LPEDIVQKTIDKYLQAYELLTG 288

Query: 292 LKF 294
            K 
Sbjct: 289 EKL 291


>gi|94309449|ref|YP_582659.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cupriavidus metallidurans CH34]
 gi|166230836|sp|Q1LR36|PUR7_RALME RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|93353301|gb|ABF07390.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Cupriavidus metallidurans CH34]
          Length = 302

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/307 (31%), Positives = 156/307 (50%), Gaps = 32/307 (10%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L ++ I  LP    GKVR+NY + D   + + TDRLSAFD  +   IP KG VLNQ+  +
Sbjct: 5   LYESSIQSLPLLGKGKVRDNYAVGDDKLLIVTTDRLSAFDVILGEPIPAKGRVLNQMANF 64

Query: 63  WFHHTSDICSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTS 109
           WF   + I  NH  D    +V+             V ++L+   +E +VRGYLAG   + 
Sbjct: 65  WFKKLAHIVPNHETDVTAESVVAPNEVEQVKGRAVVVKRLKPILVEAVVRGYLAG---SG 121

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
              +   GK  +    LP  + + QKLP P+ TP  K+       D+ IS +E+  R  +
Sbjct: 122 WKDYQATGK--VCGIALPAGLQNAQKLPEPIFTPAAKAEMGEH--DENISFDEVEAR--I 175

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
            +     +   ++ L++     A   G+I+ D+K+EFG+D+   + L DE+ T DSSR+W
Sbjct: 176 GKELAAKMRDISIRLYKEAADYAATRGIIIADTKFEFGLDENGTLTLMDEVLTADSSRFW 235

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWI-LTRCN----PYRDNIPDIPENIILRTSQTYIA 284
             ++Y+     G  P   DK F+R+W+   R +    P     P +PE+++ +T+  Y  
Sbjct: 236 PADSYQV----GTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPKLPEDVVQKTADKYKE 291

Query: 285 AYEKITG 291
           A  ++TG
Sbjct: 292 ALTRLTG 298


>gi|330818177|ref|YP_004361882.1| SAICAR synthetase [Burkholderia gladioli BSR3]
 gi|327370570|gb|AEA61926.1| SAICAR synthetase [Burkholderia gladioli BSR3]
          Length = 296

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 103/305 (33%), Positives = 154/305 (50%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY +     + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGTDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNT 106
             +WF   S I  NH T D P+  V            +V ++L+   +E +VRGYLAG  
Sbjct: 61  ANFWFDKLSHIVPNHLTGDAPESVVAADEVEQVAGRGVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +  +G   +    LP  + + QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 119 -SGWKDYQASGA--VCGVELPAGLQNAQKLPEPIFTPAAKAEMGHH--DENISYEECERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDEHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+ T+        P +P++++ RTS  Y  A 
Sbjct: 232 RFWPADEYQV----GTNPPSFDKQFVRDWLETQDWKKEPPAPKLPDDVVARTSAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|52425536|ref|YP_088673.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mannheimia succiniciproducens MBEL55E]
 gi|81825513|sp|Q65SH2|PUR7_MANSM RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|52307588|gb|AAU38088.1| PurC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 286

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILEDPIPRKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH               D      +V ++L+   IE IVRGYL G   + L  + + G
Sbjct: 66  MPNHFTGDTVYDVLPKEEADLVKNRAVVVKRLKPIKIESIVRGYLTG---SGLKDYKQTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP  + +  KLP P+ TP++K  E     D  IS  E   +  + +     +
Sbjct: 123 T--ICGLQLPQGLVEASKLPEPIFTPSSK--EEVGDHDINISYAECERQ--IGKELAAQV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L++     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY   
Sbjct: 177 RDAAIALYKEAAAYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            REG  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 234 -REGTNPPSFDKQFVRDWLEQSGWNKQPPAPKVPADVIQKTVDKYQEALDLLT 285


>gi|313836144|gb|EFS73858.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL037PA2]
 gi|314927583|gb|EFS91414.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL044PA1]
 gi|314971422|gb|EFT15520.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL037PA3]
 gi|328906355|gb|EGG26130.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium sp. P08]
          Length = 412

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/292 (31%), Positives = 152/292 (52%), Gaps = 24/292 (8%)

Query: 11  ELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           +LP    GKVR  Y   D  G  + +ATDR+SA+D  +   +P KG +L  ++ +WF   
Sbjct: 7   DLPLLAEGKVRRLYRFPDQPGRLLMVATDRISAYDHVLTPGVPGKGAILTSMSLWWFDQL 66

Query: 68  SDICSNH--TLDYPDP---NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           +DI  NH   LD P       +V ++L MFP+E +VRGYL G+           G R + 
Sbjct: 67  ADIVDNHLVGLDVPAEVAGRAMVVEELDMFPVECVVRGYLTGSGWAEY-----QGHRSVC 121

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
              LPD + D  +L  P+ TP  K+ +     D+ I    ++   ++       + S +L
Sbjct: 122 GIRLPDGLQDRSRLEEPIFTPAVKAPQGEH--DENIDYLRLVK--LVGPEVAAQLRSLSL 177

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            +++R  ++A + G+IL D+K+EFG      I+LADE+ TPDSSR+W+ E+++     G 
Sbjct: 178 QIYQRAEEIARKRGIILADTKFEFGRRADGTIVLADEVLTPDSSRFWDAESWQP----GK 233

Query: 243 TPIGLDKDFIRNWILTRCNPYR---DNIPDIPENIILRTSQTYIAAYEKITG 291
                DK ++R+W+       R      P +P+ ++  TS+ Y  A+ ++TG
Sbjct: 234 GADSFDKQYVRDWLTKESGWDRASDQEPPALPDEVVKATSRRYEEAWARLTG 285


>gi|169595304|ref|XP_001791076.1| hypothetical protein SNOG_00390 [Phaeosphaeria nodorum SN15]
 gi|111070765|gb|EAT91885.1| hypothetical protein SNOG_00390 [Phaeosphaeria nodorum SN15]
          Length = 301

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 160/296 (54%), Gaps = 26/296 (8%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSD 69
           +LP   SGKVR+ Y + D   + +A+DR+SA+D  +   IP KG +L  ++ YWF +  +
Sbjct: 14  KLPKVASGKVRDLYAVDDNILLFVASDRISAYDVIMENGIPGKGALLTSMSAYWFKYLPN 73

Query: 70  ICSN---HTLDYPDPNVLVGQ-----------QLQMFPIELIVRGYLAGNTKTSLLTFYK 115
                  H +    P +L  +           +L++ PIE IVRGY+ G+  +    + K
Sbjct: 74  HVPGLRTHFITSSLPPILASETYLQERSMQVRRLRIIPIESIVRGYITGSGWSE---YRK 130

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
           +G   +    LP+ + + QKLP P+ TP+TK+     G D+ ISP E   + I   +   
Sbjct: 131 SGT--VNGISLPEGLIEGQKLPSPLWTPSTKAE--VGGKDENISP-EAARQVIGNSSIAA 185

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +   +L+++      A   G+IL D+K+EFG+D   N++L DE+ TPDSSR+W  ET+E
Sbjct: 186 KVEELSLAIYTAAAARAESVGIILADTKFEFGLDADDNVVLVDEVLTPDSSRFWPKETWE 245

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
            +   G      DK F+R+W+ +     +D +  +PE I+ +T++ Y  AYEKI G
Sbjct: 246 INL--GKAQPSFDKQFLRDWLTSEGLKGKDGV-TVPEEIVKKTAEKYREAYEKIAG 298


>gi|254493245|ref|ZP_05106416.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae 1291]
 gi|268598509|ref|ZP_06132676.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae MS11]
 gi|268683875|ref|ZP_06150737.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae SK-92-679]
 gi|268686118|ref|ZP_06152980.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae SK-93-1035]
 gi|226512285|gb|EEH61630.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae 1291]
 gi|268582640|gb|EEZ47316.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae MS11]
 gi|268624159|gb|EEZ56559.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae SK-92-679]
 gi|268626402|gb|EEZ58802.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae SK-93-1035]
          Length = 319

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + I
Sbjct: 38  LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAHI 97

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH                  +   +V ++L    +E IVRGYLAG   +    + K G
Sbjct: 98  MPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 154

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 155 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 208

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + YE  
Sbjct: 209 RDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQYEV- 267

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              GI P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 268 ---GINPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 317


>gi|221126333|ref|XP_002166104.1| PREDICTED: similar to
           5-phosphoribosyl-5-aminoimidazole-4-N-succinoca
           rboxamide synthase [Hydra magnipapillata]
          Length = 301

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 160/305 (52%), Gaps = 42/305 (13%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFH----H 66
           LP    GKVR+NY + +   + +A+DRLSAFD  +   IP KG +L Q+  +WF     +
Sbjct: 12  LPLLARGKVRDNYAVGEDRILMVASDRLSAFDVIMGEPIPGKGALLTQMALFWFEKLGKN 71

Query: 67  TSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNTKTSLLTF 113
            +D+C NH T D P+  V            ++ ++L+  P+E +VRGYLAG   +    +
Sbjct: 72  GADVCPNHLTGDAPESAVTPAEAAQVAGRSMLVKRLKPLPVEAVVRGYLAG---SGWKEY 128

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS---PNEIIHRGILT 170
             NG   +    LP  + +  KLP P+ TP  K++      D+ I+     E+I   + T
Sbjct: 129 QHNGA--VCGVPLPAGLQNASKLPEPIYTPAAKAA--VGDHDENITFEKTVEMIGLDLAT 184

Query: 171 RNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWE 230
           R     I   ++ +++   + AL  G+I+ D+K+EFG+DK   + L DE+ TPDSSRYW 
Sbjct: 185 R-----IRDLSIQIYKVAAEFALTKGIIIADTKFEFGLDKDGTLTLMDEVLTPDSSRYWP 239

Query: 231 VETYEKSFREGITPIGLDKDFIRNWI---LTRCNPYRDN--IPDIPENIILRTSQTYIAA 285
           VE+Y+     G  P   DK F+R+W+   L    P+      P +P  +I +T+  Y  A
Sbjct: 240 VESYQV----GTNPPSYDKQFVRDWLEQALVDGKPWDKTPPAPRVPREVIEKTADKYREA 295

Query: 286 YEKIT 290
            +++T
Sbjct: 296 LQRLT 300


>gi|317126341|ref|YP_004100453.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Intrasporangium calvum DSM 43043]
 gi|315590429|gb|ADU49726.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Intrasporangium calvum DSM 43043]
          Length = 298

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 101/306 (33%), Positives = 155/306 (50%), Gaps = 35/306 (11%)

Query: 11  ELPNY---YSGKVRENY--FLSDGTRIT-----IATDRLSAFDQNIAC-IPYKGEVLNQI 59
           ELP Y   YSGKVR+ Y     DG  +      +A+DRLSA+D  ++  IP KG VL ++
Sbjct: 6   ELPGYAHVYSGKVRDLYAPVGPDGAPVPDQLLLVASDRLSAYDWMMSPEIPDKGAVLTRL 65

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQ-----LQMFPIELIVRGYLAGNTKTSLLTFY 114
           + +WF   SD+  NH L    P  + G+      L M  +E I R YL G      L  Y
Sbjct: 66  SLWWFDQLSDLVPNHVLSTDVPAAVAGRAVLVRTLDMLKVEAIARAYLTGGG----LEEY 121

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           +  K  +    LPD + D  +LP PV TPTTK+       D P++  E+     L     
Sbjct: 122 Q-AKGSVSGVALPDGLVDGSRLPEPVFTPTTKA--PVGEHDLPMTFAEV--EAALGVEVA 176

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGI--DKKQNIILADEIHTPDSSRYWEVE 232
             +S    ++  RG ++A   G+++ D+K EFG+  D    ++LADE+ TPDSSR+W  E
Sbjct: 177 VEVSRLTRAILARGNEIAGARGILIADTKVEFGVAPDGSGGLVLADEVLTPDSSRFWPAE 236

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEK 288
            +E    +       DK ++R W+ +  + +  +     P++P  ++ +T   Y+ AYE+
Sbjct: 237 LWEPGHPQ----PSFDKQYVREWLTSAESGWSKSSGEPPPELPAQVVEQTRAKYVEAYER 292

Query: 289 ITGLKF 294
           +TG  F
Sbjct: 293 LTGETF 298


>gi|13892055|gb|AAK39638.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Crypthecodinium cohnii]
          Length = 522

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 102/325 (31%), Positives = 168/325 (51%), Gaps = 39/325 (12%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
           +L + +IPEL    SGKVR+ YF      + +  DR+SAFD  +   IP+KG+VL  I++
Sbjct: 24  VLPECFIPELGESKSGKVRDIYFAGKNV-VMVTNDRVSAFDFILPNLIPFKGQVLCGISE 82

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
           + F  T DI  N  ++  D +V+V +++    +E IVRGYL G    S+   Y+ G R  
Sbjct: 83  WAFQETKDIVPNALIENVDSSVVVQKKMTNLNVEFIVRGYLWG----SMAAAYEKGDRTF 138

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               +PD ++  QK   P+ TPTTK+     G D+ ++  E+    ++ ++  +     A
Sbjct: 139 CGLKVPDGLNRFQKFDEPLFTPTTKAE---VGHDENMTYAEV--EKLIGKDMAKKAKDVA 193

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           + L+ RG +L  + GLIL+D+KYEFG+D+   + + DE++TPDSSR   VE +E  + + 
Sbjct: 194 MKLYARGAELMRKRGLILIDTKYEFGLDEHGVLHVIDEVNTPDSSRMCTVEEWETKYPKI 253

Query: 242 ITPIG---------------------LDKDFIRNWILTRC-NPYRDN-IPDIPENIILRT 278
              +                        K ++R+ +L    +P +DN  P + +  ++  
Sbjct: 254 AAEMKTGKHKDVSALMKAKPELKLKEFSKQYVRDALLEMGFDPAKDNKAPKLSDEQVVEC 313

Query: 279 SQTYIAAYEKITGLKFIADNSELPP 303
           +  YI  YE +TG +F     E PP
Sbjct: 314 AYRYIHIYEMVTGKQF-----EFPP 333


>gi|290959188|ref|YP_003490370.1| phosphoribosylaminoimidazole-succinocarboxamide sy nthase
           [Streptomyces scabiei 87.22]
 gi|260648714|emb|CBG71827.1| phosphoribosylaminoimidazole-succinocarboxamide sy nthase
           [Streptomyces scabiei 87.22]
          Length = 299

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 160/301 (53%), Gaps = 30/301 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVRE Y    G  + +A+DR SAFD  +   IP KG VL +++ +WF   
Sbjct: 13  VPGLVHLHTGKVRELYQNEAGDLVMVASDRTSAFDWVLPTEIPDKGRVLTELSLWWFDQL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH L    P           LV + L+M P+E + RGYL G   + LL +  N  
Sbjct: 73  ADLVPNHVLSTELPPGAPADWAGRTLVCKSLKMVPVEAVARGYLTG---SGLLEY--NDS 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETI 177
           R +    LP+ + D  +LP P+ TP TK++      D+ +S  E+  + G  T  Q   +
Sbjct: 128 RTVCGLALPEGLVDGSELPAPIFTPATKAAVGEH--DENVSYEEVARQVGAETAAQ---L 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A + G+IL D+K+EFG +    ++LADE+ TPDSSR+W  + +E  
Sbjct: 183 RQTTLAVYGRARDIARDRGIILADTKFEFGYE-GDTLVLADEVLTPDSSRFWPADLWEP- 240

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLK 293
              G      DK F+R+W+ +  + +        P +PE I+  T   Y+ AYE++TG+ 
Sbjct: 241 ---GHAQPSFDKQFVRDWLTSDASGWDRRSEQPPPPLPEEIVAATRAKYVEAYERLTGVT 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|78067425|ref|YP_370194.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. 383]
 gi|77968170|gb|ABB09550.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. 383]
          Length = 296

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 154/305 (50%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVVMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH T D P+  V            +V ++L+   IE +VRGYLAG  
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRGVVVKRLEPIMIEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +  +G   +    LP+ + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 119 -SGWKEYQASGA--VCGVQLPEGLQNAQKLPEPIFTPAAKAEMGEH--DENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGQLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + YE     G  P   DK F+R+W+  +        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQYEV----GTNPPSFDKQFVRDWLEAQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|260221960|emb|CBA31046.1| Phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Curvibacter putative symbiont of Hydra magnipapillata]
          Length = 313

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 160/305 (52%), Gaps = 42/305 (13%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFH----H 66
           LP    GKVR+NY + +   + +A+DRLSAFD  +   IP KG +L Q+  +WF     +
Sbjct: 24  LPLLARGKVRDNYAVGEDRILMVASDRLSAFDVIMGEPIPGKGALLTQMALFWFEKLGKN 83

Query: 67  TSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNTKTSLLTF 113
            +D+C NH T D P+  V            ++ ++L+  P+E +VRGYLAG   +    +
Sbjct: 84  GADVCPNHLTGDAPESAVTPAEAAQVAGRSMLVKRLKPLPVEAVVRGYLAG---SGWKEY 140

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS---PNEIIHRGILT 170
             NG   +    LP  + +  KLP P+ TP  K++      D+ I+     E+I   + T
Sbjct: 141 QHNGA--VCGVPLPAGLQNASKLPEPIYTPAAKAA--VGDHDENITFEKTVEMIGLDLAT 196

Query: 171 RNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWE 230
           R     I   ++ +++   + AL  G+I+ D+K+EFG+DK   + L DE+ TPDSSRYW 
Sbjct: 197 R-----IRDLSIQIYKVAAEFALTKGIIIADTKFEFGLDKDGTLTLMDEVLTPDSSRYWP 251

Query: 231 VETYEKSFREGITPIGLDKDFIRNWI---LTRCNPYRDN--IPDIPENIILRTSQTYIAA 285
           VE+Y+     G  P   DK F+R+W+   L    P+      P +P  +I +T+  Y  A
Sbjct: 252 VESYQV----GTNPPSYDKQFVRDWLEQALVDGKPWDKTPPAPRVPREVIEKTADKYREA 307

Query: 286 YEKIT 290
            +++T
Sbjct: 308 LQRLT 312


>gi|89514407|gb|ABD75072.1| PurC [Ensifer adhaerens]
          Length = 116

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 87/112 (77%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQIT 60
           +R+LS A+IPELPN Y+GKVRENY L  G RI IATDRLSAFD  +  IP+KG VL Q  
Sbjct: 4   LRVLSDAFIPELPNRYNGKVRENYDLPGGERIIIATDRLSAFDIILTSIPHKGHVLTQTA 63

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLT 112
           +YWF  T+DIC NH + YPDPNV++G++L + P+E++VRGYLAG   TS+LT
Sbjct: 64  RYWFEETADICPNHVISYPDPNVVIGKRLDILPVEIVVRGYLAGTASTSILT 115


>gi|118471351|ref|YP_890068.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium smegmatis str. MC2 155]
 gi|166230822|sp|A0R4I0|PUR7_MYCS2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|118172638|gb|ABK73534.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium smegmatis str. MC2 155]
          Length = 299

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 158/305 (51%), Gaps = 34/305 (11%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           P L +Y    SGKVRE Y + D   + +A+DR+SA+D  + + IP KG +L  ++ ++F 
Sbjct: 3   PALSDYQHLASGKVREIYRIDDEHLLFVASDRISAYDYILDSQIPDKGRILTAMSVFFFD 62

Query: 66  HTSDICS--NHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           H        NH    PD            LV ++L M P+E + RGYL G   + L+ + 
Sbjct: 63  HLLRTAGVPNHLAGPPDDERIPADVLGRALVVRRLDMLPVECVARGYLTG---SGLIDYE 119

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQ 173
           K G   +    LP  + +  K   P+ TP TK+       D+ IS  ++I   G    NQ
Sbjct: 120 KTGT--VCGIALPPGLGEASKFDEPLFTPATKAEIGEH--DENISFAKVIELVGAELANQ 175

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
              +    L  +  G   AL  G+I+ D+K+EFG+D+   ++LADE+ TPDSSRYW  ++
Sbjct: 176 ---LRDRTLQTYTAGADHALSKGIIIADTKFEFGVDRDGTVVLADEVFTPDSSRYWRADS 232

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKI 289
           Y+     G+     DK F+RNW+    + +  +     P +P++I+  T + YI AYE+I
Sbjct: 233 YQP----GVVQNSFDKQFVRNWLTGPESGWDRHGNTPPPALPDDIVAATRERYIEAYERI 288

Query: 290 TGLKF 294
           +GL F
Sbjct: 289 SGLSF 293


>gi|240112442|ref|ZP_04726932.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae MS11]
 gi|260441000|ref|ZP_05794816.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae DGI2]
          Length = 287

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH                  +   +V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 123 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + YE  
Sbjct: 177 RDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQYEV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              GI P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 236 ---GINPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 285


>gi|145631858|ref|ZP_01787616.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae R3021]
 gi|144982514|gb|EDJ90072.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae R3021]
          Length = 290

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 102/296 (34%), Positives = 152/296 (51%), Gaps = 27/296 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           I  L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  
Sbjct: 7   ILSLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKL 66

Query: 68  SDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + I  NH               D      +V ++L    IE IVRGYL G   + L  + 
Sbjct: 67  AHIMPNHFTSDSVYDVLPKEEADLIKDRAVVCKRLTPIKIESIVRGYLTG---SGLKDYK 123

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           + G   I    LP+N+ +  KLP  + TP++K  E     D  IS  E     ++  +  
Sbjct: 124 QTGT--ICGLKLPENLVEASKLPEAIFTPSSK--EEVGNHDINISYAEC--EKLIGADLA 177

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY
Sbjct: 178 AQVKEKAIALYTVAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY 237

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           +     G  P   DK F+R+W+       +   P +PENII +T   Y  A + +T
Sbjct: 238 QA----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPENIIQKTVDKYQEALDLLT 289


>gi|330999109|ref|ZP_08322830.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Parasutterella excrementihominis YIT 11859]
 gi|329575498|gb|EGG57037.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Parasutterella excrementihominis YIT 11859]
          Length = 297

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 93/298 (31%), Positives = 155/298 (52%), Gaps = 29/298 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           I  LP  Y GKVR++Y + D   + +A+DR+SAFD  +   IP KG++L  +T +WF   
Sbjct: 9   IKSLPLVYRGKVRDSYAVGDDKLLIVASDRISAFDVILGDPIPKKGKILTALTDFWFKEL 68

Query: 68  SDICSNHTLDYPDPN--------------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTF 113
             I  NH L   DP                +V ++L+   +E + RGYL+G+      T 
Sbjct: 69  DGIVPNH-LTGTDPESVVAPEERDQVKGRAVVAKRLKPILVECVARGYLSGSAWKEYQT- 126

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
                 +I    LP  +  ++KLP P+ TP  K+   A   D+ I+  +++ +     + 
Sbjct: 127 ----TGQICGVKLPAGLKQSEKLPEPIFTPAGKAE--AGHHDENITYEDVVKQ--YGEDT 178

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
              +  Y L+L+++  + A   G+I+ D+K+EFG+D    ++L DEI TPDSSR+W  + 
Sbjct: 179 ASKLRDYTLALYKKAAEYAASKGIIIADTKFEFGLDDNGTVVLMDEILTPDSSRFWPADE 238

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           Y    + G +    DK FIR+W+ ++    +   P IP++++ +TS  Y  A  ++TG
Sbjct: 239 Y----KVGQSEPSFDKQFIRDWLESQPWNKKAPAPKIPQDVLDKTSSKYEEALIRLTG 292


>gi|301156547|emb|CBW16018.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 286

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 102/294 (34%), Positives = 151/294 (51%), Gaps = 29/294 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAHI 65

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH               D      +V ++L    IE IVRGYL G   + L  + + G
Sbjct: 66  MPNHFTGDSVYDVLPKEEADLVKDRAVVCKRLNPIKIESIVRGYLTG---SGLKDYKQTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWET 176
              I    LP+ + +  KLP P+ TP++K  E     D  IS  E     G+    Q   
Sbjct: 123 T--ICGLKLPEGLVEASKLPEPIFTPSSK--EEVGNHDINISYEECEKAIGVELAAQ--- 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   A++L+    K AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY  
Sbjct: 176 VREKAIALYTEAAKYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY-- 233

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             +EG  P   DK F+R+W+       +   P +P+ +I +T   Y  A + +T
Sbjct: 234 --KEGTNPPSFDKQFVRDWLEQSGWNKQPPAPKVPKEVIEKTVAKYQEALDLLT 285


>gi|172041306|ref|YP_001801020.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium urealyticum DSM 7109]
 gi|229564388|sp|B1VIK2|PUR7_CORU7 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|171852610|emb|CAQ05586.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium urealyticum DSM 7109]
          Length = 297

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 156/302 (51%), Gaps = 32/302 (10%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           PEL +Y    +GKVRE Y +     + + TDR+SA+D  +   IP KG VL  ++ Y+F 
Sbjct: 3   PELSDYEHISAGKVREIYEIDAEHLLMVVTDRISAYDFVLDTDIPDKGRVLTAMSAYFFE 62

Query: 66  HTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH     D            +V ++L M P E + RGYL G   + L  +   
Sbjct: 63  QID--FPNHLAGPLDDERIPEEVLGRAMVCRKLDMVPFECVARGYLTG---SGLKEYEAT 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP+ + +  KL  P+ TP TK+       D+ +  + ++    L  +  E 
Sbjct: 118 GA--VCGVKLPEGLVEASKLDEPIFTPATKAE--IGDHDENVGFDVVVKD--LGEDLAER 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + +  L ++ +  K+A E GLIL D+K+EFG+DK+ N++LADE+ TPDSSRYW  E YE 
Sbjct: 172 LRTATLEIYSQAAKMAEEKGLILADTKFEFGLDKEGNLVLADEVLTPDSSRYWPAEGYE- 230

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGL 292
              EG      DK F+RNW+    + +  N     P++P +++  T   Y+ AYE+I+G 
Sbjct: 231 ---EGKVQPSFDKQFVRNWLTGPKSGWDKNDGSQPPELPGSVVEATRARYVEAYERISGK 287

Query: 293 KF 294
           +F
Sbjct: 288 RF 289


>gi|319764779|ref|YP_004128716.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alicycliphilus denitrificans BC]
 gi|330826995|ref|YP_004390298.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alicycliphilus denitrificans K601]
 gi|317119340|gb|ADV01829.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alicycliphilus denitrificans BC]
 gi|329312367|gb|AEB86782.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alicycliphilus denitrificans K601]
          Length = 306

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 161/307 (52%), Gaps = 28/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L  + +  LP    GKVR+NY + D   + +A+DRLSAFD  +   IP KGE+L Q+  +
Sbjct: 9   LHTSALTSLPLLARGKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGELLTQMALF 68

Query: 63  WFHHTSDICSNH-TLDYPD--------PNV----LVGQQLQMFPIELIVRGYLAGNTKTS 109
           WF     +  NH T + P+        P V    ++ ++L+  PIE +VRGYLAG    S
Sbjct: 69  WFDKLGHVVPNHLTGEAPESVVTPAEAPQVRGRSMLVKRLKPIPIEAVVRGYLAG----S 124

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
               Y+   R +    LPD +++  +LP+ + TP  K++      D+ I+    +   ++
Sbjct: 125 GWKEYQE-SRSVCGVPLPDGLTNAARLPHSIYTPAAKAAMGEH--DENITFERTVE--MV 179

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
             +    I   ++ L+E    +AL  G+I+ D+K+EFG+DK   ++L DE+ TPDSSRYW
Sbjct: 180 GPDLAARIRDVSIQLYEAAAAIALAKGMIIADTKFEFGLDKDGTLVLMDEVLTPDSSRYW 239

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWI---LTRCNPYRDNIPD--IPENIILRTSQTYIA 284
            VE Y ++   G  P   DK F+R+W+        P+    P   +P  ++ +T+  Y  
Sbjct: 240 PVEGYAEALARGENPPSYDKQFVRDWLEQAQVGGKPWNKTAPAPRLPREVVEKTAAKYRE 299

Query: 285 AYEKITG 291
           A +++T 
Sbjct: 300 ALQRLTA 306


>gi|291044329|ref|ZP_06570038.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae DGI2]
 gi|291011223|gb|EFE03219.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae DGI2]
          Length = 330

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + I
Sbjct: 49  LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAHI 108

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH                  +   +V ++L    +E IVRGYLAG   +    + K G
Sbjct: 109 MPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 165

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 166 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 219

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + YE  
Sbjct: 220 RDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQYEV- 278

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              GI P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 279 ---GINPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 328


>gi|194098064|ref|YP_002001112.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae NCCP11945]
 gi|268594383|ref|ZP_06128550.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae 35/02]
 gi|268600861|ref|ZP_06135028.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID18]
 gi|193933354|gb|ACF29178.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae NCCP11945]
 gi|268547772|gb|EEZ43190.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae 35/02]
 gi|268584992|gb|EEZ49668.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID18]
 gi|317163797|gb|ADV07338.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 319

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  + A +P KGE+L QI+ +WF   + I
Sbjct: 38  LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPVPGKGEILTQISNFWFKKLAHI 97

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH                  +   +V ++L    +E IVRGYLAG   +    + K G
Sbjct: 98  MPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 154

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 155 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 208

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + YE  
Sbjct: 209 RDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQYEV- 267

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              GI P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 268 ---GINPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 317


>gi|313904382|ref|ZP_07837759.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Eubacterium cellulosolvens 6]
 gi|313470718|gb|EFR66043.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Eubacterium cellulosolvens 6]
          Length = 290

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 162/293 (55%), Gaps = 35/293 (11%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRE Y  +D   + +ATDR+SAFD  +   +  KG VL Q++++WF +T DI  NH +
Sbjct: 10  GKVREIYD-TDENLVMVATDRISAFDVILKNKVTKKGAVLTQMSKFWFDYTKDIIPNHMV 68

Query: 77  -----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
                D P        D N ++ ++L+M PIE IVRGY+ G   +   ++ +NG   +  
Sbjct: 69  SVDVKDMPEFFQQPQFDGNSMLCKKLEMLPIECIVRGYITG---SGWASYQENGT--VCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTRNQ--WETIS 178
             LP  + +  KLP P+ TP+TK+       D+ IS     E++ +    + +   + + 
Sbjct: 124 IALPAGLKECDKLPEPIYTPSTKAE--IGDHDENISYEKSIEVLEKVYPGKGEEYAKALK 181

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L L++   + AL  G+I+ D+K+EFG+D+  N++LADE+ TPDSSR+W  + YE   
Sbjct: 182 DSTLKLYKACAEYALSKGIIIADTKFEFGLDENGNVVLADEMLTPDSSRFWPADGYEP-- 239

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
             G +    DK F+R+W+  + NP  D   ++P+ II +T   Y  AY  +TG
Sbjct: 240 --GHSQPSFDKQFVRDWL--KANPDSDY--NLPQEIIDKTIDKYKEAYHLLTG 286


>gi|240125274|ref|ZP_04738160.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae SK-92-679]
 gi|240127728|ref|ZP_04740389.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae SK-93-1035]
          Length = 282

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 97/289 (33%), Positives = 150/289 (51%), Gaps = 27/289 (9%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + I  NH
Sbjct: 5   YSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAHIMPNH 64

Query: 75  -------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
                             +   +V ++L    +E IVRGYLAG   +    + K G   +
Sbjct: 65  FTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTGS--V 119

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +   A
Sbjct: 120 CGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEVRDKA 175

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           + L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + YE     G
Sbjct: 176 VRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQYEV----G 231

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           I P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 232 INPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 280


>gi|182412996|ref|YP_001818062.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Opitutus
           terrae PB90-1]
 gi|177840210|gb|ACB74462.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Opitutus
           terrae PB90-1]
          Length = 302

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 104/297 (35%), Positives = 157/297 (52%), Gaps = 33/297 (11%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
            P   SGKVRE + L D   + +ATDRLSAFD  +   IP KG +L Q++ +WF  TS +
Sbjct: 22  FPRIASGKVREIFDLGDAL-LLVATDRLSAFDVILPDGIPGKGAILTQMSNWWFAQTSQL 80

Query: 71  CSNHTLDYPD-PNVL---------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
             NH L  PD P +L               V ++L+   IE +VRGYL G+  +S   + 
Sbjct: 81  IPNHLL--PDQPGLLANKYQLTRDLQLRSMVVRKLKPLTIECVVRGYLVGSGWSS---YQ 135

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           K G+  +    LP  +    +LP P+ TPTTK+ +     D+PI  N+      +    +
Sbjct: 136 KTGE--VCGIKLPGGLRQADQLPEPIFTPTTKAPKGQH--DEPI--NDAQGAAAIGAALY 189

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
           + + + +L+L++ G   A + G+IL D+K+EFG D   N+IL DE+ TPDSSRYW  + Y
Sbjct: 190 DKVKATSLALYKFGHDRAKQAGMILADTKFEFGTDAAGNLILIDEVLTPDSSRYWPADRY 249

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
             +     +P   DK F+R+ +L          P +P  +I RT + Y+AA + + G
Sbjct: 250 APN----QSPPSYDKQFVRDHLLAIKWNQSPPAPRLPAEVIQRTQEKYLAALKNLLG 302


>gi|268603167|ref|ZP_06137334.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID1]
 gi|268587298|gb|EEZ51974.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID1]
          Length = 319

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + I
Sbjct: 38  LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAHI 97

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH                  +   +V ++L    +E IVRGYLAG   +    + K G
Sbjct: 98  MPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 154

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 155 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 208

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+D+K  + L DE+ TPDSSR+W  + YE  
Sbjct: 209 RDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEKGTLTLMDEVLTPDSSRFWPADQYEV- 267

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 268 ---GTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 317


>gi|190151374|ref|YP_001969899.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|307264731|ref|ZP_07546310.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|189916505|gb|ACE62757.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|306869927|gb|EFN01692.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 13 str. N273]
          Length = 285

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 5   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAHI 64

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYL G   + L  + + G
Sbjct: 65  MPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTG---SGLKDYKQTG 121

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP+ + +  KLP P+ TP++K+       D  IS  E  H+  +       +
Sbjct: 122 T--ICGLKLPEGLVEASKLPQPIFTPSSKAE--VGNHDINISYEECEHQ--IGAELAAKV 175

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY+  
Sbjct: 176 RDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQ-- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EG  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 234 --EGTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|239998523|ref|ZP_04718447.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae 35/02]
 gi|240016087|ref|ZP_04722627.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae FA6140]
 gi|240115182|ref|ZP_04729244.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID18]
          Length = 287

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  + A +P KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPVPGKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH                  +   +V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 123 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + YE  
Sbjct: 177 RDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQYEV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              GI P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 236 ---GINPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 285


>gi|169627791|ref|YP_001701440.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium abscessus ATCC 19977]
 gi|229564398|sp|B1MHW4|PUR7_MYCA9 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|169239758|emb|CAM60786.1| Probable phosphoribosylaminoimidazole-succinocarboxamide synthase
           PurC [Mycobacterium abscessus]
          Length = 297

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 159/303 (52%), Gaps = 34/303 (11%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           P L +Y    SGKVRE Y + D   + +ATDR+SAFD  +   IP KG +L  ++ ++F 
Sbjct: 3   PSLSDYQHVASGKVRELYRVDDEHLLFVATDRISAFDFVLDTPIPDKGRILTAMSVFFFG 62

Query: 66  HTSDICSNHTLDYPD----PNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
             +    NH    PD    P  ++G+     +L M P+E + RGYL G   + LL + + 
Sbjct: 63  LLT--VPNHLAGPPDDPRIPEEVLGRALLVRRLDMLPVECVARGYLTG---SGLLDYQRT 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +  ++LP  + +  +L  P+ TP TK+       D  +    ++  G++   +   
Sbjct: 118 GA--VCGHVLPQGLGEASRLDPPLFTPATKADIGEH--DMNVDFAAVV--GLVGAVRANQ 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    + ++ R    AL  G+IL D+K+EFG+D + N++LADE+ TPDSSRYW+   Y+ 
Sbjct: 172 LRDETIKIYTRAAAHALHKGIILADTKFEFGVDIEGNLVLADEVFTPDSSRYWDAAHYQP 231

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI-----PDIPENIILRTSQTYIAAYEKITG 291
               G+     DK F+RNW LT      D       P +P+ + + T + YI AYE+I+G
Sbjct: 232 ----GVVQDSFDKQFVRNW-LTGPESGWDRASDTPPPPLPDEVAVATRERYIEAYERISG 286

Query: 292 LKF 294
           L F
Sbjct: 287 LSF 289


>gi|46204272|ref|ZP_00209337.1| COG0152: Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
           synthase [Magnetospirillum magnetotacticum MS-1]
          Length = 330

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 99/314 (31%), Positives = 163/314 (51%), Gaps = 45/314 (14%)

Query: 9   IPELPNYYSGKVRENYF-----------LSDGTRITIATDRLSAFDQNIA-CIPYKGEVL 56
           +P   + YSGKVR+ Y            L D   + +A+DR+SA+D  ++  IP KG VL
Sbjct: 27  LPGWTHAYSGKVRDLYTPDLPAVGGVHPLGD-VVLVVASDRVSAYDHVLSPGIPDKGVVL 85

Query: 57  NQITQYWFHHTSDICSNHTL---------DYPDPNVLVG-----QQLQMFPIELIVRGYL 102
            Q++ +WF   +D+  NH +         D   P+V+ G     ++L MFP+E + RGYL
Sbjct: 86  TQLSLWWFEQLADLVPNHVVSTAVSAVPGDGLVPDVVAGRAMICRRLDMFPVECVARGYL 145

Query: 103 AGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNE 162
            G    S L  Y+ G  ++    LPD + D  +LP P+ TP TK++      D+ +S + 
Sbjct: 146 TG----SGLVEYRAGG-EVCGVPLPDGLVDGSRLPEPIFTPATKAAVGEH--DENVSFDV 198

Query: 163 IIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIH 221
           +  +  +  +    +    L+++ R  ++A + G+IL D+K EFG+D      +L DE+ 
Sbjct: 199 VAEQ--IGLDDATRLRDLTLAVYARAEEIARDRGVILADTKLEFGVDPATGETVLGDEVL 256

Query: 222 TPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILR 277
           TPDSSR+W  + +E     G      DK F+R+W+ +  + +        P IP +++ R
Sbjct: 257 TPDSSRFWPADQWEP----GRAQPSFDKQFVRDWLTSPASGWGRAADTPPPSIPADVVAR 312

Query: 278 TSQTYIAAYEKITG 291
           T   Y+ AYE++TG
Sbjct: 313 TRARYLEAYERLTG 326


>gi|302559827|ref|ZP_07312169.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces griseoflavus Tu4000]
 gi|302477445|gb|EFL40538.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces griseoflavus Tu4000]
          Length = 299

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 156/301 (51%), Gaps = 30/301 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVRE Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRELYRNEAGDLVMVASDRISAYDWVLPTEIPDKGRVLTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH L    P           LV + L M P+E + RGYL G    S L  Y +  
Sbjct: 73  ADLLPNHVLSTELPAGAPAEWEGRTLVCKSLNMVPVECVARGYLTG----SGLVEYDD-T 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETI 177
           R +    LP+ + D  +LP P+ TP TK++      D+ +S  E+  + G  T  Q   +
Sbjct: 128 RTVCGLALPEGLVDGSELPAPIFTPATKAAVGEH--DENVSYEEVARQVGAETAAQ---L 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+ + R   +A E G++L D+K+EFG D    ++LADE+ TPDSSR+W    ++  
Sbjct: 183 RQATLAAYSRARDIARERGIVLADTKFEFGFD-GDTLVLADEVLTPDSSRFWPAGQWQP- 240

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLK 293
              G      DK ++R+W+ +  + +        P +P++++  T   Y+ AYE +TG  
Sbjct: 241 ---GRAQPSYDKQYVRDWLTSAESGWDRRSEQPPPPLPQHVVDATRTKYVEAYELLTGTG 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|224826145|ref|ZP_03699248.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Lutiella
           nitroferrum 2002]
 gi|224601782|gb|EEG07962.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Lutiella
           nitroferrum 2002]
          Length = 292

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 99/304 (32%), Positives = 159/304 (52%), Gaps = 27/304 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  ++   +  L   YSGKVR+ Y + D   + IATDRLSAFD  +   IP KG++L  I
Sbjct: 1   MTGITTTNLTSLKKIYSGKVRDLYQIDDKRMLMIATDRLSAFDVILDDPIPGKGQILTAI 60

Query: 60  TQYWFHHTSDICSNH-TLDYPD--------PNV----LVGQQLQMFPIELIVRGYLAGNT 106
           + +WF    D+  NH T D P+        P V    +V ++L+  PIE +VRGYLAG  
Sbjct: 61  SNFWFERLKDLVPNHLTGDKPEDVVSAEDLPQVEGRAVVAKRLKAVPIEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    + ++G   +    LP+ + +  +LP P+ TP+TK++      D+ IS    +  
Sbjct: 119 -SGWKEYQQSGT--VCGIKLPEGLKEASQLPEPIFTPSTKAA--VGDHDENISYERCVE- 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+     E +   A++L++     A   G+I+ D+K+EFG+D+   + L DE  TPDSS
Sbjct: 173 -IIGAELAEKVRDTAITLYKAAAFYAATRGIIICDTKFEFGLDEDGTLTLMDEALTPDSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  ++Y      G  P   DK F+R+W+       +   P +P ++  +T+  Y  A 
Sbjct: 232 RFWPADSYVA----GSNPPSFDKQFVRDWLEASGWNKQAPAPAVPLDVREKTADKYREAL 287

Query: 287 EKIT 290
           E++T
Sbjct: 288 ERLT 291


>gi|240117466|ref|ZP_04731528.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID1]
          Length = 287

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH                  +   +V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 123 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+D+K  + L DE+ TPDSSR+W  + YE  
Sbjct: 177 RDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEKGTLTLMDEVLTPDSSRFWPADQYEV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 236 ---GTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 285


>gi|312194087|ref|YP_004014148.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. EuI1c]
 gi|311225423|gb|ADP78278.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. EuI1c]
          Length = 303

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 96/307 (31%), Positives = 158/307 (51%), Gaps = 29/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQY 62
           L+      L +  SGKVRE + + D   + +A+DR+SAFD  +   IP KG VL  ++ +
Sbjct: 3   LTHVEFAGLTHLGSGKVRELFAVGDDAVLLVASDRISAFDVILPTEIPDKGAVLTGLSLW 62

Query: 63  WFHHTSDICSNHTL-----DYPDP----------NVLVGQQLQMFPIELIVRGYLAGNTK 107
           WF   +D+  +H +     +YPD             ++  +L M  +E + RGYL G   
Sbjct: 63  WFDQLADLVPSHVISSNVDEYPDELQPYAEQLRGRSMLCHRLDMALVECVARGYLTG--- 119

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
           + L  + + G   +  + LP+ + D  KLP+P+ TP+TK+       D+ IS  +   R 
Sbjct: 120 SGLKDYVRTGA--VSGHTLPEGLVDGSKLPHPIYTPSTKAPIGEH--DENISRADAATR- 174

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
            +  +    +    L +F R   LA E G++L D+K+EFG D    + L DE+ TPDSSR
Sbjct: 175 -IGDDLAAELEKLTLQIFGRASDLAAERGILLADTKFEFGHDPAGVLRLGDEVLTPDSSR 233

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  +++      G  P   DK FIR++++          P++P++I+  T   Y+ AYE
Sbjct: 234 FWPADSWAPG---GAQP-SYDKQFIRDYLVNTGWDKVSPAPELPDDIVFSTRSRYVEAYE 289

Query: 288 KITGLKF 294
           ++TG+ F
Sbjct: 290 RLTGISF 296


>gi|152978657|ref|YP_001344286.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus succinogenes 130Z]
 gi|171704257|sp|A6VN04|PUR7_ACTSZ RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|150840380|gb|ABR74351.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus succinogenes 130Z]
          Length = 286

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP+KGE+L QI+ +WF   + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPHKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH               D      +V ++L+   IE IVRGYL G   + L  + + G
Sbjct: 66  MPNHFTGDSVYDVLPKAEADLLKDRAVVVKRLKPIKIESIVRGYLTG---SGLKDYQQTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP  + +  KLP P+ TP++K  E     D  IS  E     ++ +     +
Sbjct: 123 T--ICGLELPKGLVEAGKLPEPIFTPSSK--EEVGDHDINISYAEC--ERLIGKELAAQV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L++     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY   
Sbjct: 177 RDAAIALYKEAAAYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            +EG  P   DK F+R+W+       +   P +P  +I +T   Y  A + +T
Sbjct: 234 -KEGTNPPSFDKQFVRDWLEQSGWNKQPPAPKVPAEVIEKTVAKYQEALDLLT 285


>gi|32033842|ref|ZP_00134127.1| COG0152: Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
           synthase [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|126209472|ref|YP_001054697.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae L20]
 gi|126098264|gb|ABN75092.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Actinobacillus pleuropneumoniae serovar 5b
           str. L20]
          Length = 285

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 5   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAHI 64

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYL G   + L  + + G
Sbjct: 65  MPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTG---SGLKDYKQTG 121

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP+ + +  KLP P+ TP++K+       D  IS  E  H+  +       +
Sbjct: 122 T--ICGLKLPEGLVEASKLPQPIFTPSSKAE--VGDHDINISYEECEHQ--IGAELAAKV 175

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY+  
Sbjct: 176 RDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQ-- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EG  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 234 --EGTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|329666292|pdb|3R9R|A Chain A, Structure Of A
           Phosphoribosylaminoimidazole-Succinocarboxamide Synthase
           From Mycobacterium Abscessus Atcc 19977  DSM 44196
          Length = 301

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 159/303 (52%), Gaps = 34/303 (11%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           P L +Y    SGKVRE Y + D   + +ATDR+SAFD  +   IP KG +L  ++ ++F 
Sbjct: 7   PSLSDYQHVASGKVRELYRVDDEHLLFVATDRISAFDFVLDTPIPDKGRILTAMSVFFFG 66

Query: 66  HTSDICSNHTLDYPD----PNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
             +    NH    PD    P  ++G+     +L M P+E + RGYL G   + LL + + 
Sbjct: 67  LLT--VPNHLAGPPDDPRIPEEVLGRALLVRRLDMLPVECVARGYLTG---SGLLDYQRT 121

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +  ++LP  + +  +L  P+ TP TK+       D  +    ++  G++   +   
Sbjct: 122 GA--VCGHVLPQGLGEASRLDPPLFTPATKADIGEH--DMNVDFAAVV--GLVGAVRANQ 175

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    + ++ R    AL  G+IL D+K+EFG+D + N++LADE+ TPDSSRYW+   Y+ 
Sbjct: 176 LRDETIKIYTRAAAHALHKGIILADTKFEFGVDIEGNLVLADEVFTPDSSRYWDAAHYQP 235

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI-----PDIPENIILRTSQTYIAAYEKITG 291
               G+     DK F+RNW LT      D       P +P+ + + T + YI AYE+I+G
Sbjct: 236 ----GVVQDSFDKQFVRNW-LTGPESGWDRASDTPPPPLPDEVAVATRERYIEAYERISG 290

Query: 292 LKF 294
           L F
Sbjct: 291 LSF 293


>gi|300780477|ref|ZP_07090333.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Corynebacterium genitalium ATCC 33030]
 gi|300534587|gb|EFK55646.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Corynebacterium genitalium ATCC 33030]
          Length = 290

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 101/306 (33%), Positives = 163/306 (53%), Gaps = 38/306 (12%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           PEL +Y    +GKVRE Y +   T + +ATDR+SAFD ++   IP KG++L   + ++F 
Sbjct: 3   PELSDYKHLSAGKVREIYEIDTDTLLMVATDRISAFDYSLDPEIPDKGKILTLTSAFFFD 62

Query: 66  HTSDICSNHTLDYPD-----PNVLVG----QQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
             ++   NH     D      +VL G    ++L M P E +VRGYL G+ K        +
Sbjct: 63  LLAEF-PNHLAGPLDDGRIPEDVLGGAFVVKRLDMVPFECVVRGYLTGSGKKEY-----D 116

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LPD + +  KLP P+ TP TK+ +     D  ++    +    + R   E 
Sbjct: 117 ATGSVCGVELPDGLVEASKLPEPIFTPATKAEQG----DHDVN----VSYDYMAREIGED 168

Query: 177 ISS----YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVE 232
           ++S      L+++ +  + A   G+IL D+K+EFG+D    ++LADE+ TPDSSRYW  +
Sbjct: 169 LASRLRETTLAIYTKAAQYAESRGIILADTKFEFGLDDNGTLVLADEVLTPDSSRYWPAD 228

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDN---IPDIPENIILRTSQTYIAAYEKI 289
           +Y    +EG      DK ++RNW+  +     D+    P++P +++  T + YI AYE++
Sbjct: 229 SY----KEGEAQPSFDKQYVRNWLSQKSGWDADSGTPPPELPGSVVEATRERYIEAYERL 284

Query: 290 TGLKFI 295
           +G KFI
Sbjct: 285 SGKKFI 290


>gi|317507539|ref|ZP_07965259.1| saicar synthetase [Segniliparus rugosus ATCC BAA-974]
 gi|316254163|gb|EFV13513.1| saicar synthetase [Segniliparus rugosus ATCC BAA-974]
          Length = 327

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 156/300 (52%), Gaps = 37/300 (12%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           P L  Y   +SGKVR+ Y + D   + +A+DR+SA+D  +A  IP KG VL  ++ ++F 
Sbjct: 3   PSLAEYQHVHSGKVRDLYAVDDEHLLFVASDRISAYDHVLATPIPDKGRVLTALSGFFFE 62

Query: 66  HTSDICSNHTLDYPD---------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                 ++H    PD            LV ++L+M P+E I RGYL G+        Y+ 
Sbjct: 63  QLG--AASHLAGPPDDERIPAEVLGRALVVRKLRMVPVECIARGYLTGSGWAD----YQA 116

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP  +++N +L  P+ TPTTK+       D+ IS  E+  +  L  +  E 
Sbjct: 117 GG-SVSGVALPPGLAENARLRPPIFTPTTKAEVGEH--DESISFAEVAEK--LGASLAEQ 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L +F    +L  E GL LVD+K+EFG+D +  ++LADE  TPDSSRYW  ++   
Sbjct: 172 LRDATLRIFSSASELVAERGLTLVDTKFEFGLDDEGRLVLADEALTPDSSRYWPADSPGT 231

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITGL 292
           S         LDK ++RNW+ +  + +  +     P +P  ++  T + YI  YE++TGL
Sbjct: 232 S---------LDKQYVRNWLTSPASGWSKSGGQEPPPLPAEVVEATRRRYIQLYEQVTGL 282


>gi|264680783|ref|YP_003280693.1| phosphoribosylaminoimidazole-succinocarboxamide [Comamonas
           testosteroni CNB-2]
 gi|299531974|ref|ZP_07045374.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Comamonas
           testosteroni S44]
 gi|262211299|gb|ACY35397.1| phosphoribosylaminoimidazole-succinocarboxamide [Comamonas
           testosteroni CNB-2]
 gi|298720149|gb|EFI61106.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Comamonas
           testosteroni S44]
          Length = 305

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 98/307 (31%), Positives = 158/307 (51%), Gaps = 28/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L  + I  LP    GKVR+NY + D   + +A+DRLSAFD  +   IP KG +L Q+  +
Sbjct: 8   LHTSNIASLPLLARGKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGVLLTQMALF 67

Query: 63  WFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNTKTS 109
           WF     IC NH T + P+  V            ++ ++L+   IE +VRGYLAG    S
Sbjct: 68  WFDKLGHICPNHLTGEAPESVVKPEEVKQVEGRSMLVKRLKPVLIEAVVRGYLAG----S 123

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
               Y+   + +    LP  +++  KLP P+ TP  K+       D+ I+    +   ++
Sbjct: 124 GWKEYQE-SQSVCGVKLPAGLTNAAKLPEPIYTPAAKAE--MGDHDENITYERTVE--MV 178

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
                  I   A+ +++   ++AL  G+I+ D+K+EFG+ +   ++L DE+ TPDSSRYW
Sbjct: 179 GEQLAAQIRDTAIRIYKEAAEIALTKGMIIADTKFEFGLTEDGTLVLMDEVLTPDSSRYW 238

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTYIA 284
            VE YE +  +G  P   DK F+R+W+       +    +   P +P+ +I RT+  Y  
Sbjct: 239 PVEGYEDALAKGENPPSYDKQFVRDWLEQAQVNGKAWDKKAPAPRLPKEVIDRTAAKYRE 298

Query: 285 AYEKITG 291
           A +++T 
Sbjct: 299 ALDRLTA 305


>gi|291549944|emb|CBL26206.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ruminococcus torques L2-14]
          Length = 291

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 103/301 (34%), Positives = 164/301 (54%), Gaps = 33/301 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + EL     GKVRE Y   D + I +ATDR+S FD  +   +  KG VL Q++++WF  T
Sbjct: 1   MQELKPIKEGKVREIYDNGD-SLIMVATDRISCFDVILNNEVTKKGTVLTQMSKFWFDLT 59

Query: 68  SDICSNHTL-----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
            DI  NH L     D P        D   ++ ++L+M PIE IVRGY+ G+   S   + 
Sbjct: 60  EDILPNHMLSVDVKDMPEFFQQEKYDGKSMMCKKLEMLPIECIVRGYITGSGWES---YK 116

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSS----ESASGCDQPISPNEIIHRGILT 170
           +NG   +    LP+ + ++ KLP P+ TP+TK+     +     +Q +   E  + G   
Sbjct: 117 ENGT--VCGITLPEGLKESDKLPEPIYTPSTKAEIGDHDENISFEQSVDHLEKYYPG-RG 173

Query: 171 RNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWE 230
           R   E +    ++L+++  + AL  G+I+ D+K+EFG+D+  N+++ DE+ TPDSSR+W 
Sbjct: 174 RELAEKLRDNTIALYKKCAEYALSKGIIIADTKFEFGLDENGNMVIGDEMLTPDSSRFWP 233

Query: 231 VETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            + YE     G      DK F R+W+  + NP  DN   +P+ I+ +T + Y+ AY+ +T
Sbjct: 234 ADGYEA----GHGQPSFDKQFARDWL--KANP--DNDWTLPQEIVDKTIEKYLQAYKMLT 285

Query: 291 G 291
           G
Sbjct: 286 G 286


>gi|284030028|ref|YP_003379959.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Kribbella
           flavida DSM 17836]
 gi|283809321|gb|ADB31160.1| Phosphoribosylaminoimidazolesuccinocarboxamide synthase [Kribbella
           flavida DSM 17836]
          Length = 280

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 153/289 (52%), Gaps = 24/289 (8%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNH 74
           + GKVR+ Y    G  I +ATDR+S +D  +   IP KG++L  ++ +WF   +D+  NH
Sbjct: 5   HRGKVRDVYSDRPGEVILVATDRVSVYDVVLPTPIPDKGKLLTSLSLWWFGQLADVMPNH 64

Query: 75  TLDYPD-PNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            +   D P    G     QQ+++  +E I RGYLAG        + + GK  I    +P 
Sbjct: 65  VISATDVPAEFEGRAVRCQQVEIIQVECIARGYLAG---LGWDAYQETGK--ISGVEIPP 119

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            + +  KLP PV TPTTK++    G D+P++  E+     +     +T+ +  L LF + 
Sbjct: 120 GLREGDKLPQPVFTPTTKTAPE-DGHDEPMTFEEVSE--AVGPELAKTLEAKTLELFSKA 176

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++    G+ L D+K EFG+ K   ++LADE+ T DSSRYW  E ++   R+    +  D
Sbjct: 177 TEITAGRGVHLADTKLEFGLAKDGTLVLADEVLTSDSSRYWRDEDWKPGQRQ----VSFD 232

Query: 249 KDFIRNWILTRCNPYRDNI---PDIPENIILRTSQTYIAAYEKITGLKF 294
           K ++R+W   R     D     P+IP  ++  T   Y+A YE+ITGLK+
Sbjct: 233 KQYVRDW--ARDLGSWDKTPPGPEIPAEVVEETRARYVAMYERITGLKW 279


>gi|240013648|ref|ZP_04720561.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae DGI18]
          Length = 282

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 97/289 (33%), Positives = 149/289 (51%), Gaps = 27/289 (9%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDICSNH 74
           YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + I  NH
Sbjct: 5   YSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAHIMPNH 64

Query: 75  -------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
                             +   +V ++L    +E IVRGYLAG   +    + K G   +
Sbjct: 65  FTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTGS--V 119

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +   A
Sbjct: 120 CGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEVRDKA 175

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           + L+    + A   G+I+ D+K+EFG+D+K  + L DE+ TPDSSR+W  + YE     G
Sbjct: 176 VRLYTEAAEYAKSRGIIICDTKFEFGLDEKGTLTLMDEVLTPDSSRFWPADQYEV----G 231

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 232 TNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 280


>gi|227496886|ref|ZP_03927149.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces urogenitalis DSM 15434]
 gi|226833620|gb|EEH66003.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces urogenitalis DSM 15434]
          Length = 305

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 94/302 (31%), Positives = 157/302 (51%), Gaps = 33/302 (10%)

Query: 10  PELPNYY---SGKVRENYFLSDG-------TRITIATDRLSAFDQNIAC-IPYKGEVLNQ 58
           P LP +    SGKVR+ Y  +D          + +A+DR+SA+D  ++  +P KG+VL  
Sbjct: 12  PALPGWQHLSSGKVRDVYVPADNGPWAGKDVLLVVASDRISAYDYILSTPVPDKGKVLTA 71

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTF 113
           ++ +WF   +DI  NH +    P  + G     Q+L+M+P+E + RGYL G    S L  
Sbjct: 72  LSAWWFEQLADIIPNHLVSLEVPEQVAGRAMICQRLEMYPVECVARGYLTG----SGLAE 127

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
           Y+ G   +    LP+ +++  +LP PV TP  K+       D+ +S   +    ++  + 
Sbjct: 128 YRAGG-AVCGVPLPEGLTEASRLPEPVFTPAVKAE--LGDHDENVSFERVAE--MVGESA 182

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
             ++    L L+     +A E G+IL D+K+E G D    ++L DE+ TPDSSR+W  + 
Sbjct: 183 ASSLREVTLRLYSAAADIARERGIILADTKFELGRDASGQMVLGDEVLTPDSSRFWPADE 242

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKI 289
           +       +TP   DK F+R+W+    + +        P +P+++I RT   Y+ AYE++
Sbjct: 243 WVPG---QVTP-SFDKQFVRDWLTGPDSGWDRSSGQQPPALPDDVIERTRARYLEAYERL 298

Query: 290 TG 291
           TG
Sbjct: 299 TG 300


>gi|293399518|ref|ZP_06643671.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae F62]
 gi|291610087|gb|EFF39209.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae F62]
          Length = 330

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + I
Sbjct: 49  LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAHI 108

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH                  +   +V ++L    +E IVRGYLAG   +    + K G
Sbjct: 109 MPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 165

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 166 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 219

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+D+K  + L DE+ TPDSSR+W  + YE  
Sbjct: 220 RDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEKGTLTLMDEVLTPDSSRFWPADQYEV- 278

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 279 ---GTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 328


>gi|115352723|ref|YP_774562.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria AMMD]
 gi|170697610|ref|ZP_02888699.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria IOP40-10]
 gi|115282711|gb|ABI88228.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria AMMD]
 gi|170137497|gb|EDT05736.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria IOP40-10]
          Length = 296

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 155/305 (50%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH T D P+  V            +V ++L+   IE +VRGYLAG  
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRGVVVKRLEPIMIEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +  +G   +    LP+ + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 119 -SGWKEYQASGA--VCGVQLPEGLQNAQKLPEPIFTPAAKAELGEH--DENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+ T+        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLETQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|171322045|ref|ZP_02910920.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria MEX-5]
 gi|171092648|gb|EDT37948.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria MEX-5]
          Length = 296

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 155/305 (50%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESKLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH T D P+  V            +V ++L+   IE +VRGYLAG  
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRGVVVKRLEPIMIEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +  +G   +    LP+ + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 119 -SGWKEYQASGA--VCGVQLPEGLQNAQKLPEPIFTPAAKAELGEH--DENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+ T+        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLETQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|315442647|ref|YP_004075526.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium sp. Spyr1]
 gi|315260950|gb|ADT97691.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium sp. Spyr1]
          Length = 297

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 154/302 (50%), Gaps = 32/302 (10%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           P L +Y    SGKVRE Y + DG  + +ATDR+SA+D  +   IP KG VL  ++ ++F 
Sbjct: 3   PALSDYQHVASGKVRELYHVDDGHLLFVATDRISAYDHILESQIPDKGRVLTAMSVFFFG 62

Query: 66  HTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH    PD            LV +QL M P+E + RGYL G   + L+ + K 
Sbjct: 63  LLD--SPNHLAGPPDDERIPEEVLGRALVVRQLDMLPVEAVARGYLTG---SGLIDYQKT 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP  + +  +   P+ TP TK+       D  I+ ++++   ++   + E 
Sbjct: 118 GT--VCGIPLPSGLVEASRFDEPLFTPATKAELGEH--DVNITYDDVVE--LIGAERAER 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L+++ +G   A   G+I+ D+K+EFGI     + LADE+ TPDSSRYW  + Y  
Sbjct: 172 LRERTLAVYRQGADHASTRGIIVADTKFEFGIGADGELALADEVFTPDSSRYWRADDYA- 230

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGL 292
              EG      DK F+RNW+    + +  N     P +P +I+  T   YI AYE+I+GL
Sbjct: 231 ---EGQVQNSFDKQFVRNWLTGPDSGWDRNGDQAPPPLPPDIVAATRARYIEAYERISGL 287

Query: 293 KF 294
           +F
Sbjct: 288 RF 289


>gi|221069907|ref|ZP_03546012.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Comamonas
           testosteroni KF-1]
 gi|220714930|gb|EED70298.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Comamonas
           testosteroni KF-1]
          Length = 305

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 98/307 (31%), Positives = 158/307 (51%), Gaps = 28/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L  + I  LP    GKVR+NY + D   + +A+DRLSAFD  +   IP KG +L Q+  +
Sbjct: 8   LHTSNIASLPLLARGKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGVLLTQMALF 67

Query: 63  WFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNTKTS 109
           WF     IC NH T + P+  V            ++ ++L+   IE +VRGYLAG    S
Sbjct: 68  WFDKLGHICPNHLTGEAPESVVKPEEVKQVEGRSMLVKRLKPVLIEAVVRGYLAG----S 123

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
               Y+   + +    LP  +++  KLP P+ TP  K+       D+ I+    +   ++
Sbjct: 124 GWKEYQE-SQSVCGVKLPAGLTNAAKLPEPIYTPAAKAE--MGDHDENITYERTVE--MV 178

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
                  I   A+ +++   ++AL  G+I+ D+K+EFG+ +   ++L DE+ TPDSSRYW
Sbjct: 179 GEQLAAQIRDTAIRIYKEAAEIALTKGMIIADTKFEFGLTEDGALVLMDEVLTPDSSRYW 238

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRTSQTYIA 284
            VE YE +  +G  P   DK F+R+W+       +    +   P +P+ +I RT+  Y  
Sbjct: 239 PVEGYEDALAKGENPPSYDKQFVRDWLEQAQVNGKAWDKKAPAPRLPKEVIDRTAAKYRE 298

Query: 285 AYEKITG 291
           A +++T 
Sbjct: 299 ALDRLTA 305


>gi|260942094|ref|XP_002615213.1| hypothetical protein CLUG_05228 [Clavispora lusitaniae ATCC 42720]
 gi|238851636|gb|EEQ41100.1| hypothetical protein CLUG_05228 [Clavispora lusitaniae ATCC 42720]
          Length = 305

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 91/305 (29%), Positives = 164/305 (53%), Gaps = 35/305 (11%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y +   T + +ATDR+SA+D  ++  IP KG++L +++++WF   S  
Sbjct: 12  LPLLARGKVRDIYEVDANTLLFVATDRISAYDVIMSNGIPGKGKILTKLSEFWFDFLSSE 71

Query: 71  CSNHTLDYPDPNV---------------------LVGQQLQMFPIELIVRGYLAGNTKTS 109
             NH L  P+ ++                     L+ +++++ P+E+IVRGY+ G    S
Sbjct: 72  VPNHLLLKPEEDLFSHLPAELSQPKYKEQLEGRSLLVKKMKLIPLEVIVRGYITG----S 127

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
               YK         +   N+ ++++   P+ TP+TK+ +     D+ ISP +     I+
Sbjct: 128 AWKEYKKSNTVHGMKVEQQNLQESEEFATPIFTPSTKAEQGEH--DENISPEQAAE--IV 183

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
            +   + +++ A+ L+ +  + A   G+I+ D+K+EFG+D   N++L DE+ TPDSSR+W
Sbjct: 184 GKELCDKVAAIAIRLYSKAKEYAKTRGIIIADTKFEFGLDANDNVVLVDEVLTPDSSRFW 243

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKI 289
              TYE     G      DK F+R+W+ +     +D +  + E+I+++T   Y+ A+E +
Sbjct: 244 NASTYEV----GRGQDSYDKQFLRDWLTSNNLNGKDGVA-MDESIVVQTKNKYVEAFEAL 298

Query: 290 TGLKF 294
           TG K+
Sbjct: 299 TGQKW 303


>gi|148827143|ref|YP_001291896.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae PittGG]
 gi|166229549|sp|A5UFF7|PUR7_HAEIG RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|148718385|gb|ABQ99512.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae PittGG]
          Length = 290

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 152/296 (51%), Gaps = 27/296 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           I  L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  
Sbjct: 7   ILSLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKL 66

Query: 68  SDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + I  NH               D      +V ++L    IE IVRGYL G   + L  + 
Sbjct: 67  AHIMPNHFTGDSVYDVLPKEEADLIRDRAVVCKRLNPIKIESIVRGYLTG---SGLKDYK 123

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           + G   I    LP+ + +  KLP  + TP++K  E     D  IS  E     ++  +  
Sbjct: 124 QTGT--ICGLKLPEGLVEASKLPEAIFTPSSK--EEVGNHDINISYAEC--EKLIGADLA 177

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY
Sbjct: 178 AQVKEKAIALYTVAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY 237

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           +     G  P   DK F+R+W+       +  +P +PENII +T   Y  A + +T
Sbjct: 238 QA----GTNPPSFDKQFVRDWLENSGWNKQAPVPKVPENIIQKTVDKYQEALDLLT 289


>gi|303256760|ref|ZP_07342774.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderiales bacterium 1_1_47]
 gi|302860251|gb|EFL83328.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Burkholderiales bacterium 1_1_47]
          Length = 297

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 93/298 (31%), Positives = 155/298 (52%), Gaps = 29/298 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           I  LP  Y GKVR++Y + D   + +A+DR+SAFD  +   IP KG++L  +T +WF   
Sbjct: 9   IKSLPLVYRGKVRDSYAVGDDKLLIVASDRISAFDVILGDPIPKKGKILTALTDFWFKEL 68

Query: 68  SDICSNHTLDYPDPN--------------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTF 113
             I  NH L   DP                +V ++L+   +E + RGYL+G+      T 
Sbjct: 69  DGIVPNH-LTGIDPESVVAPEERDQVKGRAVVAKRLKPILVECVARGYLSGSAWKEYQT- 126

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
                 +I    LP  +  ++KLP P+ TP  K+   A   D+ I+  +++ +     + 
Sbjct: 127 ----TGQICGVKLPAGLKQSEKLPEPIFTPAGKAE--AGHHDENITYEDVVKQ--YGEDT 178

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
              +  Y L+L+++  + A   G+I+ D+K+EFG+D    ++L DEI TPDSSR+W  + 
Sbjct: 179 ASKLRDYTLALYKKAAEYAASKGIIIADTKFEFGLDDNGTVVLMDEILTPDSSRFWPADE 238

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           Y    + G +    DK FIR+W+ ++    +   P IP++++ +TS  Y  A  ++TG
Sbjct: 239 Y----KVGQSEPSFDKQFIRDWLESQPWNKKAPAPKIPQDVLDKTSSKYEEALIRLTG 292


>gi|148825735|ref|YP_001290488.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae PittEE]
 gi|229847343|ref|ZP_04467445.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae 7P49H1]
 gi|319896790|ref|YP_004134984.1| phosphoribosylaminoimidazole-succinocarboxa mide synthase
           [Haemophilus influenzae F3031]
 gi|166229548|sp|A5UBF4|PUR7_HAEIE RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|89892440|gb|ABD79013.1| HI1726-like protein [Haemophilus influenzae]
 gi|148715895|gb|ABQ98105.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae PittEE]
 gi|229809768|gb|EEP45492.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae 7P49H1]
 gi|317432293|emb|CBY80646.1| phosphoribosylaminoimidazole-succinocarboxa mide synthase
           [Haemophilus influenzae F3031]
          Length = 290

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  + I
Sbjct: 10  LKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAHI 69

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH               D      +V ++L    IE IVRGYL G   + L  + + G
Sbjct: 70  MPNHFTGDSVYDVLPKEEADLIKDRAVVCKRLTPIKIESIVRGYLTG---SGLKDYKQTG 126

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP+N+ +  KLP  + TP++K  E     D  IS  E     ++  +    +
Sbjct: 127 T--ICGLKLPENLVEASKLPEAIFTPSSK--EEVGNHDINISYAEC--EKLIGSDLAAQV 180

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY+  
Sbjct: 181 KEKAIALYTEASEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQA- 239

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P +P+NII +T   Y  A + +T
Sbjct: 240 ---GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPKNIIQKTVDKYQEALDLLT 289


>gi|311740200|ref|ZP_07714032.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Corynebacterium pseudogenitalium ATCC 33035]
 gi|311304755|gb|EFQ80826.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Corynebacterium pseudogenitalium ATCC 33035]
          Length = 297

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 95/302 (31%), Positives = 159/302 (52%), Gaps = 32/302 (10%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFH 65
           PEL +Y    SGKVR+ Y + + T + + +DR+SA+D  +   IP KG VL   ++++F 
Sbjct: 3   PELSSYTHLASGKVRDIYDVDENTLLMVVSDRISAYDHALEPAIPDKGRVLTATSKFFFD 62

Query: 66  HTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH     D            +V ++L M P E + RG+L G   + L  +  N
Sbjct: 63  SID--FPNHLAGPLDDERIPAECLGRAMVVKKLDMLPFECVARGFLTG---SGLKEYKAN 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G     E  LP+ + +  +LP P+ TP TK+ +     D+ +S + ++ +  L   + E 
Sbjct: 118 GTVCGIE--LPEGLVEASRLPEPIFTPATKAEQGEH--DENVSFDFVVDK--LGAERAEE 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + +  L ++     LA E G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW  ++Y  
Sbjct: 172 LRAATLRIYSEAAALAEEKGIILADTKFEFGLDQDGTLVLADEVLTPDSSRYWPADSY-- 229

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGL 292
              EG      DK ++RNW+ +  + +        P +P++++  T   YI AYE+++G 
Sbjct: 230 --VEGEVQPSFDKQYVRNWLTSDASGWDQAADGTPPQLPDDVVSATRLRYIEAYERLSGE 287

Query: 293 KF 294
           +F
Sbjct: 288 RF 289


>gi|107023561|ref|YP_621888.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia AU 1054]
 gi|116690645|ref|YP_836268.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia HI2424]
 gi|170733989|ref|YP_001765936.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia MC0-3]
 gi|206561175|ref|YP_002231940.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia J2315]
 gi|254247335|ref|ZP_04940656.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Burkholderia cenocepacia PC184]
 gi|105893750|gb|ABF76915.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia AU 1054]
 gi|116648734|gb|ABK09375.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia HI2424]
 gi|124872111|gb|EAY63827.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Burkholderia cenocepacia PC184]
 gi|169817231|gb|ACA91814.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia cenocepacia MC0-3]
 gi|198037217|emb|CAR53138.1| 5'-phosphoribosyl-4-N-succinocarboxamide-5-amin o imidazole
           synthetase [Burkholderia cenocepacia J2315]
          Length = 296

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 153/305 (50%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVVMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH T D P+  V            +V ++L+   IE +VRGYLAG  
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRGVVVKRLEPIMIEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +  +G   +    LP  + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 119 -SGWKEYQASGA--VCGVQLPAGLQNAQKLPEPIFTPAAKAEMGEH--DENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + YE     G  P   DK F+R+W+  +        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQYEV----GTNPPSFDKQFVRDWLEAQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|254251529|ref|ZP_04944847.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Burkholderia dolosa AUO158]
 gi|124894138|gb|EAY68018.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Burkholderia dolosa AUO158]
          Length = 296

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 154/305 (50%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH T D P+  V            +V ++L+   IE +VRGYLAG  
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRAVVVKRLEPILIEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +  +G   +    LP  + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 119 -SGWKEYQASGA--VCGVQLPAGLQNAQKLPEPIFTPAAKAEMGEH--DENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+ T+        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLETQPWGKTAPAPALPADVVAKTAAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|283796003|ref|ZP_06345156.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium sp. M62/1]
 gi|291076648|gb|EFE14012.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Clostridium sp. M62/1]
 gi|295090908|emb|CBK77015.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Clostridium cf. saccharolyticum K10]
          Length = 289

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 162/303 (53%), Gaps = 35/303 (11%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSD 69
           E+     GKVRE Y   D + I +ATDR+S FD  +   +  KG VL Q++++WF  T D
Sbjct: 2   EMKPIKEGKVREIYDNGD-SLIMVATDRISCFDVILNNVVTKKGTVLTQMSKFWFDMTKD 60

Query: 70  ICSNHTL-----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH +     D P        D N ++ ++L M PIE IVRGY+ G   +   ++ K+
Sbjct: 61  ILPNHMISADVKDMPEFFQQPQFDGNSMMCRKLNMLPIECIVRGYITG---SGWASYQKD 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS-PNEIIHRGILTRNQWE 175
           G   +    LP+ + ++ KLP P+ TP+TK+       D+ IS    I H       + E
Sbjct: 118 GT--VCGIRLPEGLKESDKLPEPIYTPSTKAE--IGDHDENISYEQSIAHLEKYFPGKGE 173

Query: 176 TISS----YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEV 231
             ++    Y ++L+++    AL  G+I+ D+K+EFG+D+   I+L DE+ TPDSSR+W  
Sbjct: 174 EYAAKLRDYTIALYKKCADYALSRGIIIADTKFEFGLDENGTIVLGDEMLTPDSSRFWPA 233

Query: 232 ETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           + YE     G      DK F R+W+  + NP   N   +PE+++ +T   Y+ +YE +TG
Sbjct: 234 DGYEP----GHGQPSFDKQFARDWL--KANP--GNNWTLPEDVVQKTIDKYLQSYEMLTG 285

Query: 292 LKF 294
            K 
Sbjct: 286 EKL 288


>gi|296166472|ref|ZP_06848904.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295898233|gb|EFG77807.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 295

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 108/303 (35%), Positives = 159/303 (52%), Gaps = 34/303 (11%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           P L +Y    SGKVRE Y + D   + +ATDR+SA+D  + + IP KG +L  ++ ++F 
Sbjct: 3   PALSDYRHLASGKVREIYRVDDEHLLLVATDRISAYDYVLDSTIPDKGRILTAMSVFFFG 62

Query: 66  HTSDICSNHTLDYPD-PNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
             +    NH    PD P +        LV ++L M P+E + RGYL G   + LL +   
Sbjct: 63  LVT--APNHLAGPPDDPRIPQEVLGRGLVVRRLDMLPVECVARGYLTG---SGLLDYQAT 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWE 175
           GK  +    LP  + +  K   P+ TP TK++      D+ IS + +I   G +  NQ  
Sbjct: 118 GK--VCGITLPPGLVEASKFSEPLFTPATKAA--LGDHDENISFDRVIELVGGVRANQ-- 171

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L ++ +    AL  G+I+ D+K+EFG D   N++LADEI TPDSSRYW  E Y 
Sbjct: 172 -LRDRTLQIYVQAADHALTRGIIIADTKFEFGTDAGGNLLLADEIFTPDSSRYWPAEDY- 229

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITG 291
              R G      DK F+RNW+    + +  +     P +P++II  T   YI AYE+I+G
Sbjct: 230 ---RVGEVQTSFDKQFVRNWLTGPESGWDRHGSQPPPPLPDHIIEATRDRYIDAYERISG 286

Query: 292 LKF 294
           L F
Sbjct: 287 LSF 289


>gi|167561721|ref|ZP_02354637.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia oklahomensis EO147]
 gi|167568957|ref|ZP_02361831.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia oklahomensis C6786]
          Length = 296

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 98/305 (32%), Positives = 148/305 (48%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFP-------------IELIVRGYLAGNT 106
             +WF   + I  NH        V+   +++                +E +VRGYLAG  
Sbjct: 61  ANFWFDKLAHIVPNHLTGVAPETVVAADEVEQVKGRGVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   GK  +    LP  +S+ QKLP P+ TP  K+       D+ IS  E   R
Sbjct: 119 -SGWKDYQATGK--VCGVELPAGLSNAQKLPEPIFTPAAKAEMGHH--DENISFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L+      A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELAATIRDISIKLYREAADYAATRGIIIADTKFEFGLDEHGKLFLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+  +        P +P+++I +TS  Y  A 
Sbjct: 232 RFWPADEYQV----GTNPPSFDKQFVRDWLEAQDWNKEPPAPKLPDDVIAKTSAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|73540262|ref|YP_294782.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           eutropha JMP134]
 gi|123625794|sp|Q475J5|PUR7_RALEJ RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|72117675|gb|AAZ59938.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           eutropha JMP134]
          Length = 302

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 155/308 (50%), Gaps = 34/308 (11%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L ++ I  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+  +
Sbjct: 5   LYQSSISSLPLLGHGKVRDNYAVGEDKLLIVTTDRLSAFDVIMGEPIPDKGRVLNQMANF 64

Query: 63  WFHHTSDICSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTS 109
           WF   + I  NH        V+             V ++L+   +E +VRGYLAG   + 
Sbjct: 65  WFRKLAHIVPNHETGVAAETVVAPAEVEQVKGRAVVVKRLKPILVEAVVRGYLAG---SG 121

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GI 168
              +   GK  +    LP  + + QKLP P+ TP  K+       D+ IS  E+  R GI
Sbjct: 122 WKDYQATGK--VCGIELPAGLQNAQKLPEPIFTPAAKAEMGEH--DENISFGEVEERIGI 177

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
               Q   IS   + L++   + A   G+I+ D+K+EFG+D+   + L DE+ T DSSR+
Sbjct: 178 ALARQMRDIS---IRLYKEAAEFAATRGIIIADTKFEFGLDENGTLTLMDEVLTADSSRF 234

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWI-LTRCN----PYRDNIPDIPENIILRTSQTYI 283
           W  ++Y+     G  P   DK F+R+W+   R +    P     P +P+++I +T+  Y 
Sbjct: 235 WPADSYQV----GTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPKLPDDVIEKTAAKYR 290

Query: 284 AAYEKITG 291
            A  ++TG
Sbjct: 291 EALTRLTG 298


>gi|167856336|ref|ZP_02479065.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Haemophilus parasuis 29755]
 gi|219871599|ref|YP_002475974.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus parasuis SH0165]
 gi|167852532|gb|EDS23817.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Haemophilus parasuis 29755]
 gi|219691803|gb|ACL33026.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus parasuis SH0165]
          Length = 285

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 104/293 (35%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF+  + I
Sbjct: 5   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAHI 64

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYL G   + L  + K G
Sbjct: 65  MPNHFTGDSVFDVLPRAEAEAIQHRAVVCKRLVPVKIESIVRGYLTG---SGLKDYQKTG 121

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  +       +
Sbjct: 122 T--ICGLALPEGLVEASKLPEPIFTPSSKAE--VGDHDINISYAECERQ--IGVELAAKV 175

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L++     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W VETY+  
Sbjct: 176 RDAAIALYKEAADYALTKGIIICDTKFEFGLDENGVLTLMDEVLTPDSSRFWSVETYQ-- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EG  P   DK FIR+W+       +   P +P ++I +T   Y  A E +T
Sbjct: 234 --EGSNPPSFDKQFIRDWLEQSGWNKQAPAPSVPADVIEKTVAKYQEALELLT 284


>gi|306836861|ref|ZP_07469818.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Corynebacterium accolens ATCC 49726]
 gi|304567268|gb|EFM42876.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Corynebacterium accolens ATCC 49726]
          Length = 301

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 93/300 (31%), Positives = 161/300 (53%), Gaps = 28/300 (9%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWF- 64
           PEL +Y    SGKVR+ Y + D T + + +DR+SA+D  +   IP KG VL   ++++F 
Sbjct: 7   PELSSYTHVASGKVRDIYDVDDNTLLMVVSDRISAYDFALEPAIPDKGRVLTATSKFFFD 66

Query: 65  ------HHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
                 H    +  +   +      +V ++L M P E + RG+L G   + L  +  +G 
Sbjct: 67  AIDFPNHLAGPLDDDRIPEECLGRAMVVKKLDMLPFECVARGFLTG---SGLKEYQADGT 123

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
               E  LP  + +  +LP P+ TP TK+ +     D+ +S   +  +  L R + E + 
Sbjct: 124 VCGIE--LPAGLVEASRLPEPIFTPATKAEQGDH--DENVSFAHVADK--LGRERAEELR 177

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
           +  L ++ +  +LA E G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW  ++Y    
Sbjct: 178 AATLRIYAKAAQLAEEKGIILADTKFEFGLDEDGTLVLADEVLTPDSSRYWPADSY---- 233

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGLKF 294
            EG      DK ++R+W+ +  + +  +     P +P++++  T   YI AYE+++G +F
Sbjct: 234 VEGEVQPSFDKQYVRDWLTSAASGWDKSSETTPPALPDDVVSATRLRYIEAYERLSGERF 293


>gi|229494146|ref|ZP_04387909.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodococcus erythropolis SK121]
 gi|229318508|gb|EEN84366.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodococcus erythropolis SK121]
          Length = 297

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 161/302 (53%), Gaps = 32/302 (10%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           P L +Y     GKVR+ Y + D   + +A+DR+SA+D  ++  IP KG VL  ++ ++F+
Sbjct: 3   PTLDSYTHLAGGKVRDLYTIDDEHLLLVASDRISAYDHVLSTPIPDKGRVLTAMSVFFFN 62

Query: 66  HTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                 +NH    PD +          LV + L M P+E +VRG+L G   + L+ +   
Sbjct: 63  VLG--GTNHLAGEPDDDRIPEEVLGRALVVRSLDMVPVECVVRGFLTG---SGLVDYNNT 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP+ + +  +LP P+ TP +K++      D+ IS ++++ +  + +     
Sbjct: 118 GA--VCGVALPEGLVEASRLPDPIFTPASKAA--LGDHDENISFDQVVEK--VGQKLAVQ 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L ++ R    A + G+IL D+K EFG+D   N++LADE+ TPDSSRYW +E YE 
Sbjct: 172 LREDTLDVYARASNFAADRGIILADTKLEFGLDSAGNLVLADEVLTPDSSRYWPLEGYEA 231

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGL 292
               G      DK F+R+W+ +  + +  +     P +P+ I+  T   YI AYE+I+GL
Sbjct: 232 ----GKVQPSFDKQFVRDWLTSPESGWDRSSDTTPPPLPQEIVDATRARYIEAYERISGL 287

Query: 293 KF 294
            F
Sbjct: 288 SF 289


>gi|315924115|ref|ZP_07920341.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315622517|gb|EFV02472.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 300

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 104/292 (35%), Positives = 161/292 (55%), Gaps = 35/292 (11%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRE Y + D + + +ATDR+SAFD  +   I  KG VL Q++++WF +T D+  NH +
Sbjct: 20  GKVREIYDIGD-SLVMVATDRISAFDVILKNKIVKKGTVLTQMSKFWFDYTKDVLPNHMI 78

Query: 77  -----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
                D P        D N ++ ++L M PIE IVRGY+ G+   S   + K+G   +  
Sbjct: 79  SVDVADMPAFFQNENFDGNSMLCKKLTMLPIECIVRGYITGSGWNS---YQKDGT--VCG 133

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII-----HRGILTRNQWETIS 178
             LP  + +  KL  P+ TP+TK+       D+ IS  + I     H     R   E + 
Sbjct: 134 IKLPGGLRECDKLSEPIYTPSTKAD--LGNHDENISFEQSIDVLEKHFPGKGRAYAEALR 191

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L+L+++    AL +G+I+ D+K+EFGID+  N+I+ DE+ TPDSSR+W +E YE   
Sbjct: 192 DNTLALYQKCADYALSHGIIIADTKFEFGIDETGNLIIGDEMLTPDSSRFWPLEGYE--- 248

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             G      DK F+R+W+  + NP  D+   +P+++I +T   Y  AY+ +T
Sbjct: 249 -SGKPQPSFDKQFVRDWL--KANP--DSDYSLPQDVINKTIAKYKEAYKLLT 295


>gi|269216462|ref|ZP_06160316.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Slackia
           exigua ATCC 700122]
 gi|269129991|gb|EEZ61073.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Slackia
           exigua ATCC 700122]
          Length = 290

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 155/293 (52%), Gaps = 32/293 (10%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVR+ Y L D   + +ATDR+SAFD  +   IPYKG+VL Q++ +WF     +  NH +
Sbjct: 12  GKVRDLYDLGD-RLLLVATDRISAFDYVLKDEIPYKGQVLTQLSCFWFELLDGVVENHLV 70

Query: 77  ---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
                          +Y     ++ ++ QMFPIE IVRGYL G   +    + K G    
Sbjct: 71  SSDVADLPEEFKPWSEYLRGRFMLVKKAQMFPIECIVRGYLTG---SGFKDYLKTGTVCG 127

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
            E  L   + ++ KLP  + TP+TK+       D+ IS +  +  GI+     +T+   +
Sbjct: 128 IE--LAGGLENSAKLPTTLYTPSTKAE--IGDHDENISYDRTV--GIVGEEAAQTLRDLS 181

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L ++E     A   G+I+ D+K+EFG      ++L DE+ TPDSSR+W V+ YE     G
Sbjct: 182 LKVYETAADHARACGIIIADTKFEFGT-VDGTVVLGDEVLTPDSSRFWSVDDYEV----G 236

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
                 DK F+RNW+    +   +  P +P++II +TS+ YI AYEK+TG  F
Sbjct: 237 REQPSFDKQFVRNWLNANWDRTGEP-PHLPQDIIEKTSEKYIQAYEKLTGRAF 288


>gi|260903923|ref|ZP_05912245.1| phosphoribosylamine--glycine ligase [Brevibacterium linens BL2]
          Length = 780

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 101/307 (32%), Positives = 156/307 (50%), Gaps = 34/307 (11%)

Query: 10  PELPNY---YSGKVRENYF---LSDGTR----ITIATDRLSAFDQNI-ACIPYKGEVLNQ 58
           PELP +   YSGKVR+ Y     +D       + +A+DR+SA+D  + + IP KG VL  
Sbjct: 488 PELPGWTHVYSGKVRDLYIPDTAADAASAEQLLMVASDRISAYDWVLDSEIPDKGRVLTG 547

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTF 113
           ++ +WF   SD+  NH +    P  + G     + L M PIE + RGYL G    S +  
Sbjct: 548 LSLWWFDQLSDVIGNHVISSDVPQAVAGRGLIVKNLSMLPIECVARGYLTG----SGMAD 603

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
           YK     +    LP  + +  +L   + TP TK+       D+ +S  +I     +    
Sbjct: 604 YK-ATGSVCGIQLPAGLIEADRLEPAIFTPATKAE--LGDHDENVSFAQITE--TIGAEA 658

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVET 233
            E      + +++R   +A E G+IL D+K+EFG      ++L DE+ TPDSSR+W+ E+
Sbjct: 659 AEQARDLTIEIYQRAEAIARERGIILADTKFEFGTLPDGTMVLGDEVLTPDSSRFWDAES 718

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKI 289
           YE     G      DK F+R+W LT+ + +  +     P +P  ++ +T   YI A+EK+
Sbjct: 719 YEA----GQAQASFDKQFVRDW-LTKESGWDKSSDTPPPALPAEVVEKTRARYIEAFEKL 773

Query: 290 TGLKFIA 296
           TG KF A
Sbjct: 774 TGQKFPA 780


>gi|296130790|ref|YP_003638040.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Cellulomonas flavigena DSM 20109]
 gi|296022605|gb|ADG75841.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Cellulomonas flavigena DSM 20109]
          Length = 318

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 94/308 (30%), Positives = 159/308 (51%), Gaps = 36/308 (11%)

Query: 7   AYIPELPNYYSGKVRENY---FLSDGTRI---------TIATDRLSAFDQNIA-CIPYKG 53
            ++P   + YSGKVR+ Y      +G  +          +A+DR+SA+D  ++  IP KG
Sbjct: 19  GHLPGWRHVYSGKVRDLYEPDASPEGVALRQRHGDVVLVVASDRVSAYDHVLSPGIPGKG 78

Query: 54  EVLNQITQYWFHHTSDICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKT 108
            VL Q++ +WF   +D+  NH +    P  + G     ++L MFP+E + RGYL G   +
Sbjct: 79  VVLTQLSLWWFEQLTDLVPNHVVSTDVPEAVAGRAMVCRRLDMFPVECVARGYLTG---S 135

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
            L  + +NG  ++    LP  + D  +LP P+ TP TK+       D+ +  + ++    
Sbjct: 136 GLAEYRENG--EVTGIALPTGLVDGSRLPEPIFTPATKA--ELGDHDENVRFSVVVD--T 189

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSR 227
           +     ET+    L+++ R   +A E G++L D+K EFG D     + L DE+ TPDSSR
Sbjct: 190 VGPETAETLRDLTLAVYARAEGVARERGVVLADTKLEFGTDPVTGAVTLGDEVLTPDSSR 249

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYI 283
           +W  + +E     G      DK F+R+W+ +  + +        P +P++++ RT   Y+
Sbjct: 250 FWPADAWEP----GHAQPSFDKQFVRDWLTSDASGWDRASDAPPPALPDDVVERTRARYL 305

Query: 284 AAYEKITG 291
            AYE++TG
Sbjct: 306 EAYERLTG 313


>gi|325577991|ref|ZP_08148185.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Haemophilus parainfluenzae ATCC 33392]
 gi|325160224|gb|EGC72352.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Haemophilus parainfluenzae ATCC 33392]
          Length = 289

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  + I
Sbjct: 9   LKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAHI 68

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH               D      +V ++L    IE IVRGYL G   + L  + + G
Sbjct: 69  MPNHFTGDSVYDVLPKEEADLVKDRAVVCKRLNPIKIESIVRGYLTG---SGLKDYKQTG 125

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP+ + +  KLP P+ TP++K  E     D  IS  E   + I      + +
Sbjct: 126 A--ICGLKLPEGLVEASKLPEPIFTPSSK--EEVGNHDINIS-YEQCEKAIGAELAAQ-V 179

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+    K AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY   
Sbjct: 180 REKAIALYTEAAKYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY--- 236

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            +EG  P   DK F+R+W+       +   P +P+ +I +T   Y  A + +T
Sbjct: 237 -KEGTNPPSFDKQFVRDWLEQSGWNKQPPAPKVPKEVIDKTVAKYQEALDLLT 288


>gi|241766802|ref|ZP_04764626.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax delafieldii 2AN]
 gi|241362801|gb|EER58566.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax delafieldii 2AN]
          Length = 307

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 161/307 (52%), Gaps = 28/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L  + +  LP    GKVR+NY + D   + +A+DRLSAFD  +   IP KG +L Q+  +
Sbjct: 9   LHTSTLTSLPLLARGKVRDNYAVGDDRILMVASDRLSAFDVIMGEPIPGKGALLTQMALF 68

Query: 63  WFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNTKTS 109
           WF     IC NH T   P+  V            ++ Q+LQ  P+E +VRGYLAG    S
Sbjct: 69  WFDKLGHICPNHLTGQAPESVVSPAEVEQVRGRSMLVQRLQPIPVEAVVRGYLAG----S 124

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
               Y+   + +    LP  +++  +LP P+ TP  K++  A   D+ I+    +   ++
Sbjct: 125 GWKEYQE-SQSVCGVPLPAGLTNAARLPEPIYTPAAKAA--AGEHDENITFERTVE--MI 179

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
            R+    I   ++++++    +AL  G+I+ D+K+EFG+     ++L DE+ TPDSSRYW
Sbjct: 180 GRDLATKIRDLSIAIYKAAAAIALTKGMIIADTKFEFGLAPDGTLVLMDEVLTPDSSRYW 239

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWI---LTRCNPYRDNIPD--IPENIILRTSQTYIA 284
            VE Y ++   G  P   DK F+R+W+        P+    P   +P+++I +T+  Y  
Sbjct: 240 PVEGYAQALARGENPPSYDKQFVRDWLEQAKVNGKPWDKTAPAPRLPQDVIEKTAAKYRE 299

Query: 285 AYEKITG 291
           A E++T 
Sbjct: 300 ALERLTA 306


>gi|226304522|ref|YP_002764480.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodococcus erythropolis PR4]
 gi|259546912|sp|C0ZRJ1|PUR7_RHOE4 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226183637|dbj|BAH31741.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodococcus erythropolis PR4]
          Length = 297

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 161/302 (53%), Gaps = 32/302 (10%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           P L +Y     GKVR+ Y + D   + +A+DR+SA+D  ++  IP KG VL  ++ ++F+
Sbjct: 3   PTLDSYTHLAGGKVRDLYTIDDEHLLLVASDRISAYDHVLSTPIPDKGRVLTAMSVFFFN 62

Query: 66  HTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                 +NH    PD +          LV + L M P+E +VRG+L G   + L+ +   
Sbjct: 63  VLG--GTNHLAGEPDDDRIPEEVLGRALVVRSLDMVPVECVVRGFLTG---SGLVDYNNT 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP+ + +  +LP P+ TP +K++      D+ IS ++++ +  + +     
Sbjct: 118 GA--VCGVALPEGLVEASRLPDPIFTPASKAA--LGDHDENISFDQVVEK--VGQKLAVQ 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L ++ R    A + G+IL D+K EFG+D   N++LADE+ TPDSSRYW +E YE 
Sbjct: 172 LREDTLDVYARASNFAADRGIILADTKLEFGLDSGGNLVLADEVLTPDSSRYWPLEGYEA 231

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGL 292
               G      DK F+R+W+ +  + +  +     P +P+ I+  T   YI AYE+I+GL
Sbjct: 232 ----GKVQPSFDKQFVRDWLTSPESGWDRSSDTTPPPLPQEIVDATRARYIEAYERISGL 287

Query: 293 KF 294
            F
Sbjct: 288 SF 289


>gi|237745646|ref|ZP_04576126.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oxalobacter formigenes HOxBLS]
 gi|229376997|gb|EEO27088.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oxalobacter formigenes HOxBLS]
          Length = 292

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 154/306 (50%), Gaps = 29/306 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L +  I  LP  + GKVR+ Y + D   + + TDRLSAFD  +   IP KG +L  +
Sbjct: 1   MPGLMETTIKSLPFLHRGKVRDIYAVGDDKMLVVQTDRLSAFDVVMEDPIPNKGRILTAM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVG--------------QQLQMFPIELIVRGYLAGN 105
           + +WF     +  NH  D  DP  LV               ++ +  PIE IVRGY+ G 
Sbjct: 61  SNFWFKKFGHLMPNHMTDI-DPESLVAPEERDQVRGRAIVVKKFRPLPIEAIVRGYIIG- 118

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
             T    + K G   I    LP  + + QKLP  + TP+TK++      DQ IS  ++  
Sbjct: 119 --TGWKDYQKTGA--ICGIKLPAGLKEAQKLPEVIFTPSTKAA--VGEHDQNISFEKM-- 170

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
           + I+  +  E +   A++L+      A   G+++ D+K+EFG+D++  + L DEI TPDS
Sbjct: 171 KEIVGADIAEKVRDLAITLYREAADFAATKGILIADTKFEFGVDEEGKVYLIDEILTPDS 230

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W   +Y      GI+P   DK ++R+W+  +    +   P +PE +  +T++ Y  A
Sbjct: 231 SRFWPAASYAV----GISPPSFDKQYVRDWLEAQPWDKKAPAPRLPEEVAQKTTEKYNEA 286

Query: 286 YEKITG 291
              +T 
Sbjct: 287 LRLLTA 292


>gi|320009591|gb|ADW04441.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces flavogriseus ATCC 33331]
          Length = 308

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 98/304 (32%), Positives = 155/304 (50%), Gaps = 31/304 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLTHLHTGKVRDLYRNEAGDLVMVASDRISAYDWVLPTEIPDKGRVLTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           + +  NH L    P           L+ + L+M  +E + RGYLAG    S L  Y +  
Sbjct: 73  AGLVPNHVLSAELPAGAPADWAGRTLICRSLRMVQVECVARGYLAG----SGLAEY-DAD 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP+ + D  +LP P+ TP TK++      D+ +S  E+     +       + 
Sbjct: 128 RTVCGIGLPEGLVDGSELPGPIFTPATKAA--VGDHDENVSYEEVARE--VGPETAALLR 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGI----DKKQNIILADEIHTPDSSRYWEVETY 234
              L ++ R   +A E G+IL D+K+EFG     D  + +ILADE+ TPDSSR+W  E +
Sbjct: 184 RTTLDVYSRARDIARERGIILADTKFEFGFAPTEDGGEELILADEVLTPDSSRFWPAEIW 243

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKIT 290
           E     G      DK F+R+W+ +  + +        P +P+ I+  T   Y+ AYE +T
Sbjct: 244 EP----GKAQPSYDKQFVRDWLTSPASGWDRHGEQPPPPLPQAIVDATRAKYLEAYELLT 299

Query: 291 GLKF 294
           GL +
Sbjct: 300 GLNW 303


>gi|257069459|ref|YP_003155714.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Brachybacterium faecium DSM 4810]
 gi|256560277|gb|ACU86124.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Brachybacterium faecium DSM 4810]
          Length = 304

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/306 (32%), Positives = 160/306 (52%), Gaps = 34/306 (11%)

Query: 10  PELPNY---YSGKVRENYFLSDGTR------ITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           P+LP +    SGKVRE Y  +          + +ATDR+SA+D ++   IP KG +L  I
Sbjct: 12  PQLPGWDHVVSGKVRELYVPAGVAPSRAEEVLVVATDRISAYDHSLQPGIPDKGRLLTGI 71

Query: 60  TQYWFHHTSDICSNHTLDYPD-PNVLVGQQLQ-----MFPIELIVRGYLAGNTKTSLLTF 113
           +++WF    D+  +H L   + P  + G+ L+     M P+E I RG+L G    S L  
Sbjct: 72  SRFWFAQLEDLVPHHVLSAEEVPEAVSGRALRCRGLDMVPLECIARGHLTG----SGLAD 127

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQ 173
           Y+ G   +  ++LP  + +  +L   + TP+TK+       D+ I+  +   R +L    
Sbjct: 128 YRAGG-SVGGHVLPAGLVEASRLEPAIFTPSTKAGPGEH--DENITVAQA--RELLGEEL 182

Query: 174 WETISSYALSLFERGCKLALENGLILVDSKYEFGIDK-KQNIILADEIHTPDSSRYWEVE 232
              + S  L++FER  ++A E G+IL D+K EFG  +    ++L DE+ TPDSSR+W  +
Sbjct: 183 TGELESLTLAVFERARRIADERGIILADTKLEFGRSRLDGTLMLGDEVLTPDSSRFWSAD 242

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEK 288
            Y      G TP  LDK F+R+W+ +  + +        P +P  ++ +T   Y+ AYE+
Sbjct: 243 AYVP----GRTPPSLDKQFVRDWLTSAASGWHRGSDTAPPTLPAEVVEQTRARYVEAYER 298

Query: 289 ITGLKF 294
           +TG  F
Sbjct: 299 LTGESF 304


>gi|327306017|ref|XP_003237700.1| phosphoribosyl-aminoimidazole-succinocarboxamide synthase
           [Trichophyton rubrum CBS 118892]
 gi|326460698|gb|EGD86151.1| phosphoribosyl-aminoimidazole-succinocarboxamide synthase
           [Trichophyton rubrum CBS 118892]
          Length = 303

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 105/304 (34%), Positives = 166/304 (54%), Gaps = 37/304 (12%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFD---QNIACIPYKGEVLNQITQYWFHHTS 68
           LP    GKVR+ Y + D T + I+TDR+SA+D   QN   IP KG++L  +T YW    +
Sbjct: 14  LPLVSRGKVRDIYQVDDRTLLFISTDRISAYDVLMQN--GIPNKGQILTSLTVYWLKFLT 71

Query: 69  DICSN---HTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLT 112
               +   H +             DY     +V ++L++FP+E IVRGYLAG   ++   
Sbjct: 72  GALPSLRTHLVSLEMPGDMPQACRDYVKNRSMVVRKLKVFPVEAIVRGYLAG---SAWAE 128

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLPY-PVITPTTKSSESASGCDQPISPNEIIHRGILTR 171
           + K G   ++   LP  + ++ K+P  P+ TP+TK+ +   G D+ I P++     I+  
Sbjct: 129 YQKTGT--VHGIPLPAGLVESDKIPGGPLFTPSTKAEQG--GHDENIHPDKAAD--IVGA 182

Query: 172 NQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWE 230
              E I + ++ L+E     AL+ G+I+ D+K+EFG D+  N I+L DE+ TPDSSR+W 
Sbjct: 183 AYAEDIKAVSIRLYELASFHALQRGIIIADTKFEFGHDEVTNEIVLIDEVLTPDSSRFWA 242

Query: 231 VETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           ++TY+     G T    DK F+R+W+       +D    +P+ I+ +T   YI A+E+IT
Sbjct: 243 LDTYQP----GKTQDSFDKQFLRDWLTKEGLRGKDGTI-MPKEIVAKTEAKYIEAFERIT 297

Query: 291 GLKF 294
           G  F
Sbjct: 298 GETF 301


>gi|167585579|ref|ZP_02377967.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ubonensis Bu]
          Length = 296

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 155/305 (50%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH T D P+  V            +V ++L+   IE +VRGYLAG  
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRGVVVKRLEPILIEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    + ++G   +    LP+ + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 119 -SGWKEYQESGA--VCGVKLPEGLQNAQKLPEPIFTPAAKAEMGEH--DENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+  +        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLEAQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|227824255|ref|ZP_03989087.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226904754|gb|EEH90672.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 289

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 103/308 (33%), Positives = 165/308 (53%), Gaps = 41/308 (13%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           + E   + SGKVRE Y + D + I +A+DR+SAFD  +   I  KG VL +++++WF  T
Sbjct: 1   MQEYKPFKSGKVREIYDIGD-SLIMVASDRISAFDHILKNTITDKGAVLTRLSKFWFEFT 59

Query: 68  SDICSNHTL-----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
            D+  NH L     D P+           +  Q+L M P+E IVRGY+ G+   S   + 
Sbjct: 60  KDVIPNHMLSVDPADMPEFFRTPEFAGKSMKCQKLDMIPVECIVRGYITGSGWES---YQ 116

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH--------R 166
           KNG   +    LP  + ++QKL  P+ TP+TK+       D+ IS  + +         +
Sbjct: 117 KNGT--VCGITLPAGLKESQKLAEPIFTPSTKAE--LGDHDENISEAQCVEYLEKRFPGK 172

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
           G       + I    ++L+++    A   G+I+ D+K+EFG+D+   I+L DE+ TPDSS
Sbjct: 173 GA---EYTKAIKEATIALYKKCADYAYTKGIIIADTKFEFGLDENGQIVLGDEMLTPDSS 229

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W +  YE     G +    DK ++R+W+  + NP  + +  +P+++I +T + Y  AY
Sbjct: 230 RFWPLAGYEV----GKSQPSYDKQYVRDWL--KANPDSNYL--LPQDVIDKTIEKYKEAY 281

Query: 287 EKITGLKF 294
           EKITG  F
Sbjct: 282 EKITGETF 289


>gi|297193447|ref|ZP_06910845.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces pristinaespiralis ATCC 25486]
 gi|197718278|gb|EDY62186.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces pristinaespiralis ATCC 25486]
          Length = 299

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 94/301 (31%), Positives = 157/301 (52%), Gaps = 30/301 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRDLYQNEAGDLVMVASDRMSAYDWVLPTEIPDKGRVLTQLSLWWFERL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
            D+  NH +    P           +V + L+M P+E + RGYL G    S L  Y+   
Sbjct: 73  EDLIGNHVISTELPPGAPADWAGRTMVCKSLRMVPVECVARGYLTG----SGLAEYRE-S 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETI 177
           R +    LP+ +SD  +LP P+ TP TK++      D+ +S  E+  + G  T      +
Sbjct: 128 RTVCGLALPEGLSDGSELPAPIFTPATKAAVGEH--DENVSYEEVARQVGAETAAH---L 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A + G+IL D+K+EFG D    +++ADE+ TPDSSR+W       S
Sbjct: 183 RQSTLAVYSRARDIARDRGIILADTKFEFGFD-GDALVIADEVLTPDSSRFWPA----AS 237

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLK 293
           ++ G      DK ++R+W+ +  + +        P +P+ ++  T   Y+ AYE +TG  
Sbjct: 238 WQPGRAQPSYDKQYVRDWLTSPESGWDRKSEQPPPALPQEVVDATRAKYVEAYELLTGAT 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|186475230|ref|YP_001856700.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia phymatum STM815]
 gi|184191689|gb|ACC69654.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia phymatum STM815]
          Length = 296

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 97/308 (31%), Positives = 155/308 (50%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPDKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNH-------TLDYPDP------NVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH       T+  PD         +V ++L+   +E +VRGYLAG  
Sbjct: 61  ANFWFDKLKHVVPNHLTGVAPETVVAPDEAEQVKGRAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   G   +    LP+ + + QKLP P+ TP  K+       D+ I+  E+  R
Sbjct: 119 -SGWKDYQATGA--VCGVQLPEGLQNAQKLPEPIFTPAAKAE--MGHHDENITYEEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D+   + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDQNGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+ T+        P +P+ ++ +T++ Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDEVVTKTAEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGQKL 295


>gi|147669403|ref|YP_001214221.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dehalococcoides sp. BAV1]
 gi|146270351|gb|ABQ17343.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dehalococcoides sp. BAV1]
          Length = 304

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 102/317 (32%), Positives = 174/317 (54%), Gaps = 40/317 (12%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           +++L +  +P LP++  GKVR+ Y L D   I +A+DR+SAFD  + + I  KG VLN+I
Sbjct: 4   IKVLMETALP-LPSFIKGKVRDTYLLGDKLLI-VASDRISAFDVILPSGISGKGRVLNRI 61

Query: 60  TQYWFHHTSDICSNHTLDYPD-----------------PNVLVGQQLQM-----FPIELI 97
           + +WF  T+ I  NH ++  +                 P  L+G+ + +       +E +
Sbjct: 62  SSFWFEKTAHIIPNHVIELVENTSCLDKYLPAAERFKYPEYLIGRSMVVKKVNRVSVECV 121

Query: 98  VRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQP 157
           VRGY+AG+  +    + K G   +    +P  +  +Q+LP P+ TPTTK        D+P
Sbjct: 122 VRGYIAGSAWSE---YKKLGT--VNGVSMPKGLQQSQELPEPIFTPTTKGDGEH---DRP 173

Query: 158 ISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILA 217
           +S  E+   G++ ++  + ++  +L L++ G + A   G+I+ D+K+EFG+D  + +IL 
Sbjct: 174 MSIAEL--EGMVGKDLADKLARKSLELYKFGREYARNRGIIIADTKFEFGLDGTE-LILI 230

Query: 218 DEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILR 277
           DE  TPDSSR+W+    EK+++ G      DK  +R+++ T         P +P+ +I  
Sbjct: 231 DEALTPDSSRFWD----EKTYKVGEAQDSYDKQPVRDYLETISWNKEPPGPVLPDEVIKS 286

Query: 278 TSQTYIAAYEKITGLKF 294
           T++ Y  AYE+ITGLK 
Sbjct: 287 TTRRYEYAYERITGLKL 303


>gi|59800779|ref|YP_207491.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae FA 1090]
 gi|268596380|ref|ZP_06130547.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae FA19]
 gi|268681648|ref|ZP_06148510.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID332]
 gi|59717674|gb|AAW89079.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Neisseria gonorrhoeae FA 1090]
 gi|268550168|gb|EEZ45187.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae FA19]
 gi|268621932|gb|EEZ54332.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID332]
          Length = 319

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + I
Sbjct: 38  LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAHI 97

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH                  +   +V ++L    +E IVRGYLAG   +    + K G
Sbjct: 98  MPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 154

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 155 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 208

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + YE  
Sbjct: 209 RDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQYEV- 267

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 268 ---GTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 317


>gi|239906841|ref|YP_002953582.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio magneticus RS-1]
 gi|239796707|dbj|BAH75696.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Desulfovibrio magneticus RS-1]
          Length = 297

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 167/310 (53%), Gaps = 30/310 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  +++  I   P    GKVR+ Y LS  + + + TDR+SA+D  +   IP KG +LNQI
Sbjct: 1   MHAVTETDIKAYPLRSRGKVRDIYDLSPDSLLLVTTDRISAYDVIMPDPIPLKGVILNQI 60

Query: 60  TQYWFHHTSDICSNHTL-----DYPDP----------NVLVGQQLQMFPIELIVRGYLAG 104
           T +W     D+  NH +     D+P P            +V ++ +  PIE IVRG++ G
Sbjct: 61  TLFWMDMFKDMVPNHLIASDVADFPAPLAPHAADLAGRSVVAKKAKPLPIECIVRGFITG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
              + L  +   G   +  + LP  + ++Q LP P+ TP+TK+   A   D+ I+ +   
Sbjct: 121 ---SGLKDYQATGS--VCGHALPAGLVESQILPVPIFTPSTKADLGAH--DENITLDT-- 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
            + +L    +  + + +L+++ +    A E G+I+ D+K+EFG+   + +IL DE+ TPD
Sbjct: 172 AKEMLGSALFAKVEATSLAMYAKARDYARERGIIIADTKFEFGLIDGE-LILIDEVLTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  E Y      G +    DK ++R+W+++     +   P++P+++I +T + Y+A
Sbjct: 231 SSRFWPAEGYAA----GKSQPSYDKQYLRDWLVSIGFNKQPPAPNLPQDVIAKTQEKYLA 286

Query: 285 AYEKITGLKF 294
           AYE +TG K 
Sbjct: 287 AYELLTGKKL 296


>gi|240080229|ref|ZP_04724772.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae FA19]
 gi|240123022|ref|ZP_04735978.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           gonorrhoeae PID332]
          Length = 287

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  + A IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDAPIPGKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH                  +   +V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGDTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 123 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + YE  
Sbjct: 177 RDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQYEV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 236 ---GTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIRKTVEKYQEALTLLT 285


>gi|301170478|emb|CBW30085.1| phosphoribosylaminoimidazole-succinocarboxa mide synthase
           [Haemophilus influenzae 10810]
          Length = 290

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 151/296 (51%), Gaps = 27/296 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           I  L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  
Sbjct: 7   ILSLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKL 66

Query: 68  SDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + I  NH               D      +V ++L    IE IVRGYL G   + L  + 
Sbjct: 67  AHIMPNHFTGDSVYDVLPKEEADLIRDRAVVCKRLNPIKIESIVRGYLTG---SGLKDYK 123

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           + G   I    LP+ + +  KLP  + TP++K  E     D  IS  E     ++  +  
Sbjct: 124 QTGT--ICGLKLPEGLVEASKLPEAIFTPSSK--EEVGNHDINISYAEC--EKLIGADLA 177

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY
Sbjct: 178 AQVKEKAIALYTEASEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY 237

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           +     G  P   DK F+R+W+       +   P +PENII +T   Y  A + +T
Sbjct: 238 QA----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPENIIQKTVDKYQEALDLLT 289


>gi|302505056|ref|XP_003014749.1| hypothetical protein ARB_07311 [Arthroderma benhamiae CBS 112371]
 gi|291178055|gb|EFE33846.1| hypothetical protein ARB_07311 [Arthroderma benhamiae CBS 112371]
          Length = 310

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 107/309 (34%), Positives = 167/309 (54%), Gaps = 40/309 (12%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFD---QNIACIPYKGEVLNQITQYWFHHTS 68
           LP    GKVR+ Y + D T + I+TDR+SA+D   QN   IP KG++L  +T YW    +
Sbjct: 14  LPLVSRGKVRDIYQVDDRTLLFISTDRISAYDVLMQN--GIPNKGQILTSLTVYWLKFLT 71

Query: 69  DICSN---HTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLT 112
               +   H +             DY     +V ++L++FP+E IVRGYLAG+  T    
Sbjct: 72  GALPSLRTHLVSLEMPGDMPQACRDYVKNRSMVVRKLKVFPVEAIVRGYLAGSAWTE--- 128

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLPY-PVITPTTKSSESASGCDQPISPNEIIHRG---- 167
           + K G   ++   LP  + ++ K+P  P+ TP+TK+ +   G D+ I P++ I  G    
Sbjct: 129 YQKTGT--VHGIPLPAGLVESDKIPGGPLFTPSTKAEQG--GHDENIHPDKDILTGEVAA 184

Query: 168 -ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDS 225
            I+     E I + ++ L+E     AL+ G+I+ D+K+EFG D+  N I+L DE+ TPDS
Sbjct: 185 DIVGAAYAEDIKAVSIRLYELASFHALQRGIIIADTKFEFGHDEVTNEIVLIDEVLTPDS 244

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W ++TY+     G      DK F+R+W+       +D    +P+ I+ +T   YI A
Sbjct: 245 SRFWALDTYQP----GKPQDSFDKQFLRDWLTKEGLRGKDGTI-MPKEIVQKTEAKYIEA 299

Query: 286 YEKITGLKF 294
           +E+ITG  F
Sbjct: 300 FERITGETF 308


>gi|170996|gb|AAA34396.1| N-succinyl-5-aminoimidazole-4-carboxamide ribotide synthetase
           [Saccharomyces cerevisiae]
          Length = 306

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 104/310 (33%), Positives = 166/310 (53%), Gaps = 44/310 (14%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y +  GT + +ATDR+SA+D  +   IP KG +L +++++WF   S+ 
Sbjct: 12  LPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSND 71

Query: 71  CSNHTLDYP-----------------------DPNVLVGQQLQMFPIELIVRGYLAGNTK 107
             NH +D                         D ++LV +  ++ P+E+IVRGY+ G   
Sbjct: 72  VRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKH-KLIPLEVIVRGYITG--- 127

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH-- 165
           ++   + K G   ++    P  + ++Q+ P P+ TP+TK+ +     D+ ISP +     
Sbjct: 128 SAWKEYVKTGT--VHGLKQPQGLKESQEFPEPIFTPSTKAEQGEH--DENISPAQAAELV 183

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPD 224
            G L+R     ++  A+ L+ +    A E G+I+ D+K+EFGID+K N IIL DE+ TPD
Sbjct: 184 GGDLSRR----VAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPD 239

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W   +Y    + G +    DK F+R+W LT       N   +P++I+ RT   YI 
Sbjct: 240 SSRFWNGASY----KVGESQDSYDKQFLRDW-LTANKLNGVNGVKMPQDIVDRTRAKYIE 294

Query: 285 AYEKITGLKF 294
           AYE +TG K+
Sbjct: 295 AYETLTGSKW 304


>gi|50417214|ref|XP_457641.1| DEHA2B15862p [Debaryomyces hansenii CBS767]
 gi|49653306|emb|CAG85655.1| DEHA2B15862p [Debaryomyces hansenii]
          Length = 308

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 97/307 (31%), Positives = 163/307 (53%), Gaps = 37/307 (12%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y + D T + +ATDR+SA+D  +   I  KG++L +I+++WF   S  
Sbjct: 13  LPLVCKGKVRDIYQVDDETLLFVATDRVSAYDVIMENGISSKGKILTRISEFWFEFLSSS 72

Query: 71  CSNHTL---------------DYPDPN--------VLVGQQLQMFPIELIVRGYLAGNTK 107
             NH +                  +P          L+ ++L++ P+E+IVRGY+ G   
Sbjct: 73  IPNHLVLSNNDDEHLFARLPAKLSEPKYKQQISGRSLLVRKLKLIPLEVIVRGYITG--- 129

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
            S    YKN K      +  D++ ++Q+   P+ TP+TK+ +     D+ ISP +     
Sbjct: 130 -SAWKEYKNKKTVHGLSIDQDDLQESQEFTKPIFTPSTKAEQGEH--DENISPEKAAE-- 184

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
           I+ +   + + + A+ L+ +  + A   G+I+ D+K+EFG+DK  NI+L DE+ TPDSSR
Sbjct: 185 IVGQELCDKLEAKAIELYSKAKEYAKSRGIIIADTKFEFGLDKDNNIVLVDEVLTPDSSR 244

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W    Y+     G +    DK F+R+W+       +  +  + ENII+++ + YI AYE
Sbjct: 245 FWNAANYQI----GKSQDSYDKQFLRDWLTANGLAGKFGVA-MDENIIVKSKEKYIEAYE 299

Query: 288 KITGLKF 294
            +TG K+
Sbjct: 300 SLTGEKW 306


>gi|309972882|gb|ADO96083.1| Phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Haemophilus influenzae R2846]
          Length = 290

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 151/296 (51%), Gaps = 27/296 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           I  L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  
Sbjct: 7   ILSLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKL 66

Query: 68  SDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + I  NH               D      +V ++L    IE IVRGYL G   + L  + 
Sbjct: 67  AHIMPNHFTGESVYDVLPKEEADLIKDRAVVCKRLTPIKIESIVRGYLTG---SGLKDYK 123

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           + G   I    LP+ + +  KLP  + TP++K  E     D  IS  E     ++  +  
Sbjct: 124 QTGT--ICGLKLPEGLVEASKLPEAIFTPSSK--EEVGNHDINISYAEC--EKLIGADLA 177

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY
Sbjct: 178 AQVKEKAIALYTVAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY 237

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           +     G  P   DK F+R+W+       +   P +PENII +T   Y  A + +T
Sbjct: 238 QA----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPENIIQKTVDKYQEALDLLT 289


>gi|291548260|emb|CBL21368.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Ruminococcus sp. SR1/5]
          Length = 290

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/301 (34%), Positives = 162/301 (53%), Gaps = 33/301 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + EL     GKVRE Y   D + I +ATDR+S FD  +   +  KG VL Q++++WF  T
Sbjct: 1   MQELKPIKEGKVREIYDNGD-SLIMVATDRISCFDVILNNEVTKKGAVLTQMSKFWFDMT 59

Query: 68  SDICSNH-----TLDYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
            DI  NH     T D P+           ++ ++L M PIE IVRGY+ G   +   ++ 
Sbjct: 60  EDILPNHMISVDTKDMPEFFQQEKFEGKSMMCRKLNMLPIECIVRGYITG---SGWASYK 116

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSS----ESASGCDQPISPNEIIHRGILT 170
           +NG   +    LP+ + ++ KLP P+ TP+TK+     +     +Q I   E    G   
Sbjct: 117 ENGT--VCGIKLPEGLKESDKLPEPIYTPSTKAEIGDHDENISFEQSIDHLEKYFPG-KG 173

Query: 171 RNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWE 230
           R   E +    ++L+++  + AL  G+I+ D+K+EFG+D+  N+++ DE+ TPDSSR+W 
Sbjct: 174 REYAEKLRDNTIALYKKCAEYALSKGIIIADTKFEFGLDEDGNMVIGDEMLTPDSSRFWP 233

Query: 231 VETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            E YE     G      DK F R+W+  + NP  DN   +P+ I+ +T + Y+ AY+ +T
Sbjct: 234 AEGYEP----GHGQPSFDKQFARDWL--KANP--DNDWTLPQEIVDKTIEKYLQAYKMLT 285

Query: 291 G 291
           G
Sbjct: 286 G 286


>gi|145296591|ref|YP_001139412.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glutamicum R]
 gi|166229544|sp|A4QGZ4|PUR7_CORGB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|140846511|dbj|BAF55510.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 297

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 161/309 (52%), Gaps = 46/309 (14%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           PEL  Y    +GKVRE Y + D   + +A+DR+SA+D  +   IP KG VL  ++Q++F 
Sbjct: 3   PELSQYKHLSAGKVREIYEIDDKHILMVASDRISAYDFILDTEIPDKGRVLTAMSQFFFD 62

Query: 66  HTSDICSNHTLDYP--------DPNV--------LVGQQLQMFPIELIVRGYLAGNTKTS 109
                    T+D+P        DP +        +V ++L M P E +VRGYL G    S
Sbjct: 63  ---------TIDFPNHLAGPADDPRIPEEVLGRAMVCKKLNMLPFECVVRGYLTG----S 109

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
            L  YK     +    LP+ + ++ +LP P+ TP TK    A   D  I+ +  +    L
Sbjct: 110 GLVEYKQ-TSSVCGVELPEGLVESSQLPEPIFTPATK----ADIGDHDINVSFDVVEERL 164

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
              +   +   ++++++   ++A E G+IL D+K+EFGID+   ++L DE+ TPDSSRYW
Sbjct: 165 GEARANQLRDASIAIYKAAAEIARERGVILADTKFEFGIDEDGTLVLGDEVLTPDSSRYW 224

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAA 285
            +E YE     G      DK F+RNW+    + +  +     P +P +++  T + YI A
Sbjct: 225 PLEGYEA----GSVQPSFDKQFVRNWLTGPKSGWDKDSGLEPPALPGSVVEATRERYIEA 280

Query: 286 YEKITGLKF 294
           YE I+G KF
Sbjct: 281 YELISGQKF 289


>gi|227502108|ref|ZP_03932157.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium accolens ATCC 49725]
 gi|227077167|gb|EEI15130.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium accolens ATCC 49725]
          Length = 301

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 93/300 (31%), Positives = 160/300 (53%), Gaps = 28/300 (9%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWF- 64
           PEL +Y    SGKVR+ Y + D T + + +DR+SA+D  +   IP KG VL   ++++F 
Sbjct: 7   PELSSYTHVASGKVRDIYDVDDTTLLMVVSDRISAYDFALEPAIPDKGRVLTATSKFFFD 66

Query: 65  ------HHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
                 H    +      +      +V ++L M P E + RG+L G   + L  +  +G 
Sbjct: 67  AIDFPNHLAGPLDDERIPEECLGRAMVVKKLDMLPFECVARGFLTG---SGLKEYQADGT 123

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
               E  LP  + +  +LP P+ TP TK+ +     D+ +S   +  +  L R + E + 
Sbjct: 124 VCGIE--LPAGLVEASRLPEPIFTPATKAEQGDH--DENVSFAHVADK--LGRERAEELR 177

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
           +  L ++ +  +LA E G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW  ++Y    
Sbjct: 178 AATLRIYAKAAQLAEEKGIILADTKFEFGLDEDGTLVLADEVLTPDSSRYWPADSY---- 233

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGLKF 294
            EG      DK ++R+W+ +  + +  +     P +P++++  T   YI AYE+++G +F
Sbjct: 234 VEGEVQPSFDKQYVRDWLTSAASGWDKSSETTPPALPDDVVSATRLRYIEAYERLSGERF 293


>gi|254363232|ref|ZP_04979280.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Mannheimia
           haemolytica PHL213]
 gi|153095129|gb|EDN75676.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Mannheimia
           haemolytica PHL213]
          Length = 285

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + +   + +ATDRLSAFD  +   IP KGE+L QI+ +WF+  + I
Sbjct: 5   LKKIYSGKVRDLYEIDEKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAHI 64

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYL G   + L  + + G
Sbjct: 65  MPNHFTGDSVFDVLPQEEAEAIQHRAVVCKRLIPVKIESIVRGYLTG---SGLKDYQQTG 121

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  + +     +
Sbjct: 122 T--ICGLTLPEGLVEASKLPQPIFTPSSKAE--VGDHDINISYEECERQ--IGQELAAKV 175

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              AL L+      AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W VETY   
Sbjct: 176 RDAALKLYTEAANYALTKGIIICDTKFEFGLDENGELTLMDEVLTPDSSRFWSVETY--- 232

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            REG  P   DK F+R+W+       +   P IP  +I +T   Y  A + +T
Sbjct: 233 -REGTNPPSFDKQFVRDWLENSGWNKQPPAPKIPAEVIEKTVAKYQEALDLLT 284


>gi|145633658|ref|ZP_01789385.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae 3655]
 gi|229845257|ref|ZP_04465390.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae 6P18H1]
 gi|144985535|gb|EDJ92351.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae 3655]
 gi|229811852|gb|EEP47548.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae 6P18H1]
          Length = 290

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 151/296 (51%), Gaps = 27/296 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           I  L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  
Sbjct: 7   ILSLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKL 66

Query: 68  SDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + I  NH               D      +V ++L    IE IVRGYL G   + L  + 
Sbjct: 67  AHIMPNHFTGDSVYDVLPKEEADLIRDRAVVCKRLNPIKIESIVRGYLTG---SGLKDYK 123

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           + G   I    LP+ + +  KLP  + TP++K  E     D  IS  E     ++  +  
Sbjct: 124 QTGT--ICGLKLPEGLVEASKLPEAIFTPSSK--EEVGNHDINISYAEC--EKLIGADLA 177

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY
Sbjct: 178 AQVKEKAIALYTVAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY 237

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           +     G  P   DK F+R+W+       +   P +PENII +T   Y  A + +T
Sbjct: 238 QA----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPENIIQKTVDKYQEALDLLT 289


>gi|240949796|ref|ZP_04754128.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus minor NM305]
 gi|240295828|gb|EER46515.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus minor NM305]
          Length = 285

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   S I
Sbjct: 5   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFDKLSHI 64

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYL G   + L  + K G
Sbjct: 65  MPNHFTGDSVFDVLPKEEAEAIQYRAVVCKRLTPVKIESIVRGYLTG---SGLKDYQKTG 121

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP  + +  KLP P+ TP++K+       D  IS  E   +  +       +
Sbjct: 122 T--ICGLALPKGLVEASKLPEPIFTPSSKAE--VGDHDINISYAECERQ--IGAELAAKV 175

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L++     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY+  
Sbjct: 176 RDAAIALYKEAADYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQ-- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EG  P   DK FIR+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 234 --EGTNPPSFDKQFIRDWLENSGWNKQAPAPRVPADVIEKTVAKYQEALDLLT 284


>gi|158312067|ref|YP_001504575.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. EAN1pec]
 gi|158107472|gb|ABW09669.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. EAN1pec]
          Length = 354

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 157/300 (52%), Gaps = 31/300 (10%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           L +  SGKVRE + + D   + +A+DR+SAFD  +   IP KG VL  ++ +WF    D+
Sbjct: 62  LTHLGSGKVRELFAIGDDAVLLVASDRISAFDVVLPTEIPDKGAVLTGLSLWWFDQLGDL 121

Query: 71  CSNHTL-----DYPDPNVLVGQQLQ----------MFPIELIVRGYLAGNTKTSLLTFYK 115
             +H +     +YP       +QL+          M  IE + RGYL G   + L  + +
Sbjct: 122 VPSHVISSSVDEYPAELAPYAEQLRGRSMLCRRLDMVQIECVARGYLTG---SGLKDYRR 178

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQW 174
           +G   +  + LP  + D  +LP P+ TP+TK+       D+ IS ++   R G     + 
Sbjct: 179 SGT--VSGHPLPAGLEDGSRLPNPIYTPSTKAPIGEH--DENISRDDAAGRVGAELAAEL 234

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
           E ++   L +F R   LA E G++L D+K+EFG D    + LADE+ TPDSSR+W  + +
Sbjct: 235 ERLT---LQIFGRASDLAAERGILLADTKFEFGHDADGVLRLADEVLTPDSSRFWPADAW 291

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
                 G T    DK FIR+++++         P++P++I+  T   Y+ AYE++TG+ F
Sbjct: 292 TP----GGTQPSYDKQFIRDYLVSTGWDRNPPAPELPDDIVESTRARYVEAYERLTGISF 347


>gi|255715797|ref|XP_002554180.1| KLTH0E16082p [Lachancea thermotolerans]
 gi|238935562|emb|CAR23743.1| KLTH0E16082p [Lachancea thermotolerans]
          Length = 304

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 95/307 (30%), Positives = 162/307 (52%), Gaps = 38/307 (12%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y +   T + +ATDR+SA+D  +   IP KG +L +++++WF + SD 
Sbjct: 12  LPLLAKGKVRDIYEVDSKTLLFVATDRISAYDVIMKNTIPDKGVLLTKLSEFWFSYLSDD 71

Query: 71  CSNHTLDYPDPNVLVG----------------------QQLQMFPIELIVRGYLAGNTKT 108
             NH ++ P+   +                        Q+ ++ P+E+IVRGY+ G   +
Sbjct: 72  VRNHLVEIPENKTIFDLLPAQLSEPKYKSQLEGRCMLIQKFKLIPLEVIVRGYITG---S 128

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
           +   + K G   ++    P  + ++++ P P+ TP+TK+ +     D+ ISP +     +
Sbjct: 129 AWKEYKKTGT--VHGLEAPSGLQESEEFPTPIFTPSTKAEQGEH--DENISPAQ--AAAL 182

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSR 227
           + ++  + ++S A+ L+ +    A   G+I+ D+K+EFGID+  N IIL DE+ TPDSSR
Sbjct: 183 VGQDLCDRVASLAIKLYSKCKDYARTKGIIIADTKFEFGIDESTNEIILVDEVLTPDSSR 242

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W  + Y    + G      DK F+RNW+        D +  +PE+I+  T   Y+ AYE
Sbjct: 243 FWNGQNY----KIGQPQDSYDKQFLRNWLTANKLNGVDGV-SMPEDIVRNTRSKYVEAYE 297

Query: 288 KITGLKF 294
            +TG  F
Sbjct: 298 TLTGENF 304


>gi|113461507|ref|YP_719576.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus somnus 129PT]
 gi|112823550|gb|ABI25639.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus somnus 129PT]
          Length = 281

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 151/300 (50%), Gaps = 41/300 (13%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           +   YSGKVR+ Y + D   + +ATDRLSAFD  +   I  KGE+L QI+ +WF   + I
Sbjct: 1   MKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIDRKGEILTQISNFWFKKLAHI 60

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH               D+     +V ++L    IE IVRGYL G    S L  YK  
Sbjct: 61  MPNHFTGETVYDVLPQAEADWVKDRAVVCKRLTPIKIESIVRGYLTG----SGLKDYK-A 115

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSE-------SASGCDQPISPNEIIHRGILT 170
              I    LP+ + +  KLP P+ TP++K+         S + C+Q I        G+  
Sbjct: 116 TGTICGLKLPEGLVEASKLPEPIFTPSSKAKVGDHDINISYAECEQLI--------GVEL 167

Query: 171 RNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWE 230
             Q   +   A+SL++   + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W 
Sbjct: 168 AKQ---VREKAISLYKEAAEYALTKGIIICDTKFEFGLDENGVLTLMDEVLTPDSSRFWS 224

Query: 231 VETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           VETY+    EG  P   DK F+R+W+       +   P +P ++I +T   Y    + +T
Sbjct: 225 VETYQ----EGTNPPSFDKQFVRDWLEKSGWNKQAPAPKVPADVIQKTVDKYKEVLDLLT 280


>gi|145635420|ref|ZP_01791121.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae PittAA]
 gi|145267294|gb|EDK07297.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae PittAA]
          Length = 290

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 151/296 (51%), Gaps = 27/296 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           I  L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  
Sbjct: 7   ILSLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKL 66

Query: 68  SDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + I  NH               D      +V ++L    IE IVRGYL G   + L  + 
Sbjct: 67  AHIMPNHFTGDSVYDVLPKEEADLIRDRTVVCKRLNPIKIESIVRGYLTG---SGLKDYK 123

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           + G   I    LP+ + +  KLP  + TP++K  E     D  IS  E     ++  +  
Sbjct: 124 QTGT--ICGLKLPEGLVEASKLPEAIFTPSSK--EEVGNHDINISYAEC--EKLIGADLA 177

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY
Sbjct: 178 AQVKEKAIALYTVAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY 237

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           +     G  P   DK F+R+W+       +   P +PENII +T   Y  A + +T
Sbjct: 238 QA----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPENIIQKTVDKYQEALDLLT 289


>gi|291519031|emb|CBK74252.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Butyrivibrio fibrisolvens 16/4]
          Length = 288

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 104/293 (35%), Positives = 163/293 (55%), Gaps = 35/293 (11%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRE Y   D   I +ATDR+SAFD  +   I  KG VL Q++++WF  T DI  NH L
Sbjct: 7   GKVREVYDNGDSI-IMVATDRISAFDVILKNKIVNKGAVLTQMSKFWFDLTKDIVPNHML 65

Query: 77  -----DYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
                D P+           ++ ++L M PIE IVRGY+ G+   S   + +NG   +  
Sbjct: 66  STDVKDMPEFFQNDDYKGKSMMCKKLTMLPIECIVRGYITGSGWAS---YKENGT--VCG 120

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTRN-QWET-IS 178
             LP  + ++ KLP P+ TP+TK+       D+ IS     E++ +       ++ T + 
Sbjct: 121 IKLPAGLKESDKLPEPIYTPSTKAE--IGDHDENISFERSIEVLEKEFPGHGLEYATALR 178

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              ++L+++    AL  G+I+ D+K+EFG+D+  N++LADE+ TPDSSR+W +E YE   
Sbjct: 179 DNTIALYKKCADYALTKGIIIADTKFEFGLDEDGNVVLADEMLTPDSSRFWPLEGYEA-- 236

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
             G      DK F+R+W+  + NP  D +  +P+++I +T   Y+ AY+ +TG
Sbjct: 237 --GHGQPSFDKQFVRDWL--KANPDSDYL--LPQDVIDKTIDKYLEAYKLLTG 283


>gi|126437508|ref|YP_001073199.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium sp. JLS]
 gi|166230823|sp|A3Q6D1|PUR7_MYCSJ RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|126237308|gb|ABO00709.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium sp. JLS]
          Length = 297

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 100/302 (33%), Positives = 156/302 (51%), Gaps = 32/302 (10%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           P L +Y    SGKVRE Y + D   + +ATDR+SA+D  ++  IP KG +L  ++ ++F 
Sbjct: 3   PALSDYRHLASGKVRELYRIDDEHLLFVATDRISAYDHILSSEIPDKGRILTAMSVFFFD 62

Query: 66  HTSDICSNHTLDYPD-PNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH    PD P +        LV +QL+M P+E + RGYL G   + L+ + K 
Sbjct: 63  LID--APNHLAGPPDDPRIPEEVLGRALVVRQLEMLPVECVARGYLTG---SGLIDYRKT 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP  +++  K   P+ TP +K+       D+ I     +   ++   +   
Sbjct: 118 GT--LCGLTLPPGLTEASKFAEPLYTPASKAELGLH--DENIDFAATVD--LVGEKRAAQ 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L ++ +G   AL  G+I+ D+K+EFG+D+   ++LADE+ TPDSSRYW    Y  
Sbjct: 172 LRERTLQIYTQGADHALTKGIIIADTKFEFGVDQSGELVLADEVFTPDSSRYW----YAD 227

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGL 292
           ++REG      DK F+RNW+    + +        P +P  I+  T   YI AYE+I+GL
Sbjct: 228 AYREGQVQPSYDKQFVRNWLTGPESGWDRAADQPPPPLPAEIVDATRSRYIEAYERISGL 287

Query: 293 KF 294
            F
Sbjct: 288 SF 289


>gi|6319326|ref|NP_009409.1| Ade1p [Saccharomyces cerevisiae S288c]
 gi|308153480|sp|P27616|PUR7_YEAST RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|170999|gb|AAA34398.1| phosphoribosyl-amino-imidazolesuccinocarboxamide synthetase
           [Saccharomyces cerevisiae]
 gi|349755|gb|AAC04963.1| Ade1p: phosphoribosyl amino imidazolesuccinocarbozamide synthetase
           [Saccharomyces cerevisiae]
 gi|151941397|gb|EDN59768.1| SAICAR synthase [Saccharomyces cerevisiae YJM789]
 gi|190406647|gb|EDV09914.1| phosphoribosyl amino imidazolesuccinocarbozamide synthetase
           [Saccharomyces cerevisiae RM11-1a]
 gi|207347972|gb|EDZ73970.1| YAR015Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256270361|gb|EEU05566.1| Ade1p [Saccharomyces cerevisiae JAY291]
 gi|259144718|emb|CAY77659.1| Ade1p [Saccharomyces cerevisiae EC1118]
 gi|285810208|tpg|DAA06994.1| TPA: Ade1p [Saccharomyces cerevisiae S288c]
 gi|323334812|gb|EGA76184.1| Ade1p [Saccharomyces cerevisiae AWRI796]
 gi|323349909|gb|EGA84120.1| Ade1p [Saccharomyces cerevisiae Lalvin QA23]
 gi|323356341|gb|EGA88143.1| Ade1p [Saccharomyces cerevisiae VL3]
          Length = 306

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 165/308 (53%), Gaps = 40/308 (12%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y +  GT + +ATDR+SA+D  +   IP KG +L +++++WF   S+ 
Sbjct: 12  LPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSND 71

Query: 71  CSNHTLDYP-----------------------DPNVLVGQQLQMFPIELIVRGYLAGNTK 107
             NH +D                         D ++LV +  ++ P+E+IVRGY+ G   
Sbjct: 72  VRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKH-KLIPLEVIVRGYITG--- 127

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
           ++   + K G   ++    P  + ++Q+ P P+ TP+TK+ +     D+ ISP +     
Sbjct: 128 SAWKEYVKTGT--VHGLKQPQGLKESQEFPEPIFTPSTKAEQGEH--DENISPAQAAE-- 181

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSS 226
           ++  +    ++  A+ L+ +    A E G+I+ D+K+EFGID+K N IIL DE+ TPDSS
Sbjct: 182 LVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSS 241

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W   +Y    + G +    DK F+R+W LT       N   +P++I+ RT   YI AY
Sbjct: 242 RFWNGASY----KVGESQDSYDKQFLRDW-LTANKLNGVNGVKMPQDIVDRTRAKYIEAY 296

Query: 287 EKITGLKF 294
           E +TG K+
Sbjct: 297 ETLTGSKW 304


>gi|68250324|ref|YP_249436.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae 86-028NP]
 gi|68058523|gb|AAX88776.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae 86-028NP]
          Length = 306

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 151/296 (51%), Gaps = 27/296 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           I  L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  
Sbjct: 23  ILSLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKL 82

Query: 68  SDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + I  NH               D      +V ++L    IE IVRGYL G   + L  + 
Sbjct: 83  AHIMPNHFTGDSVYDVLPKEEADLIRNRTVVCKRLNPIKIESIVRGYLTG---SGLKDYK 139

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           + G   I    LP+ + +  KLP  + TP++K  E     D  IS  E     ++  +  
Sbjct: 140 QTGT--ICGLKLPEGLVEASKLPEAIFTPSSK--EEVGNHDINISYAEC--EKLIGADLA 193

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY
Sbjct: 194 AQVKEKAIALYTVAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY 253

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           +     G  P   DK F+R+W+       +   P +PENII +T   Y  A + +T
Sbjct: 254 QA----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPENIIQKTVDKYQEALDLLT 305


>gi|171464115|ref|YP_001798228.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171193653|gb|ACB44614.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 298

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 153/311 (49%), Gaps = 36/311 (11%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L    I  LP    GKVR+ Y L D   + I TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MAALYATSIKSLPLLSKGKVRDVYTLDDDKLLMITTDRLSAFDVVMGEPIPEKGVVLNQM 60

Query: 60  TQYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF+  + +  NH              +D      +V ++L+   +E +VRGYLAG+ 
Sbjct: 61  VNFWFNKLASVIPNHLTGIDPATVVVADEVDQVQGRAVVAKRLKPILVEAVVRGYLAGSG 120

Query: 107 KTSLLTFYKNGKR--KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
                  +K+ K   K+    LP  + + QKLP P+ TP  K+       D+ IS  +++
Sbjct: 121 -------WKDYKETGKVCGIALPAGLENAQKLPEPIFTPAAKAE--VGEHDESISFEKVV 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              ++       I   ++ L++   + A   G+I+ D+K+EFG+D    ++L DEI T D
Sbjct: 172 E--LIGEKLANQIREVSIRLYKEASEYATTRGIIIADTKFEFGLDANGQLVLMDEILTAD 229

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYR-----DNIPDIPENIILRTS 279
           SSR+W  ETY      G  P   DK F+R+W+ T     +        P +P ++I +T+
Sbjct: 230 SSRFWPAETY----YVGSNPPSYDKQFVRDWLETAMVDGKLWSKTAPAPQLPADVIEKTA 285

Query: 280 QTYIAAYEKIT 290
           Q Y  A  ++T
Sbjct: 286 QKYREALARLT 296


>gi|300932496|ref|ZP_07147752.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium resistens DSM 45100]
          Length = 297

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 98/302 (32%), Positives = 161/302 (53%), Gaps = 32/302 (10%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           PEL +Y    +GKVRE Y +   T + + TDR+SA+D  +   IP KG VL  ++ ++F 
Sbjct: 3   PELSDYEHISAGKVREIYEIDADTLLMVVTDRISAYDFVLDTEIPDKGRVLTAMSAFFFD 62

Query: 66  HTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           +      NH     D            +V ++L+M P E + RGYL G   + L  + + 
Sbjct: 63  NID--FPNHLAGPLDDERIPASVLGRAMVCKKLEMLPFECVARGYLTG---SGLKEYNET 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G     E  LP+ +++  +LP P+ TP TK+       D+ +S + ++    L  ++ + 
Sbjct: 118 GTVCGVE--LPEGLTEASRLPEPIFTPATKAE--VGDHDENVSFDVVVE--ALGEDRAKE 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L+++    ++A E G+IL D+K+EFG+D+   ++LADE+ TPDSSRYW  E YE 
Sbjct: 172 LRDATLAIYSLAAEMARERGVILADTKFEFGLDENGQLVLADEVLTPDSSRYWPAEEYE- 230

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPY--RDNI--PDIPENIILRTSQTYIAAYEKITGL 292
              EG      DK ++RNW+    + +  +D    P +P +++  T   Y+ AYEKI+G 
Sbjct: 231 ---EGKVQPSFDKQYVRNWLTGPKSGWDKKDGTPPPALPGSVVEATRARYVEAYEKISGK 287

Query: 293 KF 294
           +F
Sbjct: 288 RF 289


>gi|326319257|ref|YP_004236929.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323376093|gb|ADX48362.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 308

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 161/307 (52%), Gaps = 28/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L  + +  LP    GKVR+NY + D   + +A+DR+SAFD  +   IP KGE+L ++  +
Sbjct: 9   LHTSSLASLPLLARGKVRDNYAVGDDRILMVASDRISAFDVIMGEPIPGKGELLTKMALF 68

Query: 63  WFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNTKTS 109
           WF     +C NH T D P+  V            ++ Q+L+  P+E +VRGYLAG+    
Sbjct: 69  WFDKLGHLCPNHLTGDAPESVVSPEEAAQVRGRSMLVQRLRPIPVEAVVRGYLAGSGWKE 128

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
                    R +    LP+ +++  +LP P+ TP  K++      D+ I+    +   ++
Sbjct: 129 Y-----QASRAVCGVQLPEGLTNASRLPQPIYTPAAKAAVGEH--DENITFERTVE--MV 179

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
             +    I   +++L+E    +ALE G+I+ D+K+EFG+     ++L DE+ TPDSSRYW
Sbjct: 180 GIDLATKIRDTSIALYEAAAAIALEKGMIIADTKFEFGLAPDGTLVLMDEVLTPDSSRYW 239

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWI---LTRCNPYRDNIPD--IPENIILRTSQTYIA 284
            VE YE +   G  P   DK F+R+W+        P+  + P   +P  +I +T+  Y  
Sbjct: 240 PVEGYEAALDAGENPPSYDKQFVRDWLEQAQVNGAPWNKSAPAPRLPREVIEKTAAKYRE 299

Query: 285 AYEKITG 291
           A E++TG
Sbjct: 300 ALERLTG 306


>gi|261493523|ref|ZP_05990044.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Mannheimia
           haemolytica serotype A2 str. BOVINE]
 gi|261495968|ref|ZP_05992384.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261308374|gb|EEY09661.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261310819|gb|EEY12001.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Mannheimia
           haemolytica serotype A2 str. BOVINE]
          Length = 299

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + +   + +ATDRLSAFD  +   IP KGE+L QI+ +WF+  + I
Sbjct: 19  LKKIYSGKVRDLYEIDEKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFNKLAHI 78

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYL G   + L  + + G
Sbjct: 79  MPNHFTGDSVFDVLPQEEAEAIQHRAVVCKRLIPVKIESIVRGYLTG---SGLKDYQQTG 135

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  + +     +
Sbjct: 136 T--ICGLTLPEGLVEASKLPQPIFTPSSKAE--VGDHDINISYEECERQ--IGQELAAKV 189

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              AL L+      AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W VETY   
Sbjct: 190 RDAALKLYTEAANYALTKGIIICDTKFEFGLDENGELTLMDEVLTPDSSRFWSVETY--- 246

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            REG  P   DK F+R+W+       +   P +P  +I +T   Y  A + +T
Sbjct: 247 -REGTNPPSFDKQFVRDWLENSGWNKQPPAPKVPAEVIEKTVAKYQEALDLLT 298


>gi|284034540|ref|YP_003384471.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Kribbella
           flavida DSM 17836]
 gi|283813833|gb|ADB35672.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Kribbella
           flavida DSM 17836]
          Length = 291

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 97/307 (31%), Positives = 160/307 (52%), Gaps = 27/307 (8%)

Query: 1   MRILSKAY-IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQ 58
           M  L +A  IP   + +SGKVR+ Y L  G  + +A+DR+SAFD  ++  IP KG+VL  
Sbjct: 1   MTTLPQAVDIPGAKHLHSGKVRDLYELESGELLMVASDRISAFDWILSTPIPDKGKVLTA 60

Query: 59  ITQYWFHHTSDICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTF 113
           ++ +WF        NH      P  + G     ++L+MFP+E + RGYL+G   T LL +
Sbjct: 61  MSLWWFEQLD--VPNHIRSTDVPAEVAGRAVICEKLEMFPVECVARGYLSG---TGLLDY 115

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRN 172
              G+  +    LP  + +  +LP P+ TP TK+       D+ +S + ++   G+ T  
Sbjct: 116 DATGE--VCGIPLPSGLVEGSRLPEPIFTPATKADLGEH--DENVSYDAVVATVGVETAG 171

Query: 173 QWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVE 232
               +    L+++ +   +A ++G++L D+K+EFG      I+LADE+ TPDSSR+W   
Sbjct: 172 ---ALRDLTLAIYAKAHAMAEQHGIVLADTKFEFGARPDGTIVLADEVLTPDSSRFWPAA 228

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYR---DNIPDIPENIILRTSQTYIAAYEKI 289
            +    ++       DK  +R+W+       R   +  P + + +I RT   Y+ AYE++
Sbjct: 229 QWSPGRQQ----PSYDKQIVRDWLQFESGWDRASGEAPPPLSDEVIERTRSAYVDAYERL 284

Query: 290 TGLKFIA 296
           TG  F A
Sbjct: 285 TGRTFTA 291


>gi|157879484|pdb|1OBD|A Chain A, Saicar-Synthase Complexed With Atp
 gi|157879485|pdb|1OBG|A Chain A, Saicar-Synthase Complexed With Atp
          Length = 305

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 165/308 (53%), Gaps = 40/308 (12%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y +  GT + +ATDR+SA+D  +   IP KG +L +++++WF   S+ 
Sbjct: 11  LPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSND 70

Query: 71  CSNHTLDYP-----------------------DPNVLVGQQLQMFPIELIVRGYLAGNTK 107
             NH +D                         D ++LV +  ++ P+E+IVRGY+ G   
Sbjct: 71  VRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKH-KLIPLEVIVRGYITG--- 126

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
           ++   + K G   ++    P  + ++Q+ P P+ TP+TK+ +     D+ ISP +     
Sbjct: 127 SAWKEYVKTGT--VHGLKQPQGLKESQEFPEPIFTPSTKAEQGEH--DENISPAQAAE-- 180

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSS 226
           ++  +    ++  A+ L+ +    A E G+I+ D+K+EFGID+K N IIL DE+ TPDSS
Sbjct: 181 LVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSS 240

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W   +Y    + G +    DK F+R+W LT       N   +P++I+ RT   YI AY
Sbjct: 241 RFWNGASY----KVGESQDSYDKQFLRDW-LTANKLNGVNGVKMPQDIVDRTRAKYIEAY 295

Query: 287 EKITGLKF 294
           E +TG K+
Sbjct: 296 ETLTGSKW 303


>gi|313507122|pdb|1A48|A Chain A, Saicar Synthase
 gi|313507250|pdb|2CNQ|A Chain A, Atomic Resolution Structure Of Saicar-Synthase From
           Saccharomyces Cerevisiae Complexed With Adp, Aicar,
           Succinate
 gi|313507251|pdb|2CNU|A Chain A, Atomic Resolution Structure Of Saicar-Synthase From
           Saccharomyces Cerevisiae Complexed With Aspartic Acid
 gi|313507252|pdb|2CNV|A Chain A, Saicar-Synthase From Saccharomyces Cerevisiae Complexed
           Saicar
          Length = 306

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 165/308 (53%), Gaps = 40/308 (12%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y +  GT + +ATDR+SA+D  +   IP KG +L +++++WF   S+ 
Sbjct: 12  LPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSND 71

Query: 71  CSNHTLDYP-----------------------DPNVLVGQQLQMFPIELIVRGYLAGNTK 107
             NH +D                         D ++LV +  ++ P+E+IVRGY+ G   
Sbjct: 72  VRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKH-KLIPLEVIVRGYITG--- 127

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
           ++   + K G   ++    P  + ++Q+ P P+ TP+TK+ +     D+ ISP +     
Sbjct: 128 SAWKEYVKTGT--VHGLKQPQGLKESQEFPEPIFTPSTKAEQGEH--DENISPAQAAE-- 181

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSS 226
           ++  +    ++  A+ L+ +    A E G+I+ D+K+EFGID+K N IIL DE+ TPDSS
Sbjct: 182 LVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSS 241

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W   +Y    + G +    DK F+R+W LT       N   +P++I+ RT   YI AY
Sbjct: 242 RFWNGASY----KVGESQDSYDKQFLRDW-LTANKLNGVNGVKMPQDIVDRTRAKYIEAY 296

Query: 287 EKITGLKF 294
           E +TG K+
Sbjct: 297 ETLTGSKW 304


>gi|111021788|ref|YP_704760.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodococcus jostii RHA1]
 gi|123045855|sp|Q0S784|PUR7_RHOSR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|110821318|gb|ABG96602.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Rhodococcus jostii RHA1]
          Length = 294

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 157/303 (51%), Gaps = 34/303 (11%)

Query: 10  PELPNYY---SGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           P L +Y     GKVR+ Y + D   + +A+DR+SA+D  ++  IP KG VL  ++ ++F 
Sbjct: 3   PSLDSYAHLAGGKVRDLYTIDDEHLLLVASDRISAYDHVLSTPIPDKGRVLTAMSVFFFG 62

Query: 66  HTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                 +NH    PD +          LV ++L M P+E + RGYL G   + LL + + 
Sbjct: 63  VLG--GNNHLAGEPDDSRIPEEVLGRALVVRKLDMVPVECVARGYLTG---SGLLDYNET 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP+ + +  +LP P+ TP +K+       D+ IS   ++ +  + ++    
Sbjct: 118 GA--VCGVALPEGLVEASQLPDPIFTPASKAELGEH--DENISFEAVVEK--VGQDLAVK 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L ++ R    A + G+IL D+K EFG+D + N++LADE+ TPDSSRYW  + YE 
Sbjct: 172 LRDDTLDIYGRASNFAADRGIILADTKLEFGLDPQGNLVLADEVLTPDSSRYWPADGYEA 231

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI-----PDIPENIILRTSQTYIAAYEKITG 291
               G      DK F+RNW LT      D       P +P  I+  T + YI AYE+I+G
Sbjct: 232 ----GKVQPSFDKQFVRNW-LTGPESGWDRASDTPPPPLPAEIVEATRERYIEAYERISG 286

Query: 292 LKF 294
           L F
Sbjct: 287 LSF 289


>gi|257062787|ref|YP_003142459.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Slackia
           heliotrinireducens DSM 20476]
 gi|256790440|gb|ACV21110.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Slackia
           heliotrinireducens DSM 20476]
          Length = 290

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 154/293 (52%), Gaps = 32/293 (10%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVR+ Y L D   + +ATDR+SAFD  +   IP KG+VL QI+ +WF     +  NH +
Sbjct: 12  GKVRDLYDLGD-KLLLVATDRISAFDYILPDEIPCKGQVLTQISCFWFELLDGVVENHLI 70

Query: 77  ---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
                          +Y     ++  +  MFPIE IVRGYL G   +    + K G   +
Sbjct: 71  SADVADLPEQFKPWSEYLRGRFMLVNKANMFPIECIVRGYLTG---SGFKDYLKTGS--V 125

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYA 181
               LP+ + ++ KLP  + TP+TK+       D+ IS   ++   I+ +     +   +
Sbjct: 126 CGIQLPEGLQNSAKLPETLFTPSTKAE--IGDHDENISYERMVD--IIGQTDAAALRDLS 181

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           L ++      A E G+I+ D+K+EFG+   Q IIL DE+ TPDSSR+W  + YE     G
Sbjct: 182 LKVYTTAADHARERGIIIADTKFEFGVLNGQ-IILGDEVLTPDSSRFWSADDYEV----G 236

Query: 242 ITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
                 DK F+RNW+    +   ++ P +P+++I +TS+ YI AYEK+TG  F
Sbjct: 237 REQASFDKQFVRNWLNDNWDRTGES-PHLPQDVIEKTSEKYIQAYEKLTGRVF 288


>gi|25029043|ref|NP_739097.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium efficiens YS-314]
 gi|39931985|sp|Q8FML6|PUR7_COREF RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|23494330|dbj|BAC19297.1| phosphoribosylaminoimidazolesuccinocarboxyamide synthase
           [Corynebacterium efficiens YS-314]
          Length = 304

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 99/301 (32%), Positives = 160/301 (53%), Gaps = 30/301 (9%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           PEL  Y    +GKVRE Y + +   + +A+DR+SA+D  +   IP KG VL  ++Q++F 
Sbjct: 10  PELSQYKHLSAGKVREIYEIDEHHILMVASDRISAYDFILDTEIPDKGRVLTAMSQFFFD 69

Query: 66  HTSDICSNHTLDYPDPNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
              D  ++      DP +        +V ++L M P E +VRGYL G   + L  + + G
Sbjct: 70  AI-DFPNHLAGPIDDPRIPEEVLGRAMVCKKLAMMPFECVVRGYLTG---SGLEEYRQTG 125

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ + ++ +LP P+ TP TK    A   D  I+ +  +    L   +   +
Sbjct: 126 T--VCGITLPEGLVESSRLPEPIFTPATK----ADVGDHDINVSFDVVEERLGEARANQL 179

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              +++++ R  ++ALE G+IL D+K+EFG+D+   ++L DE+ TPDSSRYW  E YE  
Sbjct: 180 RDASIAIYSRAAEIALERGVILADTKFEFGLDENGELVLGDEVLTPDSSRYWPAEGYEA- 238

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGLK 293
              G      DK ++RNW+    + +  N     P +P +++  T + YI AYE I+G K
Sbjct: 239 ---GHVQPSFDKQYVRNWLTGPKSGWDKNSGVQPPALPGSVVEATRERYIEAYELISGNK 295

Query: 294 F 294
           F
Sbjct: 296 F 296


>gi|291302289|ref|YP_003513567.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stackebrandtia nassauensis DSM 44728]
 gi|290571509|gb|ADD44474.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Stackebrandtia nassauensis DSM 44728]
          Length = 278

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 150/287 (52%), Gaps = 23/287 (8%)

Query: 16  YSGKVRENYFLSDGTR-ITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSN 73
           +SGKVR+ Y  +DG   I +A+DR+S +D  +   +P KG +L  ++ +WF   +D   N
Sbjct: 5   HSGKVRDVY--ADGDELILVASDRVSVYDIVLPTPVPDKGRLLTALSLWWFDQLADAMPN 62

Query: 74  HTLDYPD-PNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLP 127
           H +   D P    G+     +L M P+E + RGYL G   + L  + ++G     E  LP
Sbjct: 63  HVISATDVPEEFAGRAVRCRRLDMVPVECVARGYLTG---SGLKEYQRDGTVSGLE--LP 117

Query: 128 DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFER 187
             + D  +LP P+ TP+TK+       D+P++  E+  +  L     + +    L ++ R
Sbjct: 118 PGLEDGSRLPEPIFTPSTKAPVGQH--DEPMTFGEVAAK--LDHPTAQRLRDITLDIYRR 173

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G  LA + G+I+ D+K E G D    ++LADE+ T DSSR+W  + ++     G      
Sbjct: 174 GRDLAAQRGIIVADTKIELGFDTDGELVLADEVLTMDSSRFWPADGWQP----GRPQPSF 229

Query: 248 DKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
           DK ++R+W  T         P+IP+ ++  T   YI AYE+ITGL +
Sbjct: 230 DKQYLRDWAATTGWDKTSPPPEIPDEVVAATRAKYIEAYERITGLTW 276


>gi|223041880|ref|ZP_03612066.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Actinobacillus minor 202]
 gi|223017302|gb|EEF15728.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Actinobacillus minor 202]
          Length = 285

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   S I
Sbjct: 5   LKKIYSGKVRDLYEIDDKLMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFDKLSHI 64

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYL G   + L  + K G
Sbjct: 65  MPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTG---SGLKDYQKTG 121

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP  + +  KLP P+ TP++K+       D  IS  E   +  +       +
Sbjct: 122 T--ICGLELPKGLVEASKLPEPIFTPSSKAE--VGDHDINISYAECERQ--IGAELAAKV 175

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L++     AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY+  
Sbjct: 176 RDAAIALYKEAADYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQ-- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EG  P   DK FIR+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 234 --EGTNPPSFDKQFIRDWLENSGWNKQAPAPRVPADVIEKTVAKYQEALDLLT 284


>gi|326442334|ref|ZP_08217068.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces clavuligerus ATCC 27064]
          Length = 300

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 92/300 (30%), Positives = 158/300 (52%), Gaps = 27/300 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  I +A+DR+SA+D  +   IP KG VL +++ +WF   
Sbjct: 13  VPGLLHLHTGKVRDLYRNEAGDLIMVASDRISAYDWVLPSEIPDKGRVLTRLSLWWFDRL 72

Query: 68  SDICSNHTL--DYPDP-------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  +H +  D PD          LV + L+M P+E + RGYL G    S L  Y    
Sbjct: 73  ADLVPHHVVSTDLPDGAPADWEGRTLVCRSLRMVPVECVARGYLTG----SGLVEYDE-S 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP+ +SD  +LP P+ TP TK++      D+ ++  E+  +  +       + 
Sbjct: 128 RTVCGITLPEGLSDGSELPAPIFTPATKAA--VGDHDENVTYEEVARQ--VGAETAAVLR 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L+++ R   +A + G+IL D+K+EFG  +   +++ADE+ TPDSSR+W       S+
Sbjct: 184 QTTLAVYGRARDIARDRGIILADTKFEFGHTEDGTLVIADEVLTPDSSRFWPA----ASW 239

Query: 239 REGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
           + G      DK ++R+W+ +  + +        P +P+ ++  T   Y+ AYE +TG  +
Sbjct: 240 QPGRPQPSYDKQYVRDWLTSPASGWDRRGEQPPPALPDEVVAATRAKYLEAYEMLTGTPW 299


>gi|259505966|ref|ZP_05748868.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium efficiens YS-314]
 gi|259166447|gb|EEW51001.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium efficiens YS-314]
          Length = 297

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 99/301 (32%), Positives = 160/301 (53%), Gaps = 30/301 (9%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           PEL  Y    +GKVRE Y + +   + +A+DR+SA+D  +   IP KG VL  ++Q++F 
Sbjct: 3   PELSQYKHLSAGKVREIYEIDEHHILMVASDRISAYDFILDTEIPDKGRVLTAMSQFFFD 62

Query: 66  HTSDICSNHTLDYPDPNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
              D  ++      DP +        +V ++L M P E +VRGYL G   + L  + + G
Sbjct: 63  AI-DFPNHLAGPIDDPRIPEEVLGRAMVCKKLAMMPFECVVRGYLTG---SGLEEYRQTG 118

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ + ++ +LP P+ TP TK    A   D  I+ +  +    L   +   +
Sbjct: 119 T--VCGITLPEGLVESSRLPEPIFTPATK----ADVGDHDINVSFDVVEERLGEARANQL 172

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              +++++ R  ++ALE G+IL D+K+EFG+D+   ++L DE+ TPDSSRYW  E YE  
Sbjct: 173 RDASIAIYSRAAEIALERGVILADTKFEFGLDENGELVLGDEVLTPDSSRYWPAEGYEA- 231

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGLK 293
              G      DK ++RNW+    + +  N     P +P +++  T + YI AYE I+G K
Sbjct: 232 ---GHVQPSFDKQYVRNWLTGPKSGWDKNSGVQPPALPGSVVEATRERYIEAYELISGNK 288

Query: 294 F 294
           F
Sbjct: 289 F 289


>gi|254468572|ref|ZP_05081978.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [beta
           proteobacterium KB13]
 gi|207087382|gb|EDZ64665.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [beta
           proteobacterium KB13]
          Length = 289

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 91/288 (31%), Positives = 157/288 (54%), Gaps = 27/288 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHT 67
           I  L  ++ GKVR+ Y + D   + + +DR+SAFD  +   +  KG+VL++++ +WFH T
Sbjct: 5   IQSLQLFHQGKVRDTYVVDDEHFLMVTSDRISAFDVIMNETVESKGKVLSRVSNFWFHKT 64

Query: 68  SDICSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
             I  NH  D    +V+             V ++LQ  P+E IVRGYL G   +    + 
Sbjct: 65  ESIIKNHLTDIAPESVVKDHEIPLIKDRSVVVKRLQPLPVEAIVRGYLIG---SGWKDYQ 121

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
            NG   +    LP N+   +KL  P+ TP+TK++      D+ IS +++ +  ++  ++ 
Sbjct: 122 SNGS--VSGITLPKNLQQAEKLAEPIFTPSTKAA--VGDHDENISFDQMAN--LIGEDRA 175

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
           + I   ++ ++      AL+ G+I+ D+K+EFG+D + ++IL DEI TPDSSR+W+ + Y
Sbjct: 176 KNIKDKSIEIYNFARDYALDRGIIIADTKFEFGLDDQGDLILMDEILTPDSSRFWDADLY 235

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTY 282
               + G +P   DK F+R+W+ +     +   P +P ++I  T Q Y
Sbjct: 236 ----KIGTSPQSYDKQFLRDWLESIDWNKQPPPPTLPSDVIEMTKQKY 279


>gi|146283124|ref|YP_001173277.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas stutzeri A1501]
 gi|145571329|gb|ABP80435.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Pseudomonas stutzeri A1501]
          Length = 291

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 92/294 (31%), Positives = 150/294 (51%), Gaps = 27/294 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +A  IP KG++L  I+ +WF     +
Sbjct: 11  LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILAEPIPEKGKILTAISNFWFDKLKGL 70

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH              L   +   +V ++L+   +E IVRGY+ G   +    + K+G
Sbjct: 71  IPNHFTGDKVEDVVPADELPLVEGRAVVAKRLKPVAVEAIVRGYIVG---SGWKEYQKSG 127

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP  + +  KLP P+ TP+TK++      D+ IS  +     I+ +     +
Sbjct: 128 T--VCGIQLPAGLKEAAKLPQPIFTPSTKAA--VGDHDENISFEQC--EAIIGKELAAQV 181

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              +++L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  ++YE  
Sbjct: 182 RDVSIALYSAAVEYAATRGIIIADTKFEFGLDENGTLTLMDEVLTPDSSRFWPADSYE-- 239

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
             EG  P   DK F+R+W+ +     +   P +P  +  RT+  Y  A  ++T 
Sbjct: 240 --EGKNPPSFDKQFVRDWLESTGWNKQPPAPAVPAEVAQRTADKYREALTRLTA 291


>gi|326471556|gb|EGD95565.1| argininosuccinate synthase [Trichophyton tonsurans CBS 112818]
          Length = 372

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 106/304 (34%), Positives = 165/304 (54%), Gaps = 37/304 (12%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFD---QNIACIPYKGEVLNQITQYWFHH-T 67
           LP    GKVR+ Y + D T + I+TDR+SA+D   QN   IP KG++L  +T YW    T
Sbjct: 83  LPLVSRGKVRDIYQVDDRTLLFISTDRISAYDVLMQN--GIPNKGQILTSLTVYWLKFLT 140

Query: 68  SDICSNHT---------------LDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLT 112
             + S  T                DY     +V ++L++FP+E IVRGYLAG+  T    
Sbjct: 141 GALPSLRTHLVSLEMPGDMPQACRDYVKNRSMVVRKLKVFPVEAIVRGYLAGSAWTE--- 197

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLP-YPVITPTTKSSESASGCDQPISPNEIIHRGILTR 171
           + K G   ++   LP  + ++ K+P  P+ TP+TK+ +   G D+ I P++     I+  
Sbjct: 198 YQKTG--TVHGIPLPAGLVESDKIPGGPLFTPSTKAEQ--GGHDENIHPDKAAD--IVGA 251

Query: 172 NQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWE 230
              E I + ++ L+E     AL+ G+I+ D+K+EFG D+  N I+L DE+ TPDSSR+W 
Sbjct: 252 AYAEDIKAVSIRLYELASFHALQRGIIIADTKFEFGHDEVTNEIVLIDEVLTPDSSRFWA 311

Query: 231 VETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           ++ Y+     G      DK F+R+W+       +D    +P++I+ +T   YI A+E+IT
Sbjct: 312 LDKYQP----GKPQDSFDKQFLRDWLTKEGLRGKDGTI-MPKDIVAKTEAKYIEAFERIT 366

Query: 291 GLKF 294
           G  F
Sbjct: 367 GETF 370


>gi|303251792|ref|ZP_07337963.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307246956|ref|ZP_07529021.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|307249093|ref|ZP_07531100.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|302649222|gb|EFL79407.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|306852241|gb|EFM84481.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306854381|gb|EFM86577.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
          Length = 285

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 5   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAHI 64

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYL G   + L  + + G
Sbjct: 65  MPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTG---SGLKDYKQTG 121

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  +       +
Sbjct: 122 T--ICGLKLPEGLVEASKLPQPIFTPSSKAE--VGNHDINISYEECERQ--IGAELAAKV 175

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY+  
Sbjct: 176 RDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQ-- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EG  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 234 --EGTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|297625618|ref|YP_003687381.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
 gi|296921383|emb|CBL55936.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Propionibacterium freudenreichii subsp. shermanii
           CIRM-BIA1]
          Length = 292

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 152/291 (52%), Gaps = 25/291 (8%)

Query: 12  LPNYYSGKVRENYFL--SDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTS 68
           LP  ++GKVRE + L       + +ATD +SAFD  + + IP KG VL Q++ +WF    
Sbjct: 11  LPLIHAGKVRELFDLPREPAHLLMVATDNISAFDYVLDSMIPDKGVVLTQLSLWWFKQLG 70

Query: 69  DICSNHTL--DYPDP---NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           DI  NH +  D PD      +V ++L M P+E + RGYL G   +    + + G   +  
Sbjct: 71  DIVDNHVVSTDVPDEVAGRAIVAEKLDMVPVECVARGYLTG---SGWAEYQETGS--VTG 125

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP  + D  +LP P+ TP TK+       D+ +S +++     +  +    I    L 
Sbjct: 126 IALPAGLHDGSRLPEPIFTPATKAPMGEH--DENVSFDQMSR--TVGYDTGAAIRDLTLR 181

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           L+ +  ++A E G++L D+K+EFG      ++L DE+ TPDSSR+W+ + YE    E   
Sbjct: 182 LYAKAEQIARERGIVLADTKFEFGRRPDGVLVLGDEVLTPDSSRFWDADAYEAGRLE--- 238

Query: 244 PIGLDKDFIRNWILTRCNPYR---DNIPDIPENIILRTSQTYIAAYEKITG 291
               DK ++R+W+       R   +  P +P+ I+  T + Y+ A+E++TG
Sbjct: 239 --SFDKQYLRDWLTHDSGWDRSSGERPPALPDAIVTATRERYLEAFERLTG 287


>gi|145637866|ref|ZP_01793512.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae PittHH]
 gi|145268936|gb|EDK08893.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae PittHH]
          Length = 290

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 150/296 (50%), Gaps = 27/296 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           I  L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF+  
Sbjct: 7   ILSLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPRKGEILTQISNFWFNKL 66

Query: 68  SDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + I  NH               D      +V + L    IE IVRGYL G   + L  + 
Sbjct: 67  AHIMPNHFTGDSVYDVLPKEEADLIKDRAVVCKLLTPIKIESIVRGYLTG---SGLKDYK 123

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           + G   I    LP+ + +  KLP  + TP++K  E     D  IS  E     ++  +  
Sbjct: 124 QTGT--ICGLKLPEGLVEASKLPEAIFTPSSK--EEVGNHDINISYAEC--EKLIGSDLA 177

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY
Sbjct: 178 AQVKEKAIALYTVAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY 237

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           +     G  P   DK F+R+W+       +   P +PENII +T   Y  A + +T
Sbjct: 238 QA----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPENIIQKTVDKYQEALDLLT 289


>gi|29830689|ref|NP_825323.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces avermitilis MA-4680]
 gi|39931881|sp|Q82FV6|PUR7_STRAW RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|29607801|dbj|BAC71858.1| putative phosphoribosylaminoimidazole- succinocarboxamide
           synthetase [Streptomyces avermitilis MA-4680]
          Length = 299

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 99/301 (32%), Positives = 158/301 (52%), Gaps = 30/301 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  + +A+DRLSAFD  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRDLYQNEAGDLVMVASDRLSAFDWVLPTEIPDKGRVLTQLSLWWFDRL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
            D+  NH L    P           L+ + L+M P+E + RGYL G    S L  Y N  
Sbjct: 73  VDLAPNHVLSTELPPGAPADWQGRTLICKSLKMEPVECVARGYLTG----SGLVEY-NET 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETI 177
           R +    LP+ + D  +LP P+ TP TK++      D+ +S  E+  + G  T  +   +
Sbjct: 128 RTVCGLALPEGLVDGSELPGPIFTPATKAAVGEH--DENVSYEEVARQVGAETAAK---L 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
               L+++ R   +A   G+IL D+K+EFG D    ++LADE+ TPDSSR+W  + +E  
Sbjct: 183 RQTTLAVYARARDIARRRGIILADTKFEFGFD-GDTLVLADEVLTPDSSRFWPADQWEP- 240

Query: 238 FREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLK 293
              G      DK F+R+W+ +  + +        P +P++++  T   Y+ AYE++TG  
Sbjct: 241 ---GRAQPSFDKQFVRDWLTSPESGWDRKSEQPPPPLPQHVVDATRAKYVEAYERLTGAN 297

Query: 294 F 294
           +
Sbjct: 298 W 298


>gi|84497661|ref|ZP_00996483.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Janibacter sp. HTCC2649]
 gi|84382549|gb|EAP98431.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Janibacter sp. HTCC2649]
          Length = 327

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 96/298 (32%), Positives = 154/298 (51%), Gaps = 25/298 (8%)

Query: 9   IPELPNYYSGKVRENYFLS--DGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFH 65
           +P   + YSGKVR+ Y     D   + +A+DR+SAFD  +   IP KG VL Q++ +WF 
Sbjct: 43  VPGFTHVYSGKVRDLYEPDGRDDQLLLVASDRISAFDFILDPPIPDKGAVLTQLSLWWFD 102

Query: 66  HTSDICSNHTLDYPDPNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
             +D+  NH +    P V+ G+     +L M P+E + R YL G     L  +  +G   
Sbjct: 103 QLADLVPNHVVSVDVPEVVAGRAVLVRKLDMVPVECVARAYLTGG---GLREYAADGT-- 157

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +    LP  + D  +   P+ TP+TK+       D+P++   +     +      T+   
Sbjct: 158 VSGLSLPGGLRDGDRFEAPLFTPSTKAPMGEH--DEPMTYEAV--EAEVGPELAATLRDL 213

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
              +  RG ++A E G+++ D+K EFGID    +ILADE+ TPDSSR+W  + +E     
Sbjct: 214 TTRILSRGNEIAGERGILIADTKVEFGIDGDGTLILADEVLTPDSSRFWPADQWEP---- 269

Query: 241 GITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
           G T    DK+F+R W+L+  + +     +  P +P  ++ RT   Y+ AYE++TG  F
Sbjct: 270 GHTQPSFDKEFVREWLLSPESGWDKSSGEAPPALPAEVVERTRAKYVEAYERLTGKTF 327


>gi|218283202|ref|ZP_03489272.1| hypothetical protein EUBIFOR_01860 [Eubacterium biforme DSM 3989]
 gi|218216020|gb|EEC89558.1| hypothetical protein EUBIFOR_01860 [Eubacterium biforme DSM 3989]
          Length = 289

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 105/302 (34%), Positives = 161/302 (53%), Gaps = 35/302 (11%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + EL     GKVRE Y   D   I +ATDR+S FD  +   +  KG VL Q++++WF +T
Sbjct: 1   MQELKPIKEGKVREIYDNGD-NLIMVATDRISCFDVILNNEVTKKGTVLTQMSKFWFDYT 59

Query: 68  SDICSNH-----TLDYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           SDI  NH     T D P+           ++ ++L M PIE IVRGY+ G+   S    Y
Sbjct: 60  SDILPNHMISVDTKDMPEYFQQEKFEGKSMLCRKLNMLPIECIVRGYITGSGWAS----Y 115

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII-----HRGIL 169
           K    K+    LP+ + ++Q+LP P+ TP+TK+       D+ IS  + I     H    
Sbjct: 116 KE-TGKVCGIELPEGLQESQQLPEPIYTPSTKAE--IGDHDENISFEQSIAHLEKHFPGH 172

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
                  I    ++L+++  + AL  G+I+ D+K+EFG+D+  NI++ DE+ TPDSSR+W
Sbjct: 173 GEEYATKIKDCTIALYKKCAEYALSKGIIIADTKFEFGLDENGNIVIGDEMLTPDSSRFW 232

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKI 289
             + YE     G +    DK F R+W+  + NP  D    +P+ I+ +T + Y+ AY  +
Sbjct: 233 PADGYEA----GHSQPSFDKQFARDWL--KANPGNDWT--LPQEIVDKTIEKYLQAYTML 284

Query: 290 TG 291
           TG
Sbjct: 285 TG 286


>gi|161523853|ref|YP_001578865.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans ATCC 17616]
 gi|189351386|ref|YP_001947014.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans ATCC 17616]
 gi|221200178|ref|ZP_03573221.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans CGD2M]
 gi|221206669|ref|ZP_03579681.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans CGD2]
 gi|221211357|ref|ZP_03584336.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans CGD1]
 gi|160341282|gb|ABX14368.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans ATCC 17616]
 gi|189335408|dbj|BAG44478.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans ATCC 17616]
 gi|221168718|gb|EEE01186.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans CGD1]
 gi|221173324|gb|EEE05759.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans CGD2]
 gi|221180417|gb|EEE12821.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia multivorans CGD2M]
          Length = 296

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 152/305 (49%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH T D P+  V            +V ++L+   IE +VRGYLAG  
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRAVVVKRLEPILIEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   G   +    LP  + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 119 -SGWKEYQATGA--VCGVQLPAGLQNAQKLPEPIFTPAAKAEMGEH--DENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+  +        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLEAQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|165977464|ref|YP_001653057.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|303250452|ref|ZP_07336649.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307251292|ref|ZP_07533212.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|307251493|ref|ZP_07533400.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|165877565|gb|ABY70613.1| phosphoribosylaminoimidazole succinocarboxamide(SAICAR) synthase
           [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|302650440|gb|EFL80599.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306856690|gb|EFM88826.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306860957|gb|EFM92963.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
          Length = 285

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 5   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAHI 64

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYL G   + L  + + G
Sbjct: 65  MPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTG---SGLKDYKQTG 121

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  +       +
Sbjct: 122 T--ICGLKLPEGLVEASKLPQPIFTPSSKAE--VGDHDINISYEECERQ--IGAELAAKV 175

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY+  
Sbjct: 176 RDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQ-- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EG  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 234 --EGTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|172061586|ref|YP_001809238.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria MC40-6]
 gi|171994103|gb|ACB65022.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia ambifaria MC40-6]
          Length = 296

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 153/305 (50%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH T D P+  V            +V ++L+   IE +VRGYLAG  
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEIEQVKGRGVVVKRLEPIMIEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +  +G   +    LP  + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 119 -SGWKEYQASGA--VCGVQLPAGLQNAQKLPEPIFTPAAKAELGEH--DENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+  +        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLEAQPWGKTAPAPALPADVVEKTAAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|50554603|ref|XP_504710.1| YALI0E33033p [Yarrowia lipolytica]
 gi|49650579|emb|CAG80314.1| YALI0E33033p [Yarrowia lipolytica]
          Length = 310

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 95/309 (30%), Positives = 163/309 (52%), Gaps = 42/309 (13%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y ++D   + +ATDR+SA+D  +   IP KG++L  I+++WF   +  
Sbjct: 15  LPLVARGKVRDLYAVNDNQLLFVATDRISAYDVIMTNGIPEKGKILTSISKFWFQLLAKE 74

Query: 71  CSNHTLDYPDPNVLVG----------------------QQLQMFPIELIVRGYLAGNTKT 108
             NH  +  +  +L                         + ++ PIE IVRGY+ G+  +
Sbjct: 75  IKNHVAESENSQILAALPKAVQDDPELVEMLKDRCLLVNKYKIVPIEAIVRGYITGSAWS 134

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS---PNEIIH 165
               + K+G   ++   +   + ++QKLP  + TP+TK+ +     D+ IS     EII 
Sbjct: 135 E---YKKSGT--VHGMSVESGLQESQKLPQAIYTPSTKAEQGEH--DENISVAKAAEIIG 187

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
                +N  + I   ++ L+ +  + A ++G+I+ D+K+EFGID+   ++L DE+ TPDS
Sbjct: 188 ----DKNLADEIEKLSVQLYTKAAEYADKHGIIIADTKFEFGIDENGKLVLVDEVLTPDS 243

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  +TYE     G      DK ++RNW+       ++++   PE ++++T + YI A
Sbjct: 244 SRFWNAKTYEV----GKPQDSYDKQYLRNWLTNSGLKGQEDVAMTPE-VVIKTREKYIEA 298

Query: 286 YEKITGLKF 294
           YE ITG K+
Sbjct: 299 YESITGCKW 307


>gi|225075234|ref|ZP_03718433.1| hypothetical protein NEIFLAOT_00234 [Neisseria flavescens
           NRL30031/H210]
 gi|224953409|gb|EEG34618.1| hypothetical protein NEIFLAOT_00234 [Neisseria flavescens
           NRL30031/H210]
          Length = 287

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH--------TLDYPDPNVL-----VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH         L   +  VL     V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGDTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 123 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y   
Sbjct: 177 RAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 -KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|108801523|ref|YP_641720.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium sp. MCS]
 gi|119870677|ref|YP_940629.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium sp. KMS]
 gi|123069639|sp|Q1B370|PUR7_MYCSS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|166230824|sp|A1ULY1|PUR7_MYCSK RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|108771942|gb|ABG10664.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium sp. MCS]
 gi|119696766|gb|ABL93839.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Mycobacterium sp. KMS]
          Length = 297

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 100/302 (33%), Positives = 155/302 (51%), Gaps = 32/302 (10%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           P L +Y    SGKVRE Y + D   + +ATDR+SA+D  ++  IP KG +L  ++ ++F 
Sbjct: 3   PALSDYRHLASGKVRELYRIDDEHLLFVATDRISAYDHILSSEIPDKGRILTAMSVFFFD 62

Query: 66  HTSDICSNHTLDYPD-PNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH    PD P +        LV +QL+M P+E + RGYL G   + L+ + K 
Sbjct: 63  LID--APNHLAGPPDDPRIPEEVLGRALVVRQLEMLPVECVARGYLTG---SGLIDYRKT 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP  +++  K   P+ TP +K+       D+ I     +   ++   +   
Sbjct: 118 GT--LCGLTLPPGLTEASKFAEPLYTPASKAELGLH--DENIDFAATVD--LVGEKRAAQ 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L ++ +G   AL  G+I+ D+K+EFG+D    ++LADE+ TPDSSRYW    Y  
Sbjct: 172 LRERTLQIYTQGADHALTKGIIIADTKFEFGVDPSGELVLADEVFTPDSSRYW----YAD 227

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGL 292
           ++REG      DK F+RNW+    + +        P +P  I+  T   YI AYE+I+GL
Sbjct: 228 AYREGQVQPSYDKQFVRNWLTGPESGWDRAADQPPPPLPAEIVDATRSRYIEAYERISGL 287

Query: 293 KF 294
            F
Sbjct: 288 SF 289


>gi|291612499|ref|YP_003522656.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sideroxydans lithotrophicus ES-1]
 gi|291582611|gb|ADE10269.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Sideroxydans lithotrophicus ES-1]
          Length = 294

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 100/307 (32%), Positives = 152/307 (49%), Gaps = 30/307 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQI 59
           M  L ++ +  L   + GKVR+ Y +     + + TDRLSAFD  +   IP KGEVL  +
Sbjct: 1   MSALHESNLTSLKFLHRGKVRDLYEVDADHLLIVQTDRLSAFDVILPTPIPGKGEVLTAV 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPN---------------VLVGQQLQMFPIELIVRGYLAG 104
           + +WF     I  NH L   DP                  V ++L+  PIE IVRGYL G
Sbjct: 61  SNFWFKKLGHIIPNH-LSGIDPESVVKTEAEKAQVRGRAFVTKKLKPLPIEAIVRGYLVG 119

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
              +    + K G   +    LP  + + QKLP P+ TP+TK++      D+ IS  E  
Sbjct: 120 ---SGWKDYKKTGA--VCGIQLPTGLQEAQKLPQPLFTPSTKAA--VGEHDENISFEEA- 171

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
            R +L  +  E + +  L+L+      AL  G+I+ D+K+EFG D    + L DE  TPD
Sbjct: 172 -RKLLGADMAEQVKNATLALYIEAADYALTKGIIIADTKFEFGTDAAGKLYLIDEALTPD 230

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W  + Y    + G  P   DK F+R+W+ +     +   P +P +++ +T++ Y  
Sbjct: 231 SSRFWPADQY----KVGSNPPSFDKQFVRDWLESSGWNKQPPAPQVPADVLHKTAEKYRE 286

Query: 285 AYEKITG 291
           A   +TG
Sbjct: 287 AQRLLTG 293


>gi|307331257|ref|ZP_07610380.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces violaceusniger Tu 4113]
 gi|306883069|gb|EFN14132.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces violaceusniger Tu 4113]
          Length = 306

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 92/306 (30%), Positives = 156/306 (50%), Gaps = 33/306 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG++L Q++ +WF   
Sbjct: 13  VPGLQHLHTGKVRDLYRNERGELVMVASDRISAYDWVLPTEIPEKGKILTQLSLWWFDLL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH L    P           LV + L+M P+E + RG+L G    S L  Y+   
Sbjct: 73  ADLVPNHVLSTELPPGAPADWEGRTLVCRSLRMVPVECVARGHLTG----SGLAEYRE-T 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP+ ++D  +LP P+ TP TK+       D+ ++  E+ HR  +       + 
Sbjct: 128 RTVCGIALPEGLTDGSELPSPIFTPATKAEVGEH--DENVAYEEVAHR--IGAEPAAQLR 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKK------QNIILADEIHTPDSSRYWEVE 232
              L++F R  ++A   G+IL D+K+EFG  +          +LADE+ TPDSSR+W  +
Sbjct: 184 QATLAIFNRAREIARARGIILADTKFEFGYAEATLGAEGAEPVLADEVLTPDSSRFWPAD 243

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEK 288
            ++     G      DK ++R+W+ +  + +        P +P  ++ RT   Y  AY  
Sbjct: 244 QWQP----GRAQPSFDKQYVRDWLTSPASGWDRTAEQPPPPLPAEVVERTRAKYAEAYGL 299

Query: 289 ITGLKF 294
           +TG ++
Sbjct: 300 LTGTRW 305


>gi|218767878|ref|YP_002342390.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis Z2491]
 gi|22001874|sp|Q9JV73|PUR7_NEIMA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|121051886|emb|CAM08192.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Neisseria meningitidis Z2491]
 gi|319410125|emb|CBY90461.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Neisseria meningitidis WUE 2594]
          Length = 287

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH--------TLDYPDPNVL-----VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH         L   +  VL     V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGQTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 123 S--VCGIRLPEGMQEAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + YE  
Sbjct: 177 RAKAVRLYTEAAEYAKSRGIIICDTKFEFGLDTNGTLTLMDEVLTPDSSRFWPADQYEV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 236 ---GTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|322515376|ref|ZP_08068370.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Actinobacillus ureae ATCC 25976]
 gi|322118603|gb|EFX90831.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Actinobacillus ureae ATCC 25976]
          Length = 285

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 100/296 (33%), Positives = 151/296 (51%), Gaps = 33/296 (11%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 5   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAHI 64

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH               +      ++ ++L    IE IVRGYL G   + L  + + G
Sbjct: 65  MPNHFTGDSVFDILPKEEAEAIQHRAVICKRLTPVKIESIVRGYLTG---SGLKDYNQTG 121

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEI---IHRGILTRNQW 174
              I    LP+ + +  KLP P+ TP++K+       D  IS  E    I   + T+   
Sbjct: 122 T--ICGLKLPEGLVEASKLPQPIFTPSSKAE--VGDHDINISYEECERQIGAELATK--- 174

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W VETY
Sbjct: 175 --VRDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVETY 232

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           +    EG  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 233 Q----EGTNPPSFDKQFVRDWLENSGWNKQAPAPKVPSDVIEKTVAKYQEALDLLT 284


>gi|73748645|ref|YP_307884.1| phosphoribosylaminoimidazole- succinocarboxamidesynthase
           [Dehalococcoides sp. CBDB1]
 gi|289432670|ref|YP_003462543.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dehalococcoides sp. GT]
 gi|73660361|emb|CAI82968.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Dehalococcoides sp. CBDB1]
 gi|288946390|gb|ADC74087.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dehalococcoides sp. GT]
          Length = 304

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 101/317 (31%), Positives = 173/317 (54%), Gaps = 40/317 (12%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           +++L +  +P LP++  GKVR+ Y L D   I +A+DR+SAFD  + + I  KG VLN+I
Sbjct: 4   IKVLMETALP-LPSFIKGKVRDTYLLGDKLLI-VASDRISAFDVILPSGISGKGRVLNRI 61

Query: 60  TQYWFHHTSDICSNHTLDYPD-----------------PNVLVGQQLQM-----FPIELI 97
           + +WF   + I  NH ++  +                 P  L+G+ + +       +E +
Sbjct: 62  SSFWFEKIAHIIPNHVIELVENTSCLDKYLTSAERFKYPEYLIGRSMVVKKVNRVSVECV 121

Query: 98  VRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQP 157
           VRGY+AG+  +    + K G   +    +P  +  +Q+LP P+ TPTTK        D+P
Sbjct: 122 VRGYIAGSAWSE---YKKLGT--VNGVSMPKGLQQSQELPKPIFTPTTKGDGEH---DRP 173

Query: 158 ISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILA 217
           +S  E+   G++ ++  + ++  +L L++ G + A   G+I+ D+K+EFG+D  + +IL 
Sbjct: 174 MSIAEL--EGMVGKDLADKLARKSLELYKFGREYARNRGIIIADTKFEFGLDGTE-LILI 230

Query: 218 DEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILR 277
           DE  TPDSSR+W+    EK+++ G      DK  +R+++ T         P +P+ +I  
Sbjct: 231 DEALTPDSSRFWD----EKTYKVGEAQDSYDKQPVRDYLETISWNKEPPGPVLPDEVIKS 286

Query: 278 TSQTYIAAYEKITGLKF 294
           T++ Y  AYE+ITGLK 
Sbjct: 287 TTRRYEYAYERITGLKL 303


>gi|170718378|ref|YP_001783602.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus somnus 2336]
 gi|189038229|sp|B0UW56|PUR7_HAES2 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|168826507|gb|ACA31878.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus somnus 2336]
          Length = 286

 Score =  152 bits (385), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 103/300 (34%), Positives = 149/300 (49%), Gaps = 41/300 (13%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   I  KGE+L QI+ +WF   + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIDRKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH               D      +V ++L    IE IVRGYL G    S L  YK  
Sbjct: 66  MPNHFTGETVYDVLPQAEADLVKDRAVVCKRLTPIKIESIVRGYLTG----SGLKDYK-A 120

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSE-------SASGCDQPISPNEIIHRGILT 170
              I    LP+ + +  KLP P+ TP++K+         S   C+Q I        G+  
Sbjct: 121 TGTICGLKLPEGLVEASKLPEPIFTPSSKAKVGDHDINISYEECEQLI--------GVEL 172

Query: 171 RNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWE 230
             Q   +   A+SL++   + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W 
Sbjct: 173 AKQ---VREKAISLYKEAAEYALTKGIIICDTKFEFGLDENGVLTLMDEVLTPDSSRFWS 229

Query: 231 VETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           VETY+    EG  P   DK F+R+W+       +   P +P ++I +T   Y    + +T
Sbjct: 230 VETYQ----EGTNPPSFDKQFVRDWLEKSGWNKQAPAPKVPADVIQKTVDKYKEVLDLLT 285


>gi|261378781|ref|ZP_05983354.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           cinerea ATCC 14685]
 gi|269144759|gb|EEZ71177.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           cinerea ATCC 14685]
          Length = 287

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 152/296 (51%), Gaps = 27/296 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           +  L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   
Sbjct: 3   VTSLVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKL 62

Query: 68  SDICSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + I  NH   +   +VL             V ++L    +E IVRGYLAG   +    + 
Sbjct: 63  AHIMPNHFTGHTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQ 119

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           K G   +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   
Sbjct: 120 KTGS--VCGIQLPEGMQEAQQLPEVIFTPSTKAA--VGDHDENISFEEC--ERIIGKELA 173

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             + + A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y
Sbjct: 174 AEVRTKAIQLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY 233

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
               + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 ----KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|19553793|ref|NP_601795.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glutamicum ATCC 13032]
 gi|62391435|ref|YP_226837.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium glutamicum ATCC 13032]
 gi|25008973|sp|Q8NMH6|PUR7_CORGL RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|21325369|dbj|BAB99990.1| Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
           [Corynebacterium glutamicum ATCC 13032]
 gi|41326776|emb|CAF21258.1| PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
           [Corynebacterium glutamicum ATCC 13032]
          Length = 297

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 161/309 (52%), Gaps = 46/309 (14%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           PEL  Y    +GKVRE Y + D   + +A+DR+SA+D  +   IP KG VL  ++Q++F 
Sbjct: 3   PELSQYKHLSAGKVREIYEIDDKHILMVASDRISAYDFILDTEIPDKGRVLTAMSQFFFD 62

Query: 66  HTSDICSNHTLDYP--------DPNV--------LVGQQLQMFPIELIVRGYLAGNTKTS 109
                    T+D+P        DP +        +V ++L M P E +VRGYL G    S
Sbjct: 63  ---------TIDFPNHLAGPADDPRIPEEVLGRAMVCKKLNMLPFECVVRGYLTG----S 109

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
            L  YK     +    LP+ + ++ +LP P+ TP TK    A   D  I+ +  +    L
Sbjct: 110 GLVEYKQ-TSSVCGVELPEGLVESSQLPEPIFTPATK----ADIGDHDINVSFDVVEERL 164

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
              +   +   ++++++   ++A + G+IL D+K+EFGID+   ++L DE+ TPDSSRYW
Sbjct: 165 GEARANQLRDASIAIYKAAAEIARDRGVILADTKFEFGIDEDGTLVLGDEVLTPDSSRYW 224

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAA 285
            +E YE     G      DK F+RNW+    + +  +     P +P +++  T + YI A
Sbjct: 225 PLEGYEA----GSVQPSFDKQFVRNWLTGPKSGWDKDSGLEPPALPGSVVEATRERYIEA 280

Query: 286 YEKITGLKF 294
           YE I+G KF
Sbjct: 281 YELISGQKF 289


>gi|260581066|ref|ZP_05848888.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae RdAW]
 gi|260582824|ref|ZP_05850610.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae NT127]
 gi|1574582|gb|AAC23372.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (purC)
           [Haemophilus influenzae Rd KW20]
 gi|260092306|gb|EEW76247.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae RdAW]
 gi|260094150|gb|EEW78052.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae NT127]
          Length = 306

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 100/296 (33%), Positives = 150/296 (50%), Gaps = 27/296 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           I  L   YSGKVR+ Y + D   + + +DRLSAFD  +   IP KGE+L QI+ +WF+  
Sbjct: 23  ILSLKKIYSGKVRDLYEIDDKRMLMVTSDRLSAFDVILDDPIPRKGEILTQISNFWFNKL 82

Query: 68  SDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + I  NH               D      +V ++L    IE IVRGYL G   + L  + 
Sbjct: 83  AHIMPNHFTGDSVYDVLPKEEADLIRDRAVVCKRLNPIKIESIVRGYLTG---SGLKDYK 139

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           + G   I    LP+ + +  KLP  + TP++K  E     D  IS  E     ++  +  
Sbjct: 140 QTGT--ICGLKLPEGLVEASKLPEAIFTPSSK--EEVGNHDINISYAEC--EKLIGADLA 193

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY
Sbjct: 194 AQVKEKAIALYTVAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY 253

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           +     G  P   DK F+R+W+       +   P +PENII +T   Y  A + +T
Sbjct: 254 QA----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPENIIQKTVDKYQEALDLLT 305


>gi|255068246|ref|ZP_05320101.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           sicca ATCC 29256]
 gi|255047516|gb|EET42980.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           sicca ATCC 29256]
          Length = 286

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWF------ 64
           L   YSGKVR+ Y +     + +A+DRLSAFD  +   IP KGE+L QI+ +WF      
Sbjct: 6   LKKIYSGKVRDLYEIDSKRMLMVASDRLSAFDVILDNPIPGKGEILTQISNFWFQKLAHI 65

Query: 65  ---HHTSD----ICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
              H T D    +   H     +   +V ++L    +E IVRGYLAG   +    + KNG
Sbjct: 66  MPNHFTGDTVYDVLPEHEAKAIEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKNG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     +
Sbjct: 123 S--VCGIKLPEGMKEAQQLPEVIFTPSTKAA--VGDHDENISFEEC--ERIIGKELAAEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y+  
Sbjct: 177 RAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQYQV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   PD+P ++I +T   Y  A   +T
Sbjct: 236 ---GTNPPSFDKQFVRDWLEQSGWNKKAPAPDVPSDVIQKTVDKYREALNLLT 285


>gi|86743048|ref|YP_483448.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. CcI3]
 gi|86569910|gb|ABD13719.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           sp. CcI3]
          Length = 303

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 98/299 (32%), Positives = 157/299 (52%), Gaps = 29/299 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           L +  SGKVRE + + D   + +A+DR+SAFD  +   IP KG VL  ++ +WF   +D+
Sbjct: 11  LTHLGSGKVRELFAVGDDAVLLVASDRISAFDVVLPTEIPDKGAVLTGLSLWWFDQLADL 70

Query: 71  CSNHTL-----DYPDP----------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
             +H +     +YP              ++ ++L M  IE + RGYL G+    L  + +
Sbjct: 71  VPSHVVSSNVDEYPAELTPYTEQLRGRSMLCRRLNMVQIECVARGYLTGS---GLKDYQR 127

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWE 175
            G   +  + LP  + D  KLP P+ TP+TK+       D+ IS  +   R I T    E
Sbjct: 128 TGA--VSGHPLPTGLVDGSKLPAPIYTPSTKAPIGEH--DENISRADAAGR-IGTELAAE 182

Query: 176 TISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYE 235
            +    L +F R   LA E G++L D+K+EFG D +  + LADE+ TPDSSR+W     E
Sbjct: 183 -LERLTLQIFGRASVLAAERGILLADTKFEFGHDTQGTLRLADEVLTPDSSRFWP----E 237

Query: 236 KSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
            ++R G +    DK +IR+++ +         P++P +++  T   Y+ AYE++TG+ F
Sbjct: 238 DTWRPGASQPSFDKQYIRDYLTSTGWDRTAPGPELPADVVEATRVRYVEAYERLTGISF 296


>gi|261380165|ref|ZP_05984738.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           subflava NJ9703]
 gi|284797007|gb|EFC52354.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           subflava NJ9703]
          Length = 287

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 152/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH--------TLDYPDPNVL-----VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH         L   +  VL     V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGQTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ + + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 123 S--VCGIQLPEGLQEAQQLPEVIFTPSTKAA--VGDHDENISFEEC--ERIIGKELAEEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y   
Sbjct: 177 RAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 -KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|282863504|ref|ZP_06272563.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. ACTE]
 gi|282561839|gb|EFB67382.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces sp. ACTE]
          Length = 309

 Score =  152 bits (384), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 95/305 (31%), Positives = 157/305 (51%), Gaps = 33/305 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLTHLHTGKVRDLYRNEAGDLVMVASDRISAYDWVLPTEIPDKGRVLTQLSLWWFEQL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH +    P           ++ + L+M P+E + RGYL G    S L  YK   
Sbjct: 73  ADLVPNHVISTELPAGAPADWAGRTMICRSLRMVPVECVARGYLTG----SGLAEYK-AT 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETI 177
           + +    LP+ + D  +LP  + TP TK++      D+ +S  E+    G  T  +   +
Sbjct: 128 QTVCGMGLPEGLVDGSELPGAIFTPATKAA--VGDHDENVSYEEVAREVGAETAAE---L 182

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGI----DKKQNIILADEIHTPDSSRYWEVET 233
               L+++ R   +A E G+IL D+K+EFG     D  + +++ADE+ TPDSSR+W   +
Sbjct: 183 RQTTLAVYGRARDIARERGIILADTKFEFGFAPTEDGGEELVIADEVLTPDSSRFWPAAS 242

Query: 234 YEKSFREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKI 289
           +E     G      DK F+R+W+    + +        P +P+ I+  T   Y+ AYE +
Sbjct: 243 WEP----GKAQPSYDKQFVRDWLTAPESGWDRHGEQPPPALPQEIVDATRAKYLDAYEHL 298

Query: 290 TGLKF 294
           TGL +
Sbjct: 299 TGLNW 303


>gi|289644471|ref|ZP_06476548.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           symbiont of Datisca glomerata]
 gi|289505726|gb|EFD26748.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           symbiont of Datisca glomerata]
          Length = 371

 Score =  152 bits (384), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 97/304 (31%), Positives = 152/304 (50%), Gaps = 39/304 (12%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           L +  SGKVRE + + D   + +A+DR+SAFD  +   IP KG VL  ++ +WF   +D+
Sbjct: 76  LTHLGSGKVREMFAVGDDAVLLVASDRISAFDVVLPTEIPDKGAVLTGLSLWWFDQLADL 135

Query: 71  CSNHTL-----DYPDPNVLVGQQLQ----------MFPIELIVRGYLAGNTKTSLLTFYK 115
             +H +     +YPD      +QL+          M PIE + R YL G+    L  + +
Sbjct: 136 VPSHVISTDVAEYPDELAPYAEQLRGRSMLCRRLAMVPIECVARSYLTGS---GLKDYQR 192

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISP-NEIIHRGILTRNQW 174
            G+  +  + LP  + D  +LP  + TP+TK+         PI   +E I R        
Sbjct: 193 TGE--VSGHALPAGLVDGSRLPATIYTPSTKA---------PIGEHDENISRAQAASQVG 241

Query: 175 ETISS----YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWE 230
             +++      LS+FER   +A E G+I+ D+K+EFG D    + L DE+ TPDSSR+W 
Sbjct: 242 SEVAAELEKLTLSIFERAVAVAAERGIIVADTKFEFGHDADGVLRLGDEVLTPDSSRFWP 301

Query: 231 VETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            E +    R G +    DK FIR+++ +         P +P  ++  T   Y+ AYE++T
Sbjct: 302 AEQW----RPGGSQPSYDKQFIRDYLASTGWDRTAPGPQLPPEVVEATRARYVEAYERLT 357

Query: 291 GLKF 294
           G  F
Sbjct: 358 GTSF 361


>gi|53802674|ref|YP_112562.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylococcus capsulatus str. Bath]
 gi|81823726|sp|Q60CQ5|PUR7_METCA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|53756435|gb|AAU90726.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Methylococcus capsulatus str. Bath]
          Length = 297

 Score =  152 bits (384), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 153/291 (52%), Gaps = 32/291 (10%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVR+ Y   D   + + TDRLSAFD  +   IP KG VL +++++WF    D   NH  
Sbjct: 21  GKVRDIYEAGDDLMLIVTTDRLSAFDVILPDPIPGKGRVLTRVSRFWFERLKDRVPNHLS 80

Query: 77  D------YPDP--------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKR--K 120
                   PDP          +V ++L+  P+E +VRGYL G+        +K+ +R   
Sbjct: 81  GTPLEAVLPDPAEREQVEGRAMVVKRLRPLPVEAVVRGYLIGSG-------WKDYQRSGA 133

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +    LP  +   ++LP  + TP+TK+   +   D+ I  ++++  G++ R   E +   
Sbjct: 134 VCGIGLPSGLRLAERLPDALFTPSTKAEMGSH--DENIGFDQVV--GLIGRELAERMREV 189

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           AL L+      AL+ G+I+ D+K+EFG+D+   +   DE  TPDSSR+W  + Y    R 
Sbjct: 190 ALGLYREAAAYALDRGIIIADTKFEFGVDEAGVLHWIDEALTPDSSRFWPADGY----RP 245

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           GI+P   DK F+R+++ T     +   P +P +I+ RT++ Y  A  ++TG
Sbjct: 246 GISPPSFDKQFVRDYLETLEWDKKPPAPHLPPDILARTAEKYREAERRLTG 296


>gi|134296831|ref|YP_001120566.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia vietnamiensis G4]
 gi|134139988|gb|ABO55731.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia vietnamiensis G4]
          Length = 296

 Score =  152 bits (384), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 152/305 (49%), Gaps = 27/305 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPNKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNH-TLDYPDPNVL------------VGQQLQMFPIELIVRGYLAGNT 106
             +WF   + I  NH T D P+  V             V ++L+   IE +VRGYLAG  
Sbjct: 61  ANFWFDKLAHIVPNHLTGDAPEAVVAADEVEQVKGRAAVVKRLEPIMIEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +  +G   +    LP  + + QKLP P+ TP  K+       D+ I+  E   R
Sbjct: 119 -SGWKEYQASGA--VCGVPLPAGLQNAQKLPEPIFTPAAKAELGEH--DENITFEETERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 174 --IGTELAATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+  +        P +P +++ +T+  Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLEAQPWGKTAPAPALPADVVAKTAAKYQEAL 287

Query: 287 EKITG 291
           E+ITG
Sbjct: 288 ERITG 292


>gi|311897241|dbj|BAJ29649.1| putative phosphoribosylaminoimidazole- succinocarboxamide
           synthetase [Kitasatospora setae KM-6054]
          Length = 299

 Score =  152 bits (384), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 95/300 (31%), Positives = 155/300 (51%), Gaps = 28/300 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVR+ Y    G  + +A+DR SA+D  +   IP KG +L Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRDLYRDGAGNLVMVASDRTSAYDWVLPNEIPDKGRILTQLSLWWFERI 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH L    P           L+ + L M P+E + RGYLAG    S L  Y+   
Sbjct: 73  ADLVPNHVLSTELPAGAPADWAGRTLICRSLDMVPVECVARGYLAG----SGLEEYRV-S 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP+ + +  +LP P+ TP  K+       D+ +   E   R  +      T+ 
Sbjct: 128 RTVCGVALPEGLDNGSELPGPIYTPALKAEVGEH--DENVPYEETARR--VGAELAATLR 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L+++ R   +A + GLIL D+K+EFG+   + +++ DE+ TPDSSR+W  + ++   
Sbjct: 184 QTTLAVYARARDIARDRGLILADTKFEFGLLDGE-LVIGDEVLTPDSSRFWPADEWQP-- 240

Query: 239 REGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
             G      DK  IR+W+ +  + +     +  P +P+ +I  T Q YI AYEK+TGL +
Sbjct: 241 --GRDQPSFDKQIIRDWLTSPASGWDRKSENPPPRLPDEVIAHTRQRYIDAYEKLTGLAW 298


>gi|145589994|ref|YP_001156591.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145048400|gb|ABP35027.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 298

 Score =  152 bits (384), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 103/312 (33%), Positives = 153/312 (49%), Gaps = 38/312 (12%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L    I  LP    GKVR+ Y L D   + I TDRLSAFD  +   IP KG +LNQ+
Sbjct: 1   MPALYATSIKSLPLLSKGKVRDVYALGDDKLLMITTDRLSAFDVVMGEPIPEKGILLNQM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDP--------------NVLVGQQLQMFPIELIVRGYLAGN 105
             +WF     +  NH L   DP                +V ++L+   +E +VRGYLAG+
Sbjct: 61  ANFWFDKLGKVIPNH-LTGIDPATVVPADEVEQVKGRAVVAKRLKPILVEAVVRGYLAGS 119

Query: 106 TKTSLLTFYKNGKR--KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEI 163
                   +K+ K   K+    LP  + + QKLP P+ TP  K+       D+ IS  ++
Sbjct: 120 G-------WKDYKETGKVCGITLPAGLENAQKLPEPIFTPAAKAD--VGEHDENISFEKV 170

Query: 164 IHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTP 223
           I   ++       I   ++ L++   + A   G+I+ D+K+EFG+D    ++L DEI T 
Sbjct: 171 IE--LIGEKLANQIREVSIRLYKEASEYAATRGIIIADTKFEFGLDDAGQLVLMDEILTA 228

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWILT-----RCNPYRDNIPDIPENIILRT 278
           DSSR+W  ETY      G  P   DK F+R+W+ T     +  P     P +P ++I +T
Sbjct: 229 DSSRFWPAETY----YVGSNPPSYDKQFVRDWLETAQVNGKLWPKTAPAPQLPADVIEKT 284

Query: 279 SQTYIAAYEKIT 290
           +Q Y  A  ++T
Sbjct: 285 AQKYREALARLT 296


>gi|302670506|ref|YP_003830466.1| phosphoribosylaminoimidazole-succinocarboxamide synthase PurC
           [Butyrivibrio proteoclasticus B316]
 gi|302394979|gb|ADL33884.1| phosphoribosylaminoimidazole-succinocarboxamide synthase PurC
           [Butyrivibrio proteoclasticus B316]
          Length = 291

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 164/293 (55%), Gaps = 35/293 (11%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNH-- 74
           GKVRE Y + +   I +ATDR+SAFD  +   +  KG VL Q++++WF +T D+  NH  
Sbjct: 10  GKVREIYDVGENL-IMVATDRISAFDVILKNKVSTKGAVLTQMSKFWFDYTKDVVKNHMV 68

Query: 75  ---TLDYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T D P+         N ++ ++L+M P+E IVRGY+ G   +   ++ +NG   +  
Sbjct: 69  SVDTNDMPEFFRTPDFTGNSMLCKKLRMIPVECIVRGYITG---SGWKSYQENGT--VCG 123

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTRNQW--ETIS 178
             LP+ + +  KLP P+ TP+TK+       D+ I      E++ +      ++    I 
Sbjct: 124 IKLPEGLQECDKLPEPIYTPSTKAE--IGDHDENIDFERSIEVLEKEFPGHGEYYATKIR 181

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
            Y ++L+++    AL  G+I+ D+K+EFG+D+   ++LADE+ TPDSSR+W VE YE   
Sbjct: 182 DYTIALYKKCADYALTRGIIIADTKFEFGVDENGEVVLADEMLTPDSSRFWPVEGYEP-- 239

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
             G      DK F+RN++  + +P  D   ++P+++I +T   Y  AY+ +TG
Sbjct: 240 --GHDQPSFDKQFVRNYL--KAHPECDY--NLPQDVIDKTIDKYHEAYKLLTG 286


>gi|291563148|emb|CBL41964.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [butyrate-producing bacterium SS3/4]
          Length = 291

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 105/306 (34%), Positives = 163/306 (53%), Gaps = 33/306 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + EL     GKVRE Y   D + I +ATDR+S FD  +   +  KG VL Q++++WF  T
Sbjct: 1   MQELKPIKEGKVREIYDNGD-SLIMVATDRISCFDVILHNEVTSKGAVLTQMSKFWFDLT 59

Query: 68  SDICSNH-----TLDYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
            DI  NH     T D P+           ++ ++L M PIE IVRGY+ G+   S   + 
Sbjct: 60  KDILPNHMISVDTKDMPEFFQQKKFEGKTMMCRKLHMLPIECIVRGYITGSGWAS---YK 116

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSS----ESASGCDQPISPNEIIHRGILT 170
           K+G   +    LP+ + ++ KLP P+ TP+TK+     +     +Q I   E    G   
Sbjct: 117 KDGT--VCGIRLPEGLKESDKLPEPIYTPSTKAEIGDHDENISFEQSIDHLEKYFPG-KG 173

Query: 171 RNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWE 230
           R   E +    ++L+++  + AL  G+I+ D+K+EFG+D++ N+++ DE+ TPDSSR+W 
Sbjct: 174 REYAELLRDSTIALYKKCAEYALAKGIIIADTKFEFGLDEEGNLVIGDEMLTPDSSRFWP 233

Query: 231 VETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            + YE     G      DK F R+W+ +  +P  D    +P+ I+ +T   Y+ AYE IT
Sbjct: 234 AKGYEP----GHGQPSFDKQFARDWLTS--HPGNDWT--LPQEIVDKTIAKYLEAYEMIT 285

Query: 291 GLKFIA 296
           G K  A
Sbjct: 286 GKKLEA 291


>gi|261392874|emb|CAX50455.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Neisseria meningitidis 8013]
          Length = 287

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAHI 65

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 123 S--VCGIQLPEGMQEAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y   
Sbjct: 177 RAKAVRLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 -KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|255944991|ref|XP_002563263.1| Pc20g07400 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211587998|emb|CAP86069.1| Pc20g07400 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 300

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 98/302 (32%), Positives = 165/302 (54%), Gaps = 34/302 (11%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y + D T + +A+DR+SA+D  +   IP KG +L   TQ WF    + 
Sbjct: 14  LPLIAKGKVRDLYEIDDKTLLFVASDRISAYDVIMENGIPNKGVLLTLCTQTWFKALKEA 73

Query: 71  ---CSNH--TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNTKTSLLTF 113
                 H  TLD P P +            +  ++L++ PIE IVRGY+ G+       +
Sbjct: 74  NPSLRTHFITLDLP-PQIPESLRPVLQNRSMQVRKLRILPIEAIVRGYITGSAWNE---Y 129

Query: 114 YKNGKRKIYEYLLPDNMSDNQKLP-YPVITPTTKSSESASGCDQPISPNEIIHRGILTRN 172
            K+G   ++   +P  + ++Q  P  P+ TP+TK+ +     D+ I P++ +   IL   
Sbjct: 130 KKSGT--VHGIKVPAGLQESQAFPDGPIYTPSTKAEQGEH--DENIHPDQAV--AILGER 183

Query: 173 QWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVE 232
              T++  A+ L++   + AL  G+I+ D+K+EFG+D+   ++LADE+ TPDSSR+W  +
Sbjct: 184 YASTVAKMAVELYKTAHEYALARGVIIADTKFEFGVDEDGEVVLADEVLTPDSSRFWPKD 243

Query: 233 TYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGL 292
           +Y      G      DK F+R+W+++     ++ +  +P++I L+T++ Y  A+EKITG 
Sbjct: 244 SYAV----GRGQASFDKQFLRDWLVSEGLKGKEGV-RMPDDIALKTAEKYQEAWEKITGG 298

Query: 293 KF 294
           K 
Sbjct: 299 KI 300


>gi|30995475|ref|NP_439867.2| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae Rd KW20]
 gi|145629177|ref|ZP_01784976.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae 22.1-21]
 gi|145639121|ref|ZP_01794728.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae PittII]
 gi|22002062|sp|P43851|PUR7_HAEIN RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|144978680|gb|EDJ88403.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae 22.1-21]
 gi|145271683|gb|EDK11593.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Haemophilus influenzae PittII]
 gi|309750702|gb|ADO80686.1| Phosphoribosylaminoimidazole-succinocarboxamidesynthase
           [Haemophilus influenzae R2866]
          Length = 290

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 100/296 (33%), Positives = 150/296 (50%), Gaps = 27/296 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           I  L   YSGKVR+ Y + D   + + +DRLSAFD  +   IP KGE+L QI+ +WF+  
Sbjct: 7   ILSLKKIYSGKVRDLYEIDDKRMLMVTSDRLSAFDVILDDPIPRKGEILTQISNFWFNKL 66

Query: 68  SDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           + I  NH               D      +V ++L    IE IVRGYL G   + L  + 
Sbjct: 67  AHIMPNHFTGDSVYDVLPKEEADLIRDRAVVCKRLNPIKIESIVRGYLTG---SGLKDYK 123

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           + G   I    LP+ + +  KLP  + TP++K  E     D  IS  E     ++  +  
Sbjct: 124 QTGT--ICGLKLPEGLVEASKLPEAIFTPSSK--EEVGNHDINISYAEC--EKLIGADLA 177

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +   A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY
Sbjct: 178 AQVKEKAIALYTVAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTY 237

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           +     G  P   DK F+R+W+       +   P +PENII +T   Y  A + +T
Sbjct: 238 QA----GTNPPSFDKQFVRDWLENSGWNKQAPAPKVPENIIQKTVDKYQEALDLLT 289


>gi|241758808|ref|ZP_04756921.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           flavescens SK114]
 gi|241321016|gb|EER57229.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           flavescens SK114]
          Length = 287

 Score =  152 bits (383), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKLAHI 65

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH   +   +VL             V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGHTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK+       D+ IS  E     I+ +     +
Sbjct: 123 S--VCGIQLPEGMQEAQQLPEVIFTPSTKAE--VGDHDENISFEEC--ERIIGKELAAEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y   
Sbjct: 177 RAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 -KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|312797156|ref|YP_004030078.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Burkholderia rhizoxinica HKI 454]
 gi|312168931|emb|CBW75934.1| Phosphoribosylamidoimidazole-succinocarboxamide synthase (EC
           6.3.2.6) [Burkholderia rhizoxinica HKI 454]
          Length = 329

 Score =  152 bits (383), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 155/303 (51%), Gaps = 27/303 (8%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
           +L ++ +  LP    GKVR+NY + D   + + TDRLSAFD  +   IP KG VLNQ+  
Sbjct: 35  VLYESTLKSLPLLGRGKVRDNYAVGDDKLLIVTTDRLSAFDVILGEPIPDKGRVLNQMAN 94

Query: 62  YWFHHTSDICSNH-------TLDYPD--PNV----LVGQQLQMFPIELIVRGYLAGNTKT 108
           +WF   + +  NH       ++  PD  P V    +V ++LQ   +E +VRGYLAG   +
Sbjct: 95  FWFDKLAHMVPNHLTGVAPESVVAPDEVPQVAGRAVVVRRLQPILVEAVVRGYLAG---S 151

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
               +  +G   +   +LP  + + Q+LP P+ TP  K+       D+ I+  E+  R  
Sbjct: 152 GWKDYQASGS--VCGVVLPSGLQNAQRLPEPIFTPAAKAD--IGHHDENITFAEVEQR-- 205

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +       I   ++SL++     A   G+I+ D+K+EFG+D    + L DE+ T DSSR+
Sbjct: 206 IGAELAARIRDISISLYKTAAHYAATRGIIIADTKFEFGLDDDGKLYLMDEVLTADSSRF 265

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEK 288
           W  + Y    R G  P   DK F+R+W+  +        P +P  +I +T+  Y  A E+
Sbjct: 266 WPADQY----RVGTHPPSFDKQFVRDWLEAQPWNKAPPAPKLPREVIDKTAAKYREALER 321

Query: 289 ITG 291
           +TG
Sbjct: 322 LTG 324


>gi|187925247|ref|YP_001896889.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia phytofirmans PsJN]
 gi|187716441|gb|ACD17665.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia phytofirmans PsJN]
          Length = 296

 Score =  152 bits (383), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 93/308 (30%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN++
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNEM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFP-------------IELIVRGYLAGNT 106
             +WF     +  NH       +V+   +++                +E +VRGYLAG  
Sbjct: 61  ANFWFEKLKHVVPNHLTGVAPESVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   G   +    LP  + + QKLP P+ TP  K+       D+ I+ NE+  R
Sbjct: 119 -SGWKDYQATGS--VCGVELPPGLQNAQKLPEPIFTPAAKAEMGHH--DENITYNEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDDVVTKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|50843435|ref|YP_056662.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Propionibacterium acnes KPA171202]
 gi|50841037|gb|AAT83704.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Propionibacterium acnes KPA171202]
          Length = 421

 Score =  152 bits (383), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 90/292 (30%), Positives = 154/292 (52%), Gaps = 24/292 (8%)

Query: 11  ELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++ +WF   
Sbjct: 7   DLPLLAEGKVRRLYRLPDQPGCLLMVATDRISAYDHVLTPDVPGKGAILTNMSLWWFDLL 66

Query: 68  SDICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           +DI  NH +    P  + G     ++L MFP+E +VRGYL G   +    + +N  R + 
Sbjct: 67  ADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTG---SGWAEYQRN--RAVC 121

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
              LP+ + +  +L  P+ TP  K+ +     D+ I    ++   ++  +    +   +L
Sbjct: 122 GIRLPEGLQNGSRLEEPIFTPAIKAPQGEH--DENIDYLRLVE--LVGPDVAAQLHDLSL 177

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            +++R  ++A + G++L D+K+EFG      I+LADE+ TPDSSR+W+ ET++     G 
Sbjct: 178 RVYQRAEEIARKRGILLADTKFEFGRRADGTIVLADEVLTPDSSRFWDAETWQP----GK 233

Query: 243 TPIGLDKDFIRNWILTRCNPYR---DNIPDIPENIILRTSQTYIAAYEKITG 291
                DK ++R+W+       R      P +PE ++  TS+ Y  A+ ++TG
Sbjct: 234 GADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTG 285


>gi|296157278|ref|ZP_06840114.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. Ch1-1]
 gi|295892614|gb|EFG72396.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. Ch1-1]
          Length = 296

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 94/308 (30%), Positives = 153/308 (49%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN++
Sbjct: 1   MSTLYESTLHSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNEM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH       +V+             V ++L+   +E +VRGYLAG  
Sbjct: 61  ANFWFEKLKHVVPNHLTGVAPESVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   G   +   +LP  + + QKLP P+ TP  K+       D+ I+ +E+  R
Sbjct: 119 -SGWKDYQATGS--VCGVVLPPGLQNAQKLPEPIFTPAAKAEMGHH--DENITYDEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDDVVAKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|325001963|ref|ZP_08123075.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudonocardia sp. P1]
          Length = 281

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 144/286 (50%), Gaps = 23/286 (8%)

Query: 16  YSGKVRENYF---LSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDIC 71
           +SGKVRE Y    +     + +A+DRLS +D  +   +P KG +L  ++ YWF  TSD+ 
Sbjct: 5   HSGKVRELYLDESVDPAELLLVASDRLSIYDVVLPTPVPDKGAILTALSLYWFERTSDLV 64

Query: 72  SNHTLDYPD-PNVLVGQQ-----LQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYL 125
            NH L   D P+   G+      L+M P+E I RGYL G     L  + + G   +    
Sbjct: 65  PNHVLGTHDIPDEFAGRAVRCRPLEMLPVECIARGYLTG---LGLKEYQRTGA--VSGVR 119

Query: 126 LPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLF 185
           LP+ + +  KLP P+ TPTTK+       D+ ++ ++++   +L  +    +    L ++
Sbjct: 120 LPEGLVEGSKLPEPIFTPTTKAPVGEH--DEFMTFDDVVD--LLGADTATRLRGLTLEVY 175

Query: 186 ERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPI 245
            RG   A + G+++ D+K EFG D    I+L DE+ TPDSSR+W  ++YE     G    
Sbjct: 176 RRGASAAADGGILVADTKLEFGRDAAGGIVLGDEVLTPDSSRFWPADSYEP----GRPQF 231

Query: 246 GLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
             DK ++R+W            P++P  I+      Y   Y +ITG
Sbjct: 232 SFDKQYVRDWSAGLGWDRTAPGPEVPAEIVQDVRDRYAEVYRRITG 277


>gi|327481476|gb|AEA84786.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas stutzeri DSM 4166]
          Length = 289

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 91/294 (30%), Positives = 150/294 (51%), Gaps = 27/294 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +A  IP KG++L  I+ +WF     +
Sbjct: 9   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILAEPIPEKGKILTAISNFWFDKLKGL 68

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH              L   +   +V ++L+   +E IVRGY+ G   +    + K+G
Sbjct: 69  IPNHFTGDKVEDVVPADELPLVEGRAVVAKRLKPVAVEAIVRGYIVG---SGWKEYQKSG 125

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP  + +  KLP P+ TP+TK++      D+ IS  +     I+ +     +
Sbjct: 126 T--VCGIQLPAGLKEAAKLPQPIFTPSTKAA--VGDHDENISFEQC--EAIIGKELAAQV 179

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              +++L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  ++YE  
Sbjct: 180 RDVSIALYSAAVEYAATRGIIIADTKFEFGLDENGTLTLMDEVLTPDSSRFWPADSYE-- 237

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
             EG  P   DK F+R+W+ +     +   P +P  +  +T+  Y  A  ++T 
Sbjct: 238 --EGKNPPSFDKQFVRDWLESTGWNKQPPAPAVPAEVAQKTADKYREALTRLTA 289


>gi|161869701|ref|YP_001598868.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis 053442]
 gi|189038226|sp|A9M3I9|PUR7_NEIM0 RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|161595254|gb|ABX72914.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Neisseria
           meningitidis 053442]
          Length = 287

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH--------TLDYPDPNVL-----VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH         L   +  VL     V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGQTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 123 S--VCGIRLPEGMQEAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + Y   
Sbjct: 177 RAKAVRLYTEAAEYAKSRGIIICDTKFEFGLDTNGTLTLMDEVLTPDSSRFWPADQY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 -KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|315107909|gb|EFT79885.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL030PA1]
          Length = 421

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 90/292 (30%), Positives = 154/292 (52%), Gaps = 24/292 (8%)

Query: 11  ELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++ +WF   
Sbjct: 7   DLPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMSLWWFDLL 66

Query: 68  SDICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           +DI  NH +    P  + G     ++L MFP+E +VRGYL G   +    + +N  R + 
Sbjct: 67  ADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTG---SGWAEYQRN--RAVC 121

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
              LP+ + +  +L  P+ TP  K+ +     D+ I    ++   ++  +    +   +L
Sbjct: 122 GIRLPEGLQNGSRLEEPIFTPAIKAPQGEH--DENIDYLRLVE--LVGPDVAAQLHDLSL 177

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            +++R  ++A + G++L D+K+EFG      I+LADE+ TPDSSR+W+ ET++     G 
Sbjct: 178 RVYQRAEEIARKRGILLADTKFEFGRRADGTIVLADEVLTPDSSRFWDAETWQP----GK 233

Query: 243 TPIGLDKDFIRNWILTRCNPYR---DNIPDIPENIILRTSQTYIAAYEKITG 291
                DK ++R+W+       R      P +PE ++  TS+ Y  A+ ++TG
Sbjct: 234 GADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTG 285


>gi|153852729|ref|ZP_01994166.1| hypothetical protein DORLON_00148 [Dorea longicatena DSM 13814]
 gi|149754371|gb|EDM64302.1| hypothetical protein DORLON_00148 [Dorea longicatena DSM 13814]
          Length = 381

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 160/293 (54%), Gaps = 35/293 (11%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRE Y   D + I +ATDR+S FD  +   +  KG VL Q++++WF  T DI  NH +
Sbjct: 101 GKVREIYDNGD-SLIMVATDRISCFDVILKNVVSKKGTVLTQMSKFWFDLTKDILPNHMI 159

Query: 77  -----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
                D P        D N ++ ++L+M PIE IVRGY+ G+   S   + +NG   +  
Sbjct: 160 STDVKDMPEFFQKPEYDGNSMMCKKLEMLPIECIVRGYITGSGWKS---YKENGT--VCG 214

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS-PNEIIHRGILTRNQWETISS--- 179
             LP+ + ++ KLP P+ TP+TK+       D+ IS    I H       + E  ++   
Sbjct: 215 IKLPEGLKESDKLPEPIYTPSTKAEIGDH--DENISYEQSIAHLEKYFPGKGEEYAAKLR 272

Query: 180 -YALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              ++L+++    AL  G+I+ D+K+EFG+D+  N+++ DE+ TPDSSR+W VE YE   
Sbjct: 273 DCTIALYKKCADYALSRGIIIADTKFEFGLDENGNMVIGDEMLTPDSSRFWPVEGYEP-- 330

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
             G      DK F R+W+ +    + DN   +P++++ +T   Y+  Y+ ITG
Sbjct: 331 --GHGQPSFDKQFARDWLTS----HPDNDWTLPDDVVQKTIDKYLQCYKMITG 377


>gi|91200646|emb|CAJ73696.1| strongly similar to phosphoribosylaminoimidazole-succinocarboxamide
           (SAICAR) synthase [Candidatus Kuenenia stuttgartiensis]
          Length = 300

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 96/304 (31%), Positives = 164/304 (53%), Gaps = 32/304 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHT 67
           I +L  +  GKVR+ Y +++   I + TDR+SAFD  +   IPYKG+VL  +++YWFH+T
Sbjct: 12  ISQLKLHNRGKVRDIYEVNNDLLI-VTTDRISAFDVVLPNGIPYKGQVLTGLSEYWFHYT 70

Query: 68  SDICSNHTL----------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLL 111
           +D+  NH +                D      ++ +++ + P+E I+RGYLAG+      
Sbjct: 71  ADVTENHLITTDIDSIDNTFVRHHKDILQGRSMLVKKVNVIPVECIIRGYLAGSGWKEYQ 130

Query: 112 TFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTR 171
            F     + I    LP  + ++ KLP P+ TP+TK+    +G D+ I  +E+I+  ++ +
Sbjct: 131 KF-----QSICGIKLPAGLKESDKLPEPIFTPSTKAH---TGHDENIPVSEVIN--LIGK 180

Query: 172 NQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEV 231
              + +   +L ++ +  + A   G+I+ D+K+E+GI      +L DE+ TPDSSR+W +
Sbjct: 181 TLTDELKEKSLKIYSKASEYAKSRGIIICDTKFEWGITNNNKTMLIDEVLTPDSSRFWPL 240

Query: 232 ETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           E Y      G      DK FIR+++ +         P +P +II +TS+ Y+ AY+ +TG
Sbjct: 241 EFY----TPGKPQPSYDKQFIRDYLESIHWDKNPPAPALPPDIIQKTSEKYLNAYKTLTG 296

Query: 292 LKFI 295
              I
Sbjct: 297 KSLI 300


>gi|189485758|ref|YP_001956699.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [uncultured Termite group 1 bacterium phylotype Rs-D17]
 gi|170287717|dbj|BAG14238.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [uncultured Termite group 1 bacterium phylotype Rs-D17]
          Length = 292

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 98/298 (32%), Positives = 160/298 (53%), Gaps = 30/298 (10%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           LP  + GKVR+ Y L   + + +A+DR+SAFD  I   IP KG VL++++ +WF     I
Sbjct: 10  LPLVHKGKVRDVYNLGK-SYLIVASDRISAFDYVIPTIIPDKGRVLHKLSMFWFDFIQGI 68

Query: 71  CSNHTL--------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
             NH +              +Y     ++ ++ +   IE IVRGYLAG+           
Sbjct: 69  VPNHIITGNFESFPLSLKQYEYLRDRSMIVKKAKRVDIECIVRGYLAGSGWKEY-----Q 123

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
             + +    LP  + ++ KLP  V TP++K  E     D+ IS  E++ R  + ++  E+
Sbjct: 124 KSQTVCGIKLPVGLKESSKLPESVFTPSSK--EEGGKHDENISFEEMVER--VGKDTAES 179

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   +L L+++  + +  NG+IL D+K EFG    Q +IL DEI TPDSSR+WE   YE 
Sbjct: 180 LRRISLELYKKVSEYSFLNGIILADTKLEFGFYDNQ-LILIDEIFTPDSSRFWETGKYE- 237

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
              EG +   LDK ++R+++           P++P++++ +T + YI+ YEK+TG+ F
Sbjct: 238 ---EGKSQDSLDKQYVRDYLERIKWDKSSPAPELPKDVVEKTMEKYISVYEKLTGVNF 292


>gi|307258123|ref|ZP_07539875.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
 gi|306863486|gb|EFM95417.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
          Length = 285

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 5   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAHI 64

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYL G   + L  + + G
Sbjct: 65  MPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTG---SGLKDYKQTG 121

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  +       +
Sbjct: 122 T--ICGLKLPEGLVEASKLPQPIFTPSSKAE--VGDHDINISYEECERQ--IGAELAAKV 175

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V TY+  
Sbjct: 176 RDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVGTYQ-- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EG  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 234 --EGTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|291280236|ref|YP_003497071.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Deferribacter desulfuricans SSM1]
 gi|290754938|dbj|BAI81315.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Deferribacter desulfuricans SSM1]
          Length = 292

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 104/306 (33%), Positives = 170/306 (55%), Gaps = 31/306 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M ++ K  IPEL     GKVR+ Y L +   I + TDR+SAFD  +   IPYKG VL Q+
Sbjct: 1   MDVVLKTEIPELKLIGRGKVRDIYDLGNYLLI-VTTDRISAFDVILPNGIPYKGYVLTQL 59

Query: 60  TQYWFHHTSDICSNHTL-----DYPD-----PNVLVGQQLQM-----FPIELIVRGYLAG 104
           +++WF  TS I  NH +     + P+      N+L G+ + +     +P+E +VRGY+ G
Sbjct: 60  SKFWFEKTSHIVKNHLITTDIEEMPEICKKYRNILEGRSMLVEKAKPYPVECVVRGYITG 119

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
              +    + K G  ++    LP N+ ++QKL  P+ TP TK+       D+ IS  +++
Sbjct: 120 ---SGWKDYQKTG--EVCGIKLPKNLKESQKLEPPLFTPATKAEIGEH--DENISFEQMV 172

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPD 224
              ++ +   E +  YA+ ++    K+A E G+I+ D+K EFG +K   IIL DE+ TPD
Sbjct: 173 L--MVGQKTAEKLRDYAIKIYTYCAKIAEEKGIIIADTKMEFG-NKDGEIILIDELLTPD 229

Query: 225 SSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIA 284
           SSR+W    +++ ++ G     +DK F+RN++ T     +   P++P+ II +TS+ Y+ 
Sbjct: 230 SSRFW----FKEKYKVGEPQESMDKQFVRNYLETLDWDKKAPGPELPKEIIEQTSKRYLE 285

Query: 285 AYEKIT 290
             E +T
Sbjct: 286 IMEILT 291


>gi|170693445|ref|ZP_02884604.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia graminis C4D1M]
 gi|170141600|gb|EDT09769.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia graminis C4D1M]
          Length = 296

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/308 (30%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN++
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNEM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFP-------------IELIVRGYLAGNT 106
             +WF     +  NH       +V+   +++                +E +VRGYLAG  
Sbjct: 61  ANFWFEKLKHVVPNHLTGVAPESVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   G   +    LP  + + QKLP P+ TP  K+       D+ I+ NE+  R
Sbjct: 119 -SGWKDYQATGS--VCGVELPPGLQNAQKLPEPIFTPAAKAEMGHH--DENITYNEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLETQDWAKEPPAPKLPDDVVQKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|57234404|ref|YP_181568.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dehalococcoides ethenogenes 195]
 gi|57224852|gb|AAW39909.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Dehalococcoides ethenogenes 195]
          Length = 304

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/317 (31%), Positives = 171/317 (53%), Gaps = 40/317 (12%)

Query: 2   RILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQIT 60
           ++L +  +P LP++  GKVR+ Y L D   I IA+DR+SAFD  +   IP KG VLN+I+
Sbjct: 5   KVLMETALP-LPSFIKGKVRDTYLLGDKLLI-IASDRISAFDVILPGGIPGKGRVLNRIS 62

Query: 61  QYWFHHTSDICSNHTLDYPD-----------------PNVLVGQQL-----QMFPIELIV 98
            +WF  T+ I  NH ++  +                 P  L G+ +     +   +E +V
Sbjct: 63  SFWFEKTARIIPNHVIELVEDVSCLDKYLPPEERFRYPEYLSGRSMVVKRVKRVSVECVV 122

Query: 99  RGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPI 158
           RGY+AG+  +    + K G   +    +P  +  +Q+LP P+ TPTTK        D P+
Sbjct: 123 RGYIAGSAWSE---YKKTG--TVNGMPMPKGLLQSQELPEPIFTPTTKGEGEH---DHPM 174

Query: 159 SPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILAD 218
           +  E+    ++ +   + ++  +L+L++ G + A + G+I+ D+K+EFG+D  + +IL D
Sbjct: 175 TIAEL--EAMVGKELADKLAEKSLALYKLGREYARQRGIIIADTKFEFGLDGSE-LILID 231

Query: 219 EIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRT 278
           E  TPDSSR+W+    EK++R G      DK  +R+++           P +P+ +I  T
Sbjct: 232 EALTPDSSRFWD----EKTYRVGEAQDSYDKQPVRDYLEAIGWDKEPPGPVLPDEVIKST 287

Query: 279 SQTYIAAYEKITGLKFI 295
           ++ Y  AYE+ITG+K +
Sbjct: 288 TRRYEYAYERITGIKLV 304


>gi|258655174|ref|YP_003204330.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Nakamurella multipartita DSM 44233]
 gi|258558399|gb|ACV81341.1| phosphoribosylaminoimidazole-succinocarboxamides ynthase
           [Nakamurella multipartita DSM 44233]
          Length = 293

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/302 (30%), Positives = 159/302 (52%), Gaps = 30/302 (9%)

Query: 9   IPELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWF 64
           +P L +Y    +GKVR+ Y + D   + +A+DR+SA+D  +   IP KG VL  ++ +WF
Sbjct: 1   MPTLEDYRHLSTGKVRDLYEVDDELLLMVASDRISAYDYVLPTPIPDKGRVLTAMSVFWF 60

Query: 65  HHTSDICSNHTLDYPDPNV--------LVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
               D+  NH + Y DP +        L+ ++LQM P+E + RGYL G   + L  + + 
Sbjct: 61  ELLGDVVPNHVVSYDDPRIPDEVRGRALLVRKLQMLPVECVARGYLTG---SGLTDYQRT 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G  ++    LP  +++   LP P+ TP +K+ +     D+ +S +E+     +     E 
Sbjct: 118 G--EVCGIALPPGLTEASMLPEPIFTPASKAEQGEH--DENVSFDEVAR--TIGAPLAEK 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +   +++L+ER    AL   +++ D+K EFG+     I+L DE+ TPDSSR+W    Y  
Sbjct: 172 LRELSITLYERAAAHALTRSMLVADTKLEFGL-LGDTIVLGDELVTPDSSRFWPSFGY-- 228

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYR----DNIPDIPENIILRTSQTYIAAYEKITGL 292
             R G      DK ++R+W+ +  + +     +  P +P+N++  T   YI AY+ I+G 
Sbjct: 229 --RVGQVQPSFDKQYVRDWLTSPESGWDRHSGEQPPPLPDNVVGATRSRYIEAYQLISGR 286

Query: 293 KF 294
            F
Sbjct: 287 PF 288


>gi|294339376|emb|CAZ87732.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Thiomonas sp. 3As]
          Length = 294

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 98/292 (33%), Positives = 153/292 (52%), Gaps = 34/292 (11%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVRENY +     + +ATDR+SAFD  +A  IP KGE+L ++ ++WF    D+  NH L
Sbjct: 19  GKVRENYAVGADRLLMVATDRISAFDVIMAEPIPGKGEILTRMARFWFGLLHDVAPNHLL 78

Query: 77  DYPDPNVLVG--------------QQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           D  DP  +V               ++L+  P+E +VRGYLAG   +    +   G+  + 
Sbjct: 79  DI-DPETVVAADERNQVRGRAMVVKRLKPLPVEAVVRGYLAG---SGWKDYQATGE--VC 132

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQWETISSYA 181
              LP  +    KLP P+ TP TK+       D+ IS  ++    G     Q   IS   
Sbjct: 133 GVALPKGLKLASKLPAPIFTPATKAELGEH--DENISFAQMEQAIGAELAAQVRDIS--- 187

Query: 182 LSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREG 241
           ++L++R    +   G+++ D+K+EFG+D+   + L DE+ TPDSSR+W  +T+     EG
Sbjct: 188 ITLYQRAADYSAARGILIADTKFEFGLDESGTLTLMDEVLTPDSSRFWPADTW----LEG 243

Query: 242 ITPIGLDKDFIRNWI--LTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
            +P   DK F+R+W+  +   N  +   P +P ++I  T   Y  A E++TG
Sbjct: 244 SSPPSFDKQFLRDWLEGVPGWN-KQPPPPTLPADVIEHTLARYREALERLTG 294


>gi|282854766|ref|ZP_06264100.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes J139]
 gi|282581912|gb|EFB87295.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes J139]
 gi|314924537|gb|EFS88368.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL001PA1]
 gi|314967343|gb|EFT11442.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL082PA2]
 gi|314981779|gb|EFT25872.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL110PA3]
 gi|315092539|gb|EFT64515.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL110PA4]
 gi|315094859|gb|EFT66835.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL060PA1]
 gi|315102944|gb|EFT74920.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL050PA2]
 gi|327328542|gb|EGE70302.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL103PA1]
          Length = 421

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/304 (29%), Positives = 158/304 (51%), Gaps = 24/304 (7%)

Query: 11  ELPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + P    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++ +WF   
Sbjct: 7   DFPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMSLWWFDQL 66

Query: 68  SDICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIY 122
           +DI  NH +    P  + G     ++L MFP+E +VRGYL G   +    + +N  + + 
Sbjct: 67  ADIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTG---SGWAEYQRN--QAVC 121

Query: 123 EYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYAL 182
              LP+ + +  +L  P+ TP  K+ +     D+ I    ++   ++  +    +   +L
Sbjct: 122 GIRLPEGLQNGSRLEEPIFTPAIKAPQGEH--DENIDYLRLVE--LVGPDVAAQLHDLSL 177

Query: 183 SLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGI 242
            +++R  ++A + G++L D+K+EFG      I+LADE+ TPDSSR+W+ ET+    R G 
Sbjct: 178 RVYQRAEEIARKRGILLADTKFEFGRRADGTIVLADEVLTPDSSRFWDAETW----RPGK 233

Query: 243 TPIGLDKDFIRNWILTRCNPYR---DNIPDIPENIILRTSQTYIAAYEKITGLKFIADNS 299
                DK ++R+W+       R      P +PE ++  TS+ Y  A+ ++TG +   + S
Sbjct: 234 GADSFDKQYVRDWLANESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTGGQVSDEVS 293

Query: 300 ELPP 303
           +  P
Sbjct: 294 DETP 297


>gi|260578363|ref|ZP_05846277.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium jeikeium ATCC 43734]
 gi|258603385|gb|EEW16648.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Corynebacterium jeikeium ATCC 43734]
          Length = 297

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 95/300 (31%), Positives = 155/300 (51%), Gaps = 28/300 (9%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWF- 64
           PEL  Y    +GKVRE Y + +   + + +DR+SA+D  +   IP KG VL  ++ ++F 
Sbjct: 3   PELCEYEHHSAGKVREIYEVDEDNLLMVVSDRISAYDYVLETEIPDKGRVLTAVSAFFFD 62

Query: 65  ------HHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
                 H    +      +Y     ++ ++L M P E + RGYL G   + L  + + G 
Sbjct: 63  EIDFPNHLAGALDDERIPEYVLGRAMLCKKLDMIPFECVARGYLTG---SGLKEYQETGS 119

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
               E  LP+ + +  +LP P+ TP TK+       D+ +S + ++    L   +   + 
Sbjct: 120 VCGVE--LPEGLVEASRLPEPIFTPATKAE--LGDHDENVSFDVVVE--ALGEERANELR 173

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              LS++++   +A E GLIL D+K+EFG+D    ++LADE+ TPDSSRYW  E YE   
Sbjct: 174 EATLSIYKKAAAIAEERGLILADTKFEFGLDADGTLVLADEVLTPDSSRYWPAEGYE--- 230

Query: 239 REGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKITGLKF 294
            EG      DK ++RNW+    + +  +     P +P +++  T   YI AYEK++G +F
Sbjct: 231 -EGKVQPSFDKQYVRNWLTGPKSGWDKSEGTPPPPLPGSVVEATRSRYIEAYEKLSGKRF 289


>gi|156844415|ref|XP_001645270.1| hypothetical protein Kpol_1037p8 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115930|gb|EDO17412.1| hypothetical protein Kpol_1037p8 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 304

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/309 (32%), Positives = 170/309 (55%), Gaps = 42/309 (13%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y + + T + +ATDR+SA+D  +   IP KG +L +++++WF +  D 
Sbjct: 12  LPLIGRGKVRDIYEVDENTLLFVATDRISAYDVIMENTIPDKGILLTKLSEFWFEYLKDD 71

Query: 71  CSNHTLDYP-DPNV---------------------LVGQQLQMFPIELIVRGYLAGNTKT 108
             NH ++ P D  V                     ++ Q+ ++ P+E+IVRGY+ G    
Sbjct: 72  VRNHLVNIPKDKTVFDYLPKELSEPKYKSQIEGRSMLIQKFKLIPLEVIVRGYITG---- 127

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
           S    Y+  K  I+    PD + ++Q LP  + TP+TK+ +     D+ IS  +     +
Sbjct: 128 SAWKEYQKTKT-IHSIPQPDGLEESQVLPKAIFTPSTKAEQGEH--DENISIEQAAE--L 182

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSR 227
           + R+  + I + ++ L+ +    A   G+I+ D+K+EFGID+K + IIL DE+ TPDSSR
Sbjct: 183 VGRDMTKRIEALSIKLYSKCRDYASSKGIIIADTKFEFGIDEKTDEIILVDEVLTPDSSR 242

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDI--PENIILRTSQTYIAA 285
           +W     + S++ G +    DK F+R+W+ +  N + + IP +  P++I+ +T   YI A
Sbjct: 243 FWN----KNSYKLGTSQDSYDKQFLRDWLTS--NKF-NGIPGVKMPQDIVEQTRFKYIEA 295

Query: 286 YEKITGLKF 294
           YE +TG KF
Sbjct: 296 YEALTGSKF 304


>gi|307255938|ref|ZP_07537739.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307260391|ref|ZP_07542098.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306861206|gb|EFM93199.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306865642|gb|EFM97523.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
          Length = 285

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + + TDRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 5   LKKIYSGKVRDLYEIDDKRMLMVTTDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAHI 64

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYL G   + L  + + G
Sbjct: 65  MPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTG---SGLKDYKQTG 121

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    LP+ + +  KLP P+ TP++K+       D  IS  E   +  +       +
Sbjct: 122 T--ICGLKLPEGLVEASKLPQPIFTPSSKAE--VGNHDINISYEECERQ--IGAELAAKV 175

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY+  
Sbjct: 176 RDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQ-- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EG  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 234 --EGTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|226364312|ref|YP_002782094.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodococcus opacus B4]
 gi|254783971|sp|C1AT85|PUR7_RHOOB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|226242801|dbj|BAH53149.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Rhodococcus opacus B4]
          Length = 294

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 155/303 (51%), Gaps = 34/303 (11%)

Query: 10  PELPNYY---SGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           P L +Y     GKVR+ Y + D   + +A+DR+SA+D  ++  IP KG VL  ++ ++F 
Sbjct: 3   PSLDSYAHLAGGKVRDLYTIDDEHLLLVASDRISAYDHVLSTPIPDKGRVLTAMSVFFFG 62

Query: 66  HTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                 +NH    PD +          LV ++L M P+E + RGYL G   + L+ + + 
Sbjct: 63  VLG--GNNHLAGEPDDSRIPEEVLGRALVVRKLNMVPVECVARGYLTG---SGLIDYNET 117

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
           G   +    LP+ + +  +LP P+ TP  K+       D+ IS   ++ +  + ++    
Sbjct: 118 GA--VCGVALPEGLVEASQLPDPIFTPARKAELGEH--DENISFEAVVEK--VGQDLAVK 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           +    L ++ R    A + G+IL D+K EFG+D + N+ILADE+ TPDSSRYW  + YE 
Sbjct: 172 LRDDTLDVYGRASNFAADRGIILADTKLEFGLDAQNNLILADEVLTPDSSRYWPADGYEA 231

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI-----PDIPENIILRTSQTYIAAYEKITG 291
               G      DK F+RNW LT      D       P +P  I+  T   YI AYE+I+G
Sbjct: 232 ----GKVQPSFDKQFVRNW-LTGPESGWDRASDTPPPPLPAEIVEATRARYIEAYERISG 286

Query: 292 LKF 294
           L F
Sbjct: 287 LSF 289


>gi|212702427|ref|ZP_03310555.1| hypothetical protein DESPIG_00444 [Desulfovibrio piger ATCC 29098]
 gi|212674088|gb|EEB34571.1| hypothetical protein DESPIG_00444 [Desulfovibrio piger ATCC 29098]
          Length = 298

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 161/311 (51%), Gaps = 32/311 (10%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           MRI +K  I   P    GKVR+ Y + D T + + TDR+SAFD  +   IPYKG +LNQI
Sbjct: 1   MRITTKTEISAYPLLSRGKVRDIYDIDDKTLLIVTTDRMSAFDVIMDKPIPYKGVILNQI 60

Query: 60  TQYWFHHTSDICSNHTLD-----YP----------DPNVLVGQQLQMFPIELIVRGYLAG 104
           T +W     DI  NH ++     +P          +   ++ ++ +  P+E IVRGY++G
Sbjct: 61  TLFWMDKFKDIIPNHLVESDVDRFPAALAPWKDELEGRAVLVRKAKPLPVECIVRGYISG 120

Query: 105 NTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII 164
              +    + K G   +  Y LP  M ++ KL   + TP+TK+       DQ IS +E  
Sbjct: 121 ---SGWKDYQKTG--TLCGYQLPAGMRESDKLETALFTPSTKAELGQH--DQNISADEAA 173

Query: 165 HRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFG-IDKKQNIILADEIHTP 223
              +L  N    +    L+++E G   A   G+I+ D+K+EFG +D +  +I  DE+ TP
Sbjct: 174 R--LLGENVARKVQETTLAIYEAGRAYAASRGIIVADTKFEFGFVDGELRLI--DEVLTP 229

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYI 283
           DSSR+W  + YE     G +    DK ++R+W+ ++    +   P +P  ++  T++ Y 
Sbjct: 230 DSSRFWPADQYEP----GRSQPSFDKQYLRDWLTSQPWDMQPPAPALPAEVVDATARRYR 285

Query: 284 AAYEKITGLKF 294
            AY  +TG +F
Sbjct: 286 EAYHILTGKEF 296


>gi|315047138|ref|XP_003172944.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthroderma gypseum CBS 118893]
 gi|311343330|gb|EFR02533.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Arthroderma gypseum CBS 118893]
          Length = 303

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 102/304 (33%), Positives = 167/304 (54%), Gaps = 37/304 (12%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFD---QNIACIPYKGEVLNQITQYWFHHTS 68
           LP    GKVR+ Y + D T + I+TDR+SA+D   QN   IP KG++L  +T YW    +
Sbjct: 14  LPLVSRGKVRDIYQVDDRTLLFISTDRISAYDVLMQN--GIPNKGQILTSLTVYWLKFLT 71

Query: 69  DICSN---HTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLT 112
               +   H +             DY     +V ++L++FP+E IVRGYLAG   ++   
Sbjct: 72  GALPSLRTHLVSLEMPGDMPQACRDYVKNRSMVVRKLKVFPVEAIVRGYLAG---SAWAE 128

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLP-YPVITPTTKSSESASGCDQPISPNEIIHRGILTR 171
           + K+G   ++   LP  + ++ K+P  P+ TP+TK+ +   G D+ I P++     I+  
Sbjct: 129 YQKSG--TVHGIPLPSGLVESDKIPGGPLFTPSTKAEQ--GGHDENIHPDKAAD--IVGA 182

Query: 172 NQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTPDSSRYWE 230
              E I + ++ L+E     AL+ G+I+ D+K+EFG D+  N I+L DE+ TPDSSR+W 
Sbjct: 183 AYAEDIKAVSIRLYELASFHALQRGIIIADTKFEFGHDEVTNEIVLIDEVLTPDSSRFWA 242

Query: 231 VETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
           ++ Y+     G +    DK F+R+W+       +D    +P++I+ +T   YI A+E++T
Sbjct: 243 LDKYQP----GKSQDSFDKQFLRDWLTQEGLRGKDGTI-MPKDIVQKTEAKYIEAFERLT 297

Query: 291 GLKF 294
           G  F
Sbjct: 298 GETF 301


>gi|261400441|ref|ZP_05986566.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           lactamica ATCC 23970]
 gi|269209891|gb|EEZ76346.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           lactamica ATCC 23970]
          Length = 287

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH--------TLDYPDPNVL-----VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH         L   +  VL     V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGDTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     +
Sbjct: 123 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAAEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+DK   + L DE+ TPDSSR+W  + YE  
Sbjct: 177 RDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDKNGTLTLMDEVLTPDSSRFWPADQYEV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 236 ---GTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|134095776|ref|YP_001100851.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Herminiimonas arsenicoxydans]
 gi|133739679|emb|CAL62730.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Herminiimonas arsenicoxydans]
          Length = 298

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 155/306 (50%), Gaps = 28/306 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ I  LP    GKVRENY + D   + + +DRLSAFD  +   IP KG VLNQ+
Sbjct: 1   MTSLYQSTITSLPLLGRGKVRENYAVGDDKILIVTSDRLSAFDVVMNEAIPDKGRVLNQM 60

Query: 60  TQYWFHHTSDICSNH-------TLDYPDP------NVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF    DI  NH       ++  PD         +V ++LQ   +E +VRGYL G+ 
Sbjct: 61  SDFWFEKLKDIVPNHLTGIAPESVVAPDEVEQVKNRAVVAKRLQPILVEAVVRGYLIGSG 120

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    + K G   +    LP  +   +KL  P+ TP  K+       D+ I+  E+  R
Sbjct: 121 WSD---YQKTGA--VCGVQLPAGLKQAEKLAEPIFTPAAKADMGEH--DENITFAEMEQR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             + +     I   ++ L++     A   G+I+ D+K+EFG+DK   + L DE+ T DSS
Sbjct: 174 --IGKELAGKIRDVSIKLYKTAADYAATRGIIIADTKFEFGLDKDGTLHLMDEVLTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDN-IPDIPENIILRTSQTYIAA 285
           R+W  ++Y      GI+P   DK F+R+++ T  +  +    P +P ++I +T   Y  A
Sbjct: 232 RFWPADSYAT----GISPPSFDKQFVRDYLETLTDWKKTAPAPTLPADVIEKTGAKYREA 287

Query: 286 YEKITG 291
             ++TG
Sbjct: 288 LTRLTG 293


>gi|325127859|gb|EGC50765.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis N1568]
          Length = 287

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAHI 65

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     +
Sbjct: 123 S--VCGIQLPEGMQEAQQLPEVIFTPSTKAA--VGDHDENISFEEC--ERIIGKELAAEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + YE  
Sbjct: 177 RAKAIQLYTEAAEYAKLRGIIICDTKFEFGLDTNGTLTLMDEVLTPDSSRFWPADQYEV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +  +P +P ++I +T + Y  A   +T
Sbjct: 236 ---GTNPPSFDKQFVRDWLEQSGWNKKAPVPKVPADVIQKTVEKYREALTLLT 285


>gi|113866597|ref|YP_725086.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Ralstonia
           eutropha H16]
 gi|123134396|sp|Q0KE53|PUR7_RALEH RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|113525373|emb|CAJ91718.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Ralstonia eutropha H16]
          Length = 302

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 156/308 (50%), Gaps = 34/308 (11%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L ++ I  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+  +
Sbjct: 5   LYQSSINSLPLLGHGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPDKGRVLNQMANF 64

Query: 63  WFHHTSDICSNH-------TLDYPDP------NVLVGQQLQMFPIELIVRGYLAGNTKTS 109
           WF   + I  NH       T+  P+         +V ++L+   +E +VRGYLAG   + 
Sbjct: 65  WFRKLAHIVPNHETGIAPETVVAPEEVEQVKGRAVVVKRLRPILVEAVVRGYLAG---SG 121

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GI 168
              +   GK  +    LP  + + QKLP P+ TP  K+       D+ IS  E+  R GI
Sbjct: 122 WKDYQATGK--VCGIELPAGLQNAQKLPEPIFTPAAKAEMGEH--DENISFAEVEARIGI 177

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
               Q   IS   + L++   + A   G+I+ D+K+EFG+D    + L DE+ T DSSR+
Sbjct: 178 ALARQMRDIS---IRLYKEAAEFAATRGIIIADTKFEFGLDDNGVLTLMDEVLTADSSRF 234

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWI-LTRCN----PYRDNIPDIPENIILRTSQTYI 283
           W  ++Y+     G  P   DK F+R+W+   R +    P     P +P+ +I +T+  Y 
Sbjct: 235 WPADSYQV----GTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPQLPDEVIEKTAAKYR 290

Query: 284 AAYEKITG 291
            A  ++TG
Sbjct: 291 EALTRLTG 298


>gi|154483196|ref|ZP_02025644.1| hypothetical protein EUBVEN_00897 [Eubacterium ventriosum ATCC
           27560]
 gi|149736004|gb|EDM51890.1| hypothetical protein EUBVEN_00897 [Eubacterium ventriosum ATCC
           27560]
          Length = 292

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 100/303 (33%), Positives = 164/303 (54%), Gaps = 35/303 (11%)

Query: 11  ELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSD 69
           EL     GKVRE Y   D + I +ATDR+S FD  +   +  KG VL Q++++WF  T D
Sbjct: 5   ELKPIKEGKVREIYDNGD-SLIMVATDRISCFDVILNNEVTKKGTVLTQMSKFWFDLTED 63

Query: 70  ICSNHTL-----DYP--------DPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
           I  NH +     + P        D N ++ ++L+M PIE IVRGY+ G   +   ++ +N
Sbjct: 64  ILPNHMITVDVNEMPEFFRQPKFDGNSMMCKKLEMLPIECIVRGYITG---SGWASYKEN 120

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTRNQ 173
           G   +    LP+ + ++ KLP P+ TP+TK+       D+ IS     E++ +    + +
Sbjct: 121 GT--VCGIKLPEGLKESDKLPEPIYTPSTKAE--IGDHDENISYEQSIEVLEKQFPGKGE 176

Query: 174 --WETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEV 231
              + +    ++L+++    ALE G+I+ D+K+EFG+D+  NI++ DE+ TPDSSR+W  
Sbjct: 177 EYAKKLKDCTIALYKKCADYALERGIIIADTKFEFGLDENGNIVIGDEMLTPDSSRFWPA 236

Query: 232 ETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           + YE     G      DK F R+W+         +   +P++I+ +T + Y+ AYE +TG
Sbjct: 237 DGYEP----GHGQPSFDKQFARDWLKQN----EGHNWTLPQDIVDKTIEKYLQAYELLTG 288

Query: 292 LKF 294
            K 
Sbjct: 289 EKL 291


>gi|302664430|ref|XP_003023845.1| hypothetical protein TRV_02042 [Trichophyton verrucosum HKI 0517]
 gi|291187863|gb|EFE43227.1| hypothetical protein TRV_02042 [Trichophyton verrucosum HKI 0517]
          Length = 312

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 166/311 (53%), Gaps = 42/311 (13%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFD---QNIACIPYKGEVLNQITQYWFHHTS 68
           LP    GKVR+ Y + D T + I+TDR+SA+D   QN   IP KG++L  +T YW    +
Sbjct: 14  LPLVSRGKVRDIYQVDDRTLLFISTDRISAYDVLMQN--GIPNKGQILTSLTVYWLKFLT 71

Query: 69  DICSN---HTL-------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLT 112
               +   H +             DY     +V ++L++FP+E IVRGYLAG+  T    
Sbjct: 72  GALPSLRTHLVSLEMPGDMPQACRDYVKNRSMVVRKLKVFPVEAIVRGYLAGSAWTE--- 128

Query: 113 FYKNGKRKIYEYLLPDNMSDNQKLPY-PVITPTTKSSESASGCDQPISPNEIIH------ 165
           + K G   ++   LP  + ++ K+P  P+ TP+TK+ +   G D+ I P++ I       
Sbjct: 129 YQKTGT--VHGIPLPAGLVESDKIPGGPLFTPSTKAEQG--GHDENIHPDKDIDILTGEV 184

Query: 166 -RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQN-IILADEIHTP 223
              I+     E I + ++ L+E     AL+ G+I+ D+K+EFG D+  N I+L DE+ TP
Sbjct: 185 AADIVGAAYAEDIKAVSIRLYELASFHALQRGIIIADTKFEFGHDEVTNEIVLIDEVLTP 244

Query: 224 DSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYI 283
           DSSR+W ++TY+     G      DK F+R+W+       +D    +P+ I+ +T   YI
Sbjct: 245 DSSRFWALDTYQP----GKPQDSFDKQFLRDWLTKEGLRGKDGTI-MPKEIVQKTEAKYI 299

Query: 284 AAYEKITGLKF 294
            A+E+ITG  F
Sbjct: 300 EAFERITGETF 310


>gi|261364735|ref|ZP_05977618.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           mucosa ATCC 25996]
 gi|288567034|gb|EFC88594.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           mucosa ATCC 25996]
          Length = 288

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/293 (32%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWF------ 64
           L   YSGKVR+ Y +     + +A+DRLSAFD  +   IP KGE+L QI+ +WF      
Sbjct: 6   LKKIYSGKVRDLYEIDSKRMLMVASDRLSAFDVILDNPIPGKGEILTQISNFWFKKLAHI 65

Query: 65  ---HHTSD----ICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
              H T D    +   H     +   +V ++L    +E IVRGYLAG   +    + KNG
Sbjct: 66  MPNHFTGDTVYDVLPEHEAKVIEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKNG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     +
Sbjct: 123 S--VCGIKLPEGMKEAQQLPEVIFTPSTKAA--VGDHDENISFEEC--ERIIGKELAAEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y+  
Sbjct: 177 RAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQYQV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P++P ++I +T   Y  A   +T
Sbjct: 236 ---GTNPPSFDKQFVRDWLEQSGWNKKAPAPEVPSDVIQKTVDKYREALNLLT 285


>gi|296313830|ref|ZP_06863771.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           polysaccharea ATCC 43768]
 gi|296839559|gb|EFH23497.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Neisseria
           polysaccharea ATCC 43768]
          Length = 287

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKLAHI 65

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH   +   +VL             V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGHTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     +
Sbjct: 123 S--VCGIQLPEGMQEAQQLPEVIFTPSTKAA--VGDHDENISFEEC--ERIIGKELAAEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W    Y   
Sbjct: 177 RAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPAGQY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 -KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|296124081|ref|YP_003631859.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Planctomyces limnophilus DSM 3776]
 gi|296016421|gb|ADG69660.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Planctomyces limnophilus DSM 3776]
          Length = 304

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 157/291 (53%), Gaps = 30/291 (10%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWF------HH---- 66
           GKVR+ Y   +   + +ATDR+SAFD  +   IP KG++L Q++ +WF      HH    
Sbjct: 29  GKVRDVYDFGN-QLLFVATDRISAFDWILPTGIPDKGKLLTQMSCFWFDLLKVRHHLVST 87

Query: 67  ---TSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
              T  + +   L   +   LV Q+ ++ PIE +VRGYLAG+             + I  
Sbjct: 88  NPATLPLPAGTDLSLLEGRSLVVQKTRVIPIECVVRGYLAGSGWKEY-----RASQTICG 142

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP  + +  KLP P+ TP TK+    SG D+ IS  E + R I  +   E +   +LS
Sbjct: 143 ISLPPGLVECDKLPVPIFTPATKAE---SGHDENIS-FEQMQRDIDPQLA-EKLRDLSLS 197

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           ++ +    AL+ G++L D+K+EFG+   + IIL DE+ TPDSSR+W ++ Y    R G  
Sbjct: 198 IYRQAADYALKKGIVLADTKFEFGL-LGEEIILIDEVLTPDSSRFWPLDQY----RPGHG 252

Query: 244 PIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
               DK F+R+W+ T+        P +PE+++L+T   Y+ AYE++TG  F
Sbjct: 253 QPSFDKQFVRDWLETQPWDKNSPPPPLPEDVVLQTRAKYVEAYERLTGSTF 303


>gi|114321406|ref|YP_743089.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227800|gb|ABI57599.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 297

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 155/303 (51%), Gaps = 28/303 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L +A +  L   + GKVR+ Y + D   + + TDRLSAFD  +   IP KG+VL  ++ +
Sbjct: 8   LYEANLKSLECLHQGKVRDIYAVDDRRMLIVTTDRLSAFDVILPDPIPGKGQVLTSVSNF 67

Query: 63  WFHHTSDICSNHTLD------YPDP--------NVLVGQQLQMFPIELIVRGYLAGNTKT 108
           WF HT  I +NH LD       PDP          +V ++++  P+E I RGY+ G   +
Sbjct: 68  WFEHTRHIIANHLLDDRPEEVIPDPAEQARVAGRAVVVRRVRPLPVEAIARGYIIG---S 124

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGI 168
               +   G+  +    LP  +     LP P+ TP+TK++    G D+ +  + ++    
Sbjct: 125 GWKDYQATGQ--VCGIPLPPGLRQADALPEPIFTPSTKAA--VGGHDENVRFDAVVK--A 178

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
           +     E I    L L+      A E G+I+ D+K+EFG+D+  N++L DE  TPDSSR+
Sbjct: 179 IGAPLAERIREVTLRLYSEAAAYARERGIIIADTKFEFGVDEDDNLLLIDEALTPDSSRF 238

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEK 288
           W  + Y    R G +P   DK F+R+++ T         P +PE I+ RT++ Y  A  +
Sbjct: 239 WPADQY----RPGSSPPSFDKQFVRDYLETLDWDKTPPGPRLPEEILRRTAEKYREAQRR 294

Query: 289 ITG 291
           + G
Sbjct: 295 LLG 297


>gi|68535415|ref|YP_250120.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium jeikeium K411]
 gi|68263014|emb|CAI36502.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Corynebacterium jeikeium K411]
          Length = 307

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/304 (30%), Positives = 158/304 (51%), Gaps = 25/304 (8%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQ 61
           +L +  + E  ++ +GKVRE Y + +   + + +DR+SA+D  +   IP KG VL  ++ 
Sbjct: 9   LLMRPELCEYEHHSAGKVREIYEVDEDNLLMVVSDRISAYDYVLDTEIPDKGRVLTAVSA 68

Query: 62  YWF-------HHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
           ++F       H    +      +Y     ++ ++L M P E + RGYL G   + L  + 
Sbjct: 69  FFFDEIDFPNHLAGAMDDERIPEYVLGRAMLCKKLDMIPFECVARGYLTG---SGLKEYQ 125

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQW 174
           + G     E  LP+ + +  +LP P+ TP TK+       D+ +S + ++    L   + 
Sbjct: 126 ETGSVCGVE--LPEGLVEASRLPEPIFTPATKAE--LGDHDENVSFDVVVE--ALGEERA 179

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
             +    LS++++   +A E GLIL D+K+EFG+D    ++LADE+ TPDSSRYW  E Y
Sbjct: 180 NELREATLSIYKKAAAIAEERGLILADTKFEFGLDADGTLVLADEVLTPDSSRYWPAEGY 239

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDN----IPDIPENIILRTSQTYIAAYEKIT 290
           E    EG      DK ++RNW+    + +  +     P +P +++  T   YI AYEK++
Sbjct: 240 E----EGKVQPSFDKQYVRNWLTGPKSGWDKSEGTPPPPLPGSVVEATRSRYIEAYEKLS 295

Query: 291 GLKF 294
           G +F
Sbjct: 296 GKRF 299


>gi|51246354|ref|YP_066238.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Desulfotalea psychrophila LSv54]
 gi|81826771|sp|Q6AK95|PUR7_DESPS RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|50877391|emb|CAG37231.1| probable phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Desulfotalea psychrophila LSv54]
          Length = 296

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 100/302 (33%), Positives = 162/302 (53%), Gaps = 37/302 (12%)

Query: 10  PELPNYYSGKVRENYFL--SDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHT 67
           P+L   +SGKVR+ Y +   D   + +ATDR+SA+D  ++ IP KG +L Q++ +WF   
Sbjct: 11  PQLNLVHSGKVRDMYAIPGHDDKLLMVATDRISAYDVILSAIPGKGAILTQLSLFWFDLL 70

Query: 68  SDICSNHTL-----DYPDPNVLVGQQLQM----------FPIELIVRGYLAGNTKTSLLT 112
           +DI  NH +     +YP+      +QL+            PIE IVRGY++G       +
Sbjct: 71  ADIVDNHMITADVTEYPEACAPYAEQLRGRSILVKRTKPLPIECIVRGYISG-------S 123

Query: 113 FYKNGKRK--IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILT 170
           F+K  ++   +  + LP+ M ++ K P P+ TP+TK+       D+ IS   +  + I+ 
Sbjct: 124 FWKAYQQDTNVCGFQLPEGMQESDKFPEPIFTPSTKA--ELGDHDENISFERM--QEIVG 179

Query: 171 RNQWETISSYALSLFERGCKLALENGLILVDSKYEFG-IDKKQNIILADEIHTPDSSRYW 229
             + E I+  + +L+ R    A   G+I+ D+K+E G +D K  IIL DE+ TPDSSR+W
Sbjct: 180 VEKAEQIARISKALYTRAADYARTKGVIIADTKFELGEVDGK--IILIDEVLTPDSSRFW 237

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKI 289
             + YE     G +    DK ++R+++ +         P +PE II++T   Y  A E+I
Sbjct: 238 AADKYEP----GKSQESFDKQYLRDYLSSLDWDKNPPAPPLPEEIIVKTKARYDEAVERI 293

Query: 290 TG 291
           TG
Sbjct: 294 TG 295


>gi|188591312|ref|YP_001795912.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Cupriavidus taiwanensis LMG 19424]
 gi|229564389|sp|B2AHE3|PUR7_CUPTR RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|170938206|emb|CAP63192.1| PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
           [Cupriavidus taiwanensis LMG 19424]
          Length = 302

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 154/308 (50%), Gaps = 34/308 (11%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L ++ I  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLNQ+  +
Sbjct: 5   LYQSSINSLPLLGHGKVRDNYAVGNDKLLIVTTDRLSAFDVIMGEPIPDKGRVLNQMANF 64

Query: 63  WFHHTSDICSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTS 109
           WF   + I  NH        V+             V ++L+   +E +VRGYLAG   + 
Sbjct: 65  WFRKLAHIVPNHETGIAPETVVAADEVEQVRGRAVVVKRLKPILVEAVVRGYLAG---SG 121

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GI 168
              +   GK  +    LP  + + QKLP P+ TP  K+       D+ IS  E+  R GI
Sbjct: 122 WKDYQATGK--VCGIELPPGLQNAQKLPEPIFTPAAKAEMGEH--DENISFAEVEARIGI 177

Query: 169 LTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRY 228
               Q   IS   + L++   + A   G+I+ D+K+EFG+D    + L DE+ T DSSR+
Sbjct: 178 ALARQMREIS---IRLYKEAAEFAATRGIIIADTKFEFGLDDNGVLTLMDEVLTADSSRF 234

Query: 229 WEVETYEKSFREGITPIGLDKDFIRNWI-LTRCN----PYRDNIPDIPENIILRTSQTYI 283
           W  ++Y+     G  P   DK F+R+W+   R +    P     P +P+++I +T+  Y 
Sbjct: 235 WPADSYQV----GTNPPSFDKQFVRDWLEAVRIDGKPWPKTAPAPKLPDDVIEKTAAKYR 290

Query: 284 AAYEKITG 291
            A  ++TG
Sbjct: 291 EALTRLTG 298


>gi|120613192|ref|YP_972870.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax citrulli AAC00-1]
 gi|120591656|gb|ABM35096.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Acidovorax citrulli AAC00-1]
          Length = 308

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 98/307 (31%), Positives = 160/307 (52%), Gaps = 28/307 (9%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L  + +  LP    GKVR+NY + D   + +A+DR+SAFD  +   IP KGE+L ++  +
Sbjct: 9   LHTSSLASLPLLARGKVRDNYAVGDDRILMVASDRISAFDVIMGEPIPGKGELLTKMALF 68

Query: 63  WFHHTSDICSNH-TLDYPDPNV------------LVGQQLQMFPIELIVRGYLAGNTKTS 109
           WF     +C NH T   P+  V            ++ Q+L+  P+E +VRGYLAG+    
Sbjct: 69  WFDKLGHLCPNHLTGGAPESVVSPEEAAQVRGRSMLVQRLRPIPVEAVVRGYLAGSGWKE 128

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGIL 169
                    R +    LP+ +++  +LP P+ TP  K++      D+ I+    +   ++
Sbjct: 129 Y-----QATRSVCGVQLPEGLTNASRLPQPIYTPAAKAAVGEH--DENITFERTVE--MV 179

Query: 170 TRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYW 229
             +    I   +++L+E    +ALE G+I+ D+K+EFG+     ++L DE+ TPDSSRYW
Sbjct: 180 GIDLATKIRDTSIALYEAAAAIALEKGMIIADTKFEFGLAPDGTLVLMDEVLTPDSSRYW 239

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWI---LTRCNPYRDNIPD--IPENIILRTSQTYIA 284
            VE YE +   G  P   DK F+R+W+        P+  + P   +P  +I +T+  Y  
Sbjct: 240 PVEGYEAALAAGENPPSYDKQFVRDWLEQAQVNGAPWNKSAPAPRLPREVIEKTAAKYRE 299

Query: 285 AYEKITG 291
           A E++TG
Sbjct: 300 ALERLTG 306


>gi|325203844|gb|ADY99297.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis M01-240355]
          Length = 287

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH--------TLDYPDPNVL-----VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH         L   +  VL     V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGQTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E   R I      E +
Sbjct: 123 S--VCGIRLPEGMQEAQQLPEVIFTPSTKAA--VGDHDENISFEEC-ERSIGKELAAE-V 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + YE  
Sbjct: 177 RAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQYEV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 236 ---GTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|21222473|ref|NP_628252.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces coelicolor A3(2)]
 gi|256786461|ref|ZP_05524892.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces lividans TK24]
 gi|289770353|ref|ZP_06529731.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces lividans TK24]
 gi|22001878|sp|Q9RKL1|PUR7_STRCO RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|5918473|emb|CAB56351.1| phosphoribosylaminoimidazole-succinocarboxamide synthase (EC
           6.3.2.6) [Streptomyces coelicolor A3(2)]
 gi|289700552|gb|EFD67981.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces lividans TK24]
          Length = 299

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/297 (31%), Positives = 155/297 (52%), Gaps = 28/297 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           +P L + ++GKVRE Y    G  + +A+DR+SA+D  +   IP KG VL Q++ +WF   
Sbjct: 13  VPGLVHLHTGKVRELYRNEAGDLVMVASDRISAYDWVLPTEIPDKGRVLTQLSLWWFDQL 72

Query: 68  SDICSNHTLDYPDP---------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGK 118
           +D+  NH L    P           LV + L+M P+E + RGYL G    S L  Y    
Sbjct: 73  ADLAPNHVLSTELPPGAPADWEGRALVCKSLRMVPVECVARGYLTG----SGLAEYDE-T 127

Query: 119 RKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETIS 178
           R +    LP+ + D  +LP P+ TP TK+       D+ +S  E+  +  +  +    + 
Sbjct: 128 RTVCGLALPEGLVDGSELPAPIFTPATKAEVGEH--DENVSYEEVARQ--VGADTAAALR 183

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSF 238
              L+++ R   +A E G++L D+K+EFG D   +++LADE+ TPDSSR+W  + ++   
Sbjct: 184 QATLAVYSRARDIARERGIVLADTKFEFGFD-GDDLVLADEVLTPDSSRFWPADRWQP-- 240

Query: 239 REGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAAYEKITG 291
             G      DK F+R+W+ +  + +        P +P+ ++  T   Y+ AYE +TG
Sbjct: 241 --GRAQPSYDKQFVRDWLTSAESGWDRKSEQPPPPLPQQVVDATRAKYVEAYELLTG 295


>gi|329120290|ref|ZP_08248958.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Neisseria bacilliformis ATCC BAA-1200]
 gi|327462631|gb|EGF08954.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Neisseria bacilliformis ATCC BAA-1200]
          Length = 286

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 148/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + + T + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LKKTYSGKVRDLYEIDEKTMLIVATDRLSAFDVILPEPIPGKGEILTQISNFWFAKLAHI 65

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGQSVYDVLLESEARAVEKRAVVAKRLTPVKIEAIVRGYLAG---SGWKEYRKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ + + +KLP  + TP+TK+     G D+ IS  E     ++       +
Sbjct: 123 T--VCGIKLPEGLHEAEKLPQVLFTPSTKAE--MGGHDENISFAEC--ERLIGAELAAQV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+      A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + Y   
Sbjct: 177 RDKAVALYTEAAAYAETRGIIICDTKFEFGLDDNGTLTLMDEVLTPDSSRFWPQDQY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            R GI+P   DK F+R+W+       +   P +P  II +T+  Y  A   +T
Sbjct: 234 -RVGISPPSFDKQFVRDWLEQSGWNKQPPAPQVPAEIIGKTAAKYREALRLLT 285


>gi|269218089|ref|ZP_06161943.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269213024|gb|EEZ79364.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 327

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 98/309 (31%), Positives = 165/309 (53%), Gaps = 39/309 (12%)

Query: 9   IPELPNYYSGKVRENYFLS-------DGTRITIATDRLSAFDQNIAC-IPYKGEVLNQIT 60
           +P   + YSGKVR+ Y  S       +   + +A+DR+SA+D  +   IP KG +L Q++
Sbjct: 34  LPGWTHVYSGKVRDVYVPSGVDAHNGEDAYLIVASDRISAYDYVLPTEIPDKGRILTQLS 93

Query: 61  QYWFHHTSDICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
            +WF   SD+  NH +    P  + G     ++L++FP+E +VRGYL G    S +  YK
Sbjct: 94  LWWFEQLSDLTPNHVISTNVPAAVEGRAMITRRLKIFPVECVVRGYLTG----SGMAEYK 149

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR---GILTRN 172
             +  +    LP  + + + L  P+ TPTTK+       DQ I+  +   R   G+    
Sbjct: 150 R-RGTVCGVALPPGIREAECLDRPIFTPTTKA--RLGDHDQSITFADTAARVGEGVAREL 206

Query: 173 QWETISSYALSLFERGCKLALENGLILVDSKYEFGID---KKQNIILADEIHTPDSSRYW 229
           + ++I++YA     R  ++A E G+I+ D+K+EFG+      + IIL DE+ TPDSSR+W
Sbjct: 207 RAKSIATYA-----RAREIAAERGIIIADTKFEFGVSPDAGSEEIILGDEVLTPDSSRFW 261

Query: 230 EVETYEKSFREGITPIGLDKDFIRNWILTRCNPY----RDNIPDIPENIILRTSQTYIAA 285
               YE     G +   LDK F+R+W+ +  + +      + P +P+ ++ +T + Y+  
Sbjct: 262 IANVYEP----GRSQHSLDKQFVRDWLSSEESGWDVSSGTHPPALPDEVVDKTHERYVQI 317

Query: 286 YEKITGLKF 294
           YE +TG ++
Sbjct: 318 YEHLTGSRW 326


>gi|319638375|ref|ZP_07993137.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           mucosa C102]
 gi|317400124|gb|EFV80783.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           mucosa C102]
          Length = 287

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKLAHI 65

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     +
Sbjct: 123 S--VCGIQLPEGMQEAQQLPEVIFTPSTKAA--VGDHDENISFEEC--ERIIGKELAAEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D++  + L DE+ TPDSSR+W  + Y   
Sbjct: 177 RAKAIQLYTEAAEYAKSCGIIICDTKFEFGLDEEGTLTLMDEVLTPDSSRFWPADQY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 -KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|284042287|ref|YP_003392627.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Conexibacter woesei DSM 14684]
 gi|283946508|gb|ADB49252.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Conexibacter woesei DSM 14684]
          Length = 293

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 150/296 (50%), Gaps = 21/296 (7%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQ-NIACIPYKGEVLNQITQYWFHHT 67
           + +LP    GKVRE Y L D T + +A+DR+S +D  +   IP KG+VL  ++ +WF   
Sbjct: 4   LSDLPLVARGKVREIYDLGD-TLLLVASDRISTYDVVHPNTIPDKGKVLTALSVFWFERL 62

Query: 68  SDICSNHTLDYPD--PN-----VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRK 120
             I  NH +   D  P+      LV ++L M P+E +VRGY+ G+     L        K
Sbjct: 63  GAIVPNHYISATDGVPDDVRGRALVVRKLAMLPVECVVRGYITGSGWKDYLA-----TGK 117

Query: 121 IYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSY 180
           +    LP  + ++++LP P+ TP+TK+     G D+ I   + +      R   E +   
Sbjct: 118 VSGLDLPAGLQESEQLPQPLYTPSTKAE---VGHDEAIDFEQTVALLDGDRALAERVRDV 174

Query: 181 ALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFRE 240
           ++ ++ R  + A E G+IL D+K+E G D    + L DE+ TPDSSR+W V  YE     
Sbjct: 175 SIEVYVRAAEHARERGVILADTKFELGRDAAGELTLGDEVLTPDSSRFWPVAGYEP---- 230

Query: 241 GITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
           G      DK  +R+W  +         P+IP  ++ +T   Y+ AYE ITG  F A
Sbjct: 231 GHGQPSFDKQIVRDWASSTDWDKSYPAPEIPAEVVDKTRARYLEAYELITGEPFDA 286


>gi|111226001|ref|YP_716795.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Frankia
           alni ACN14a]
 gi|111153533|emb|CAJ65290.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Frankia alni ACN14a]
          Length = 303

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/300 (31%), Positives = 159/300 (53%), Gaps = 31/300 (10%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           L +  SGKVRE + + D   + +A+DR+SAFD  +   IP KG VL  ++ +WF   SD+
Sbjct: 11  LTHLGSGKVRELFAVGDDAVLLVASDRISAFDVVLPTEIPDKGAVLTGLSLWWFDQLSDL 70

Query: 71  CSNHTL-----DYPDP----------NVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYK 115
             +H +     +YP              ++ ++L M  IE + RGYL G+    L  + +
Sbjct: 71  VPSHVISSNVDEYPAELAPYTEQLRGRSMLCRRLDMVLIECVARGYLTGS---GLKDYQR 127

Query: 116 NGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR-GILTRNQW 174
            G   +  + LP  + D  +LP  + TP+TK+       D+ IS  +   R G     + 
Sbjct: 128 TGA--VSGHPLPAGLVDGSRLPSTIYTPSTKAPIGEH--DENISRADAAGRVGAELAAEL 183

Query: 175 ETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETY 234
           E ++   L +F R   LA E G++L D+K+EFG D +  + LADE+ TPDSSR+W  +T+
Sbjct: 184 ERLT---LQIFGRASDLAAERGILLADTKFEFGHDAEGTLRLADEVLTPDSSRFWPEDTW 240

Query: 235 EKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
                 G++    DK +IR+++ +      +  P++P++++  T   Y+ AYE++TG+ F
Sbjct: 241 SP----GVSQPSFDKQYIRDYLTSTGWDRTEPGPELPDHVVEATRARYVEAYERLTGISF 296


>gi|332971520|gb|EGK10470.1| phosphoribosylaminoimidazole-succinocarboxamide synthetase
           [Kingella kingae ATCC 23330]
          Length = 286

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   I  KGE+L QI+ +WF   + I
Sbjct: 6   LKKIYSGKVRDLYEIDDKIMLIVATDRLSAFDVILDEPIVGKGEILTQISNFWFGKLAHI 65

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE ++RGYL+G   +    + K+G
Sbjct: 66  MPNHFTGQTVFDVLPENEAQAVEKRAVVAKRLTPVKIEAVIRGYLSG---SGWKEYQKSG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+N+ + +KLP  + TP+TK+       D+ IS        I+ + + E +
Sbjct: 123 T--VCGIKLPENLREAEKLPEVIFTPSTKAE--VGDHDENISFERCCE--IIGKERAEEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W VETY+  
Sbjct: 177 RAKAIQLYTEAAEFAKARGIIICDTKFEFGLDENGVLTLMDEVLTPDSSRFWAVETYQV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P +P +++ +T   Y  A   +T
Sbjct: 236 ---GTNPPSFDKQFVRDWLEQSGWNKQPPAPKLPADVLEKTVAKYQEALNVLT 285


>gi|254804637|ref|YP_003082858.1| phosphoribosylaminoimidazole-succinocarboxamidesy nthase [Neisseria
           meningitidis alpha14]
 gi|254668179|emb|CBA04877.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Neisseria
           meningitidis alpha14]
          Length = 287

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF     I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLVHI 65

Query: 71  CSNH--------TLDYPDPNVL-----VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH         L   +  VL     V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGDTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 123 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y   
Sbjct: 177 RAKAVRLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 -KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|163840599|ref|YP_001625004.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Renibacterium salmoninarum ATCC 33209]
 gi|162954075|gb|ABY23590.1| phosphoribosylamidoimidazole-succinocarboxamide synthase
           [Renibacterium salmoninarum ATCC 33209]
          Length = 298

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 90/301 (29%), Positives = 156/301 (51%), Gaps = 28/301 (9%)

Query: 9   IPELPNYYSGKVRENYFLSDGTR---ITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWF 64
           +P   + YSGKVR+ Y  +DG +   + +A+DR+SA+D  +   IP KG +L +++ +WF
Sbjct: 11  LPGWKHVYSGKVRDLYEPADGAQDRVLVVASDRISAYDYVLDTEIPDKGAILTRLSLWWF 70

Query: 65  -------HHTSDICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
                  H  +   ++   +      ++ ++L+MFP+E I RGYL G    S+L  Y+  
Sbjct: 71  DQLEVPNHVLASTVADGVPELVAGRAMICRRLEMFPVECIARGYLTG----SVLAEYRQ- 125

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            + +    LP  + D  +L   + TP+ K+       D+ I    ++    +     ET+
Sbjct: 126 LQSVAGLPLPAGLLDGSRLEEAIFTPSAKAE--VGKHDENIDFAAVVES--VGAEHAETL 181

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            S  L ++ R  ++A E G+IL D+K EFG+D+   + L DE+ TPDSSR+W+   +   
Sbjct: 182 RSLTLDVYRRAEEIARERGIILADTKVEFGLDEAGVVTLGDEVLTPDSSRFWDAALWTP- 240

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGLK 293
              G      DK ++R+W+ +  + +        P +P +++ RT   Y+ AYEK+TG  
Sbjct: 241 ---GQAQASFDKQYVRDWLTSPASGWDRTTNAPPPALPADVVERTRARYVEAYEKLTGET 297

Query: 294 F 294
           F
Sbjct: 298 F 298


>gi|322703878|gb|EFY95480.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Metarhizium anisopliae ARSEF 23]
          Length = 306

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 160/309 (51%), Gaps = 31/309 (10%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSD-GTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
           L+   +P L    SGKVR+ + L D    + +A+DRLSAFD  +   IP KG +L  ++ 
Sbjct: 5   LTTISLPSLQKIASGKVRDLFSLPDPNALLFVASDRLSAFDVVMTNGIPNKGAILTLMSA 64

Query: 62  YWFHHTSD-ICSNHT----LDYP------DPNVLVGQ-----QLQMFPIELIVRGYLAGN 105
           YWF   S+ I S  T    LD P      + +V+  +     +LQ+  IE IVRGY+ G+
Sbjct: 65  YWFRVLSERIPSLRTHFISLDVPAGIPAEEASVVKNRSMQVRKLQVLKIEAIVRGYITGS 124

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
                       +  ++   +P  M   QK P  + TP+TK+   A   D+ I P++   
Sbjct: 125 AWKEY-----QARGTVHGLAMPQGMRLAQKFPSAIYTPSTKAE--AGAHDENIHPDDA-W 176

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
           + I  R   + + + AL++++     A E G+I+ D+K+EF  D + NI L DE+ TPDS
Sbjct: 177 KEIGDRETAKKVEALALTIYKTAAAYAEERGIIIADTKFEFAKDAEGNIYLVDEVLTPDS 236

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  + YE     G  P   DK F+RNW++      ++ +  +PE+I + T + Y  A
Sbjct: 237 SRFWRKDGYEV----GKEPDSFDKQFVRNWLIKEGLKAKEGVT-LPEDICVATGEKYKEA 291

Query: 286 YEKITGLKF 294
           +  +TG KF
Sbjct: 292 FYLLTGTKF 300


>gi|295677570|ref|YP_003606094.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. CCGE1002]
 gi|295437413|gb|ADG16583.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. CCGE1002]
          Length = 296

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/308 (30%), Positives = 153/308 (49%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN +
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNAM 60

Query: 60  TQYWFHHTSDICSNH-------TLDYPDP------NVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH       ++  PD         +V ++L+   +E +VRGYLAG  
Sbjct: 61  ANFWFEKLQHVVPNHLTGVAPESVVAPDEVEQVKGRAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   G   +    LP  + + QKLP P+ TP  K+       D+ I+ +E+  R
Sbjct: 119 -SGWKDYQATGS--VCGVQLPAGLQNAQKLPEPIFTPAAKAEMGHH--DENITYDEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDDVVAKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|197302805|ref|ZP_03167857.1| hypothetical protein RUMLAC_01534 [Ruminococcus lactaris ATCC
           29176]
 gi|197298042|gb|EDY32590.1| hypothetical protein RUMLAC_01534 [Ruminococcus lactaris ATCC
           29176]
          Length = 291

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/301 (33%), Positives = 160/301 (53%), Gaps = 33/301 (10%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHT 67
           + EL     GKVRE Y   D + I +ATDR+S FD  +   +  KG VL Q++++WF  T
Sbjct: 1   MQELKPIKEGKVREIYDNGD-SLIMVATDRISCFDVILNNEVTKKGTVLTQMSKFWFDLT 59

Query: 68  SDICSNH-----TLDYPD--------PNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFY 114
            DI  NH     T D P+           ++ ++L M PIE IVRGY+ G   +   ++ 
Sbjct: 60  EDILPNHMISVDTKDMPEFFQQEKYEGKSMMCRKLNMLPIECIVRGYITG---SGWASYQ 116

Query: 115 KNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSS----ESASGCDQPISPNEIIHRGILT 170
           +NG   +    LP+ + ++ KLP P+ TP+TK+     +     +Q +   E    G   
Sbjct: 117 ENGT--VCGITLPEGLRESDKLPEPIYTPSTKAEIGDHDENISFEQSVDHLEKYFPG-KG 173

Query: 171 RNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWE 230
           R   E +    ++L+++  + AL  G+I+ D+K+EFG+D+  ++++ DE+ TPDSSR+W 
Sbjct: 174 REYAEKLRDNTIALYKKCAEYALSKGIIIADTKFEFGLDENGDLVIGDEMLTPDSSRFWP 233

Query: 231 VETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            E YE     G      DK F R+W+  + NP  D    +P+ I+ +T   Y+ AYE +T
Sbjct: 234 AEGYEP----GHGQPSFDKQFARDWL--KANPGNDWT--LPQEIVDKTIDKYLQAYEMLT 285

Query: 291 G 291
           G
Sbjct: 286 G 286


>gi|91785088|ref|YP_560294.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia xenovorans LB400]
 gi|91689042|gb|ABE32242.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia xenovorans LB400]
          Length = 296

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/308 (29%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN++
Sbjct: 1   MSTLYESTLHSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNEM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFP-------------IELIVRGYLAGNT 106
             +WF     +  NH       +V+   +++                +E +VRGYLAG  
Sbjct: 61  ANFWFEKLKHVVPNHLTGVAPESVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   G   +    LP  + + QKLP P+ TP  K+       D+ I+ +E+  R
Sbjct: 119 -SGWKDYQATGS--VCGVELPPGLQNAQKLPEPIFTPAAKAE--MGHHDENITYDEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIKLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDDVVAKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|325144205|gb|EGC66512.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis M01-240013]
 gi|325206401|gb|ADZ01854.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis M04-240196]
          Length = 287

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 150/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH--------TLDYPDPNVL-----VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH         L   +  VL     V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGQTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E   R I      E +
Sbjct: 123 S--VCGIRLPEGMQEAQQLPEVIFTPSTKAA--VGDHDENISFEEC-ERSIGKELAAE-V 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + YE  
Sbjct: 177 RAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDENGRLTLMDEVLTPDSSRFWPADQYEV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 236 ---GTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|139439879|ref|ZP_01773244.1| Hypothetical protein COLAER_02279 [Collinsella aerofaciens ATCC
           25986]
 gi|133774807|gb|EBA38627.1| Hypothetical protein COLAER_02279 [Collinsella aerofaciens ATCC
           25986]
          Length = 292

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 106/299 (35%), Positives = 158/299 (52%), Gaps = 40/299 (13%)

Query: 18  GKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNHTL 76
           GKVR+ Y   +   + +ATDR+SAFD  +   IP+KGEVLN+I+ +WF   +DI  NH +
Sbjct: 9   GKVRDIYDAGENL-LMVATDRISAFDFILPDEIPFKGEVLNRISAFWFDKFADIVPNHLV 67

Query: 77  ---------------DYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKI 121
                          DY     ++ ++ Q  PIE IVRGYL G+ K    T+ +NG   +
Sbjct: 68  SIDPAEFPEEFAEYRDYLAGRAMLVKKAQTIPIECIVRGYLTGSGKK---TYDENG--TV 122

Query: 122 YEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHRGILTRNQWETIS 178
               LP+ +++  KLP P+ TP+TK+       D+ IS     EI+   I T+     I 
Sbjct: 123 CGIQLPEGLTEASKLPEPLFTPSTKA--EIGDHDENISFERCCEIVGEDIATQ-----IR 175

Query: 179 SYALSLFERGCKLALENGLILVDSKYEFG-IDKKQNIILADEIHTPDSSRYWEVETYEKS 237
             +L +++   + A   G+I+ D+K+EFG ID K  + L DE  TPDSSR+W   +YE  
Sbjct: 176 DLSLKIYKAAAEYAATRGIIIADTKFEFGVIDGK--VTLIDECLTPDSSRFWPAASYE-- 231

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFIA 296
             EG      DK F+RNW+    +      P +P  +I  TS+ Y  A++ ITG +F +
Sbjct: 232 --EGKIQPSYDKQFVRNWLKANWD-MTGETPHLPAEVIDGTSERYREAFQIITGSQFTS 287


>gi|121608519|ref|YP_996326.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Verminephrobacter eiseniae EF01-2]
 gi|121553159|gb|ABM57308.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Verminephrobacter eiseniae EF01-2]
          Length = 325

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 99/309 (32%), Positives = 151/309 (48%), Gaps = 30/309 (9%)

Query: 3   ILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQ 61
           +L  + +  LP    GKVR+NY +     + +A+DRLSAFD  +   IP KG +L Q+  
Sbjct: 26  VLHTSALTSLPLLARGKVRDNYAVGQDRILMVASDRLSAFDVIMGEPIPGKGALLTQMAL 85

Query: 62  YWFHHTSDICSNHTLDYPDPNVLVG--------------QQLQMFPIELIVRGYLAGNTK 107
           +WF     +C NH L   DP  +V               Q+L   PIE +VRGYLAG+  
Sbjct: 86  FWFDQLGHLCPNH-LTGADPESVVSAREAPQIRGRSMLVQRLAPIPIEAVVRGYLAGSGW 144

Query: 108 TSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
                      + I    LP  + +  +LP P+ TP TK+   A   D+ IS    +   
Sbjct: 145 KEY-----QATQSICGLPLPAGLGNAARLPEPIYTPATKAM--AGEHDENISFARTV--A 195

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
           ++  +    I   ++++++    +AL  GLI+ DSK+EFG+     ++L DE+ TPDSSR
Sbjct: 196 LIGPDLATRIRDLSIAIYQTAAAIALAKGLIIADSKFEFGLAPDGRLVLMDEVLTPDSSR 255

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWI---LTRCNPYRDN--IPDIPENIILRTSQTY 282
           YW V  Y  +   G  P   DK F+R+W+        P+      P +P+ +I  T+  Y
Sbjct: 256 YWPVAGYAAALAAGRNPPSYDKQFVRDWLEQAQVGGRPWDKTPPAPRLPQAVIESTAAKY 315

Query: 283 IAAYEKITG 291
             A E++T 
Sbjct: 316 REALERLTA 324


>gi|90265705|dbj|BAE91899.1| Phosphoribosyl-amino- imidazolesuccinocarbozamide synthetase
           [Pichia minuta]
          Length = 303

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 93/308 (30%), Positives = 158/308 (51%), Gaps = 42/308 (13%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y + + + + +ATDR+SA+D  +   I  KG++L Q++ +WF    D 
Sbjct: 12  LPLIAKGKVRDIYQVDEESLLFVATDRISAYDVIMENGIKDKGKILTQLSVFWFDLLKDT 71

Query: 71  CSNHTLDYPDPNV---------------------LVGQQLQMFPIELIVRGYLAGNTKTS 109
             NH +   D  V                     LV ++ ++ P+E+IVRGY+ G+    
Sbjct: 72  IKNHLIASTDDEVFARLPQELSQPKYKSQLSGRALVVRKHKLIPLEVIVRGYITGSAWKE 131

Query: 110 LLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPN---EIIHR 166
                 N  + ++   +   + ++Q+ P P+ TP+TK+ +     D+ ISP    EI+  
Sbjct: 132 Y-----NKSKTVHGLEVGAELKESQEFPVPIFTPSTKAEQGEH--DENISPEKAAEIVGE 184

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            +  R     ++  A+ L+ +    A   G+IL D+K+EFGID+   ++L DE+ TPDSS
Sbjct: 185 QLCAR-----LAEKAVQLYSKARTYAKSKGIILADTKFEFGIDENDELVLVDEVLTPDSS 239

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W+ +TY    + G +    DK F+R+W+ +     +D +    E I  RT   Y+ A+
Sbjct: 240 RFWDAKTY----KIGQSQDSYDKQFLRDWLTSNGLNGKDGVSMTAE-IAERTGAKYVEAF 294

Query: 287 EKITGLKF 294
           E +TG K+
Sbjct: 295 ESLTGRKW 302


>gi|225023983|ref|ZP_03713175.1| hypothetical protein EIKCOROL_00850 [Eikenella corrodens ATCC
           23834]
 gi|224943008|gb|EEG24217.1| hypothetical protein EIKCOROL_00850 [Eikenella corrodens ATCC
           23834]
          Length = 286

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y +   + + +A+DRLSAFD  +   IP KGE+L QI+ +WF   S I
Sbjct: 6   LKKIYSGKVRDLYEIDSRSMLIVASDRLSAFDVILNEPIPGKGEILTQISNFWFGKLSHI 65

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L+   IE IVRGYLAG   +    + + G
Sbjct: 66  MPNHFTGQTVYDVLPHDVAAALEKRAVVAKRLEPLKIEAIVRGYLAG---SGWKEYRQTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+N+ + ++LP  + TP+TK++      D  IS +E     I+ +   E +
Sbjct: 123 A--VCGIRLPENLREAEQLPEIIFTPSTKAA--VGNHDINISFDECAR--IIGQELAEEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y   
Sbjct: 177 RRKAIALYSEAAEYARTRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            R G  P   DK FIR+W+       +   P +P  +I +T   Y  A E +T
Sbjct: 234 -RPGSNPPSFDKQFIRDWLEQSGWNKQPPAPAVPAEVIEKTLAKYREALELLT 285


>gi|329908776|ref|ZP_08274954.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327546609|gb|EGF31579.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 309

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 95/306 (31%), Positives = 150/306 (49%), Gaps = 28/306 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQI 59
           M  L ++ IP LP    GKVR+NY + D   + + TDRLSAFD  +   IP KG VLNQ+
Sbjct: 12  MTSLYQSEIPSLPLLGRGKVRDNYAVGDDQILIVTTDRLSAFDVVMNEAIPAKGRVLNQM 71

Query: 60  TQYWFHHTSDICSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
           + +WF   + I  NH              +D      +V ++LQ   +E +VRGYL G  
Sbjct: 72  SNFWFEKLAAIVPNHLTGVTPESVVQANEIDQVRGRAVVAKRLQPIMVEAVVRGYLIG-- 129

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   G   +    LP  +    KL  P+ TP  K+       D+ IS  ++  R
Sbjct: 130 -SGWKDYQATGA--VCGVALPAGLRQADKLAAPIFTPAAKAELGEH--DENISFADMEQR 184

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +       +   +++L++     A   G+I+ D+K+EFG+D    + L DE+ T DSS
Sbjct: 185 --IGAELAAKMRDVSIALYQAAADYAATRGIIIADTKFEFGLDADGTMYLMDEVLTADSS 242

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCN-PYRDNIPDIPENIILRTSQTYIAA 285
           R+W  ++Y      G +P   DK F+R+++ T  + P     P +P ++I +T   Y  A
Sbjct: 243 RFWPADSYAP----GSSPPSFDKQFVRDYLETLTDWPKTAPAPTLPADVIAKTGAKYREA 298

Query: 286 YEKITG 291
            E++TG
Sbjct: 299 LERLTG 304


>gi|1709931|sp|P50124|PUR7_PICJA RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|391937|dbj|BAA04175.1| phosphoribosylaminoimidazolesuccinocarboxamide synthetase [Pichia
           jadinii]
 gi|740931|prf||2006225A phosphoribosylaminoimidazolesuccinocarboxamide synthetase
          Length = 301

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 93/303 (30%), Positives = 159/303 (52%), Gaps = 34/303 (11%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y + + T + +ATDR+SA+D  +   IP KG++L Q++++WF      
Sbjct: 12  LPLVARGKVRDIYEVDEKTLLFVATDRISAYDVIMENGIPQKGQLLTQLSEFWFEFLKPY 71

Query: 71  CSNHTLDYPD-----PNVLV----GQQLQ----------MFPIELIVRGYLAGNTKTSLL 111
              H ++  D     P VL       QLQ          + P+E+IVRGY+ G   ++  
Sbjct: 72  IKTHLIEVDDIFAHLPKVLSEDRYKSQLQGGSLLVRKYKLVPLEVIVRGYITG---SAWK 128

Query: 112 TFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTR 171
            + K+G   ++     + + ++Q+ P P+ TP+TK+ +     D+ IS  +     I+ +
Sbjct: 129 VYKKSGT--VHGVKAAEGLQESQEFPTPIFTPSTKAEQGEH--DENISVEQ--AEAIVGK 182

Query: 172 NQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEV 231
              + I   A+ L+ +    A   G+I+ D+K+EFG+D    ++L DE+ TPDSSR+W  
Sbjct: 183 ELADKIGKVAVELYSKAKGYAAGRGIIIADTKFEFGLDDDNELVLVDEVLTPDSSRFWNA 242

Query: 232 ETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           +TYE     G      DK F+R+W+ +     ++ +  + E+I  R+   Y+ AYE +TG
Sbjct: 243 KTYEV----GKGQDSYDKQFLRDWLTSNGLAGKEGVS-MTEDIATRSRVKYVEAYEALTG 297

Query: 292 LKF 294
            K+
Sbjct: 298 KKW 300


>gi|307730880|ref|YP_003908104.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. CCGE1003]
 gi|307585415|gb|ADN58813.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. CCGE1003]
          Length = 296

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 92/308 (29%), Positives = 150/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN++
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNEM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFP-------------IELIVRGYLAGNT 106
             +WF     +  NH       +V+   +++                +E +VRGYLAG  
Sbjct: 61  ANFWFEKLKHVVPNHLTGVAPESVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   G   +    LP  + + QKLP P+ TP  K+       D+ I+ +E+  R
Sbjct: 119 -SGWKDYQATGS--VCGVQLPPGLQNAQKLPEPIFTPAAKAEMGHH--DENITYDEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLETQDWAKEPPAPKLPDDVVQKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|119899163|ref|YP_934376.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Azoarcus
           sp. BH72]
 gi|166229528|sp|A1K9I4|PUR7_AZOSB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|119671576|emb|CAL95489.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Azoarcus
           sp. BH72]
          Length = 311

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 100/317 (31%), Positives = 153/317 (48%), Gaps = 37/317 (11%)

Query: 4   LSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQY 62
           L ++ I  LP    GKVR+ Y +     + + +DRLSAFD  +   IP KG VL  +  +
Sbjct: 5   LFESTIKSLPLLGRGKVRDIYAVDADKLLIVTSDRLSAFDVILPNPIPDKGRVLTAMANF 64

Query: 63  WFHHTSDICSNHTLDYPDPN--------------VLVGQQLQMFPIELIVRGYLAGNTKT 108
           WF     I  N  L   DP                LV ++L+  PIE +VRGY+ G   +
Sbjct: 65  WFAKLGHIVPNQ-LTGIDPESVVAADEREQVKGRALVVKRLKPLPIEAVVRGYVIG---S 120

Query: 109 SLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKS-----------SESASGCDQP 157
               +   G   I    LP  +    KLP P+ TP +K+           +++ + CD  
Sbjct: 121 GWKDYQDTGA--ICGIALPAGLKQAAKLPAPIFTPASKAEVGDHDENISFAQAQANCDAV 178

Query: 158 ISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILA 217
           ++   +   G       E     A++L+ +    A   G+I+ D+K+EFGID    + L 
Sbjct: 179 LA-EALAGTGKTGAGLAEEARQAAIALYSQAADYAAGRGIIIADTKFEFGIDAAGTLHLI 237

Query: 218 DEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILR 277
           DE  TPDSSR+W  ++Y    REGI+P   DK ++R+++ T     +   PD+P +++ R
Sbjct: 238 DEALTPDSSRFWPADSY----REGISPPSYDKQYVRDYLETLDWNKKAPGPDLPADVVER 293

Query: 278 TSQTYIAAYEKITGLKF 294
           T+  Y  AYEK+TGL  
Sbjct: 294 TAAKYREAYEKLTGLTL 310


>gi|319950170|ref|ZP_08024102.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Dietzia
           cinnamea P4]
 gi|319436158|gb|EFV91346.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Dietzia
           cinnamea P4]
          Length = 297

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 156/302 (51%), Gaps = 33/302 (10%)

Query: 10  PELPNY---YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFH 65
           P+L +Y    SGKVRE Y + D T + +ATDR+SA+D  +   IP KG VL  ++ ++F 
Sbjct: 3   PDLSSYRHLVSGKVRELYEIDDETLLMVATDRISAYDHVLGTPIPDKGRVLTAMSAFFFD 62

Query: 66  HTSDICSNHTLDYPDPN---------VLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKN 116
                  NH     D            +V ++L M   E + RGYL G    S +T Y+ 
Sbjct: 63  ALD--VPNHLAGPLDDERIPAEVLGRAMVVRRLDMVQAECVARGYLTG----SGITEYRE 116

Query: 117 GKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWET 176
               +    LPD + +  KLP P+ TP TK+  +    D+ IS +++    I+     E 
Sbjct: 117 SG-TVCGIELPDGLVEASKLPEPIFTPATKA--AVGDHDENISFDQLTR--IVGDELAER 171

Query: 177 ISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEK 236
           + S  L ++ R  ++A + G++L D+K+EFG+   + +ILADE+ TPDSSRYW  + Y  
Sbjct: 172 LRSETLDIYSRAAEIAADRGVLLADTKFEFGLADGE-LILADEVLTPDSSRYWPADDYSP 230

Query: 237 SFREGITPIGLDKDFIRNWILTRCNPYRDNI----PDIPENIILRTSQTYIAAYEKITGL 292
               G      DK F+RNW+      +  +     P +P+ ++  T + YI AYE+I+GL
Sbjct: 231 ----GRVQPSFDKQFVRNWLTGPEAGWNKDADTPPPVLPDAVVAATRERYIEAYERISGL 286

Query: 293 KF 294
            F
Sbjct: 287 SF 288


>gi|126139759|ref|XP_001386402.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Scheffersomyces stipitis CBS 6054]
 gi|126093684|gb|ABN68373.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR
           synthetase) [Scheffersomyces stipitis CBS 6054]
          Length = 306

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 163/310 (52%), Gaps = 40/310 (12%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y + + T + +ATDR+SA+D  +   +P KG++L +++++WF   S  
Sbjct: 12  LPLVTRGKVRDIYQVDENTLLFVATDRISAYDVIMDNAVPEKGKLLTKLSEFWFEFLSQT 71

Query: 71  CSNH------------------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNT 106
             NH                         L     ++LV ++L++ P+E+IVRGY+ G  
Sbjct: 72  IPNHLILSKNDDESLFAKLPAQLSEAKYKLQLSGRSLLV-RKLKLIPLEVIVRGYITG-- 128

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
             S    YK   + ++   +   + ++Q+   P+ TP+TK+ +     D+ ISP +    
Sbjct: 129 --SAWKEYKK-TQTVHGLSVEAGLLESQEFATPIFTPSTKADQGEH--DENISPEKAAE- 182

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
            I+ +   + ++  A+ L+ +  + A   G+I+ D+K+EFG+D   N++L DE+ TPDSS
Sbjct: 183 -IVGQELCDKLAKAAIELYTKAKEYAKTRGIIIADTKFEFGLDTDHNLVLVDEVLTPDSS 241

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W    Y    + G +    DK F+R+W+ +     +D +  + E+I+ RT   YI AY
Sbjct: 242 RFWNASAY----KLGKSQESYDKQFLRDWLTSNGIAGKDGVK-MDEDIVARTRAKYIEAY 296

Query: 287 EKITGLKFIA 296
           E ITG K+ +
Sbjct: 297 EAITGDKWTS 306


>gi|330504104|ref|YP_004380973.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas mendocina NK-01]
 gi|328918390|gb|AEB59221.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudomonas mendocina NK-01]
          Length = 289

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 91/294 (30%), Positives = 148/294 (50%), Gaps = 27/294 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KG++L  I+ +WF   +D+
Sbjct: 9   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDIILEQPIPEKGKILTAISNFWFDKLADV 68

Query: 71  CSNH-------------TLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH              L   +   +V ++L+   +E IVRGY+ G+       + K+G
Sbjct: 69  VPNHFTGDKVEDVVSAAELPLVEGRAVVAKRLKPVAVEAIVRGYIVGS---GWKEYQKSG 125

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP  + +  KLP P+ TP+TK++      D+ IS  +     I+       +
Sbjct: 126 T--VCGIALPAGLKEAAKLPQPIFTPSTKAA--VGDHDENISFEQC--EAIIGAELAAKV 179

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  ++Y   
Sbjct: 180 RDTAIKLYTTAVEYAATRGIIIADTKFEFGLDEDGTLTLMDEVLTPDSSRFWPADSYA-- 237

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
             EG  P   DK F+R+W+ +     +   P +P  +  +T+  Y  A  ++T 
Sbjct: 238 --EGSNPPSFDKQFVRDWLESTGWNKQPPAPAVPTEVAQKTADKYREALTRLTA 289


>gi|314968615|gb|EFT12713.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL037PA1]
          Length = 420

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 89/291 (30%), Positives = 153/291 (52%), Gaps = 24/291 (8%)

Query: 12  LPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTS 68
           LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++ +WF   +
Sbjct: 8   LPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMSLWWFDQLA 67

Query: 69  DICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           DI  NH +    P  + G     ++L MFP+E +VRGYL G   +    + +N  + +  
Sbjct: 68  DIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTG---SGWAEYQRN--QAVCG 122

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ + +  +L  P+ TP  K+ +     D+ I    ++   ++  +    +   +L 
Sbjct: 123 IRLPEGLQNGSRLEEPIFTPAIKAPQGEH--DENIDYLRLVE--LVGPDVAAQLHDLSLR 178

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           +++R  ++A + G++L D+K+EFG      I+LADE+ TPDSSR+W+ ET++     G  
Sbjct: 179 VYQRAEEIARKRGILLADTKFEFGRRVDGTIVLADEVLTPDSSRFWDAETWQP----GKG 234

Query: 244 PIGLDKDFIRNWILTRCNPYR---DNIPDIPENIILRTSQTYIAAYEKITG 291
               DK ++R+W+       R      P +PE ++  TS+ Y  A+ ++TG
Sbjct: 235 ADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTG 285


>gi|271963122|ref|YP_003337318.1| phosphoribosylaminoimidazolesuccinocarboxamidesynthase
           [Streptosporangium roseum DSM 43021]
 gi|270506297|gb|ACZ84575.1| Phosphoribosylaminoimidazolesuccinocarboxamidesy nthase
           [Streptosporangium roseum DSM 43021]
          Length = 276

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 150/284 (52%), Gaps = 23/284 (8%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNH 74
           +SGKVR+ Y    G  + +A+DR+S +D  +   IP KG++L Q++ +WF   +DI  NH
Sbjct: 5   HSGKVRDVY-EDRGDIVLVASDRVSVYDVILPTPIPDKGKILTQLSLWWFEQLADIVPNH 63

Query: 75  TLDYPD-PNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            +   D P    G+     +L+M  +E + RGYL G   + L  +   G+  +    LP 
Sbjct: 64  VVSATDVPAEFEGRAVRCRKLKMVQVECVARGYLTG---SGLKDYQARGE--VSGVPLPP 118

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEII-HRGILTRNQWETISSYALSLFER 187
            + D  +LP P+ TP+TK+       D+PI+ ++++   G     +   I+   L+++ R
Sbjct: 119 GLVDGSRLPEPIFTPSTKAPLGQH--DEPITFDDVVAQEGAEVAGELRRIT---LAVYGR 173

Query: 188 GCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGL 247
           G +LA E G+I+ D+K E G      ++L DE+ T DSSR+W  + +E     G      
Sbjct: 174 GAELARERGVIIADTKIELGWAADGTLVLGDEVLTSDSSRFWPADQWEP----GRAQFSF 229

Query: 248 DKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
           DK F+R+W        ++  P++P  I+  T   Y+ AYE+ITG
Sbjct: 230 DKQFVRDWATGTGWDKQEPAPEVPAEIVEITRARYVEAYERITG 273


>gi|313763793|gb|EFS35157.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL013PA1]
 gi|313817044|gb|EFS54758.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL059PA1]
 gi|313829850|gb|EFS67564.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL063PA2]
 gi|314916614|gb|EFS80445.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL005PA4]
 gi|314919454|gb|EFS83285.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL050PA1]
 gi|314920936|gb|EFS84767.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL050PA3]
 gi|314932342|gb|EFS96173.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL067PA1]
 gi|314956793|gb|EFT00987.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL027PA1]
 gi|314959645|gb|EFT03747.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL002PA1]
 gi|315100114|gb|EFT72090.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL059PA2]
 gi|315102436|gb|EFT74412.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL046PA1]
 gi|315109648|gb|EFT81624.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL030PA2]
 gi|327335350|gb|EGE77059.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL097PA1]
 gi|327457905|gb|EGF04560.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL083PA2]
 gi|328757772|gb|EGF71388.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL025PA2]
          Length = 420

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 89/291 (30%), Positives = 153/291 (52%), Gaps = 24/291 (8%)

Query: 12  LPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTS 68
           LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++ +WF   +
Sbjct: 8   LPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMSLWWFDQLA 67

Query: 69  DICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           DI  NH +    P  + G     ++L MFP+E +VRGYL G   +    + +N  + +  
Sbjct: 68  DIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTG---SGWAEYQRN--QAVCG 122

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ + +  +L  P+ TP  K+ +     D+ I    ++   ++  +    +   +L 
Sbjct: 123 IRLPEGLQNGSRLEEPIFTPAIKAPQGEH--DENIDYLRLVE--LVGPDVAAQLHDLSLR 178

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           +++R  ++A + G++L D+K+EFG      I+LADE+ TPDSSR+W+ ET++     G  
Sbjct: 179 VYQRAEEIARKRGILLADTKFEFGRRVDGTIVLADEVLTPDSSRFWDAETWQP----GKG 234

Query: 244 PIGLDKDFIRNWILTRCNPYR---DNIPDIPENIILRTSQTYIAAYEKITG 291
               DK ++R+W+       R      P +PE ++  TS+ Y  A+ ++TG
Sbjct: 235 ADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTG 285


>gi|309378198|emb|CBX23170.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 287

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH--------TLDYPDPNVL-----VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH         L   +  VL     V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGDTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     +
Sbjct: 123 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEEC--ERIIGKELAAEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + YE  
Sbjct: 177 RDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQYEV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 236 ---GTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYQEALTLLT 285


>gi|302877284|ref|YP_003845848.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gallionella capsiferriformans ES-2]
 gi|302580073|gb|ADL54084.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Gallionella capsiferriformans ES-2]
          Length = 294

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 95/306 (31%), Positives = 153/306 (50%), Gaps = 28/306 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP  + GKVR+ Y +     + + TDRLSAFD  +   IP KGEVL  +
Sbjct: 1   MSALHESNLTSLPLLHRGKVRDLYEVDAQHLLIVQTDRLSAFDVILDDPIPGKGEVLTTL 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVG--------------QQLQMFPIELIVRGYLAGN 105
           + +WF     I  NH       +V+ G              ++L+  PIE IVRGYL G 
Sbjct: 61  SNFWFKKLGHIIPNHLSGIAPESVVKGDAEQAQVRGRSFVTKKLKPLPIEAIVRGYLVG- 119

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
             +    + K G   I    LP  + + QKLP P+ TP+TK++      D+ IS  + + 
Sbjct: 120 --SGWKDYQKTGT--ICGLALPAGLREAQKLPEPLFTPSTKAA--VGDHDENISYAQAVE 173

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
             +L   +   +    ++L+      A   G+I+ D+K+EFG+D+   + L DE  TPDS
Sbjct: 174 --LLGEARAAQVRDATVALYVEAANYAASRGIIIADTKFEFGVDEAGTLYLIDEALTPDS 231

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W  E+Y+     G  P   DK F+R+W+       +   P +P++++ +T+  Y  A
Sbjct: 232 SRFWPAESYQV----GSNPPSFDKQFVRDWLEASDWNKQAPAPRVPQDVLQKTADKYHEA 287

Query: 286 YEKITG 291
            +++T 
Sbjct: 288 LQRLTA 293


>gi|327455758|gb|EGF02413.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL087PA3]
 gi|328757074|gb|EGF70690.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Propionibacterium acnes HL087PA1]
          Length = 420

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 89/291 (30%), Positives = 153/291 (52%), Gaps = 24/291 (8%)

Query: 12  LPNYYSGKVRENYFLSD--GTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTS 68
           LP    GKVR  Y L D  G  + +ATDR+SA+D  +   +P KG +L  ++ +WF   +
Sbjct: 8   LPLLAEGKVRRLYRLPDQPGRLLMVATDRISAYDHVLTPDVPGKGAILTNMSLWWFDQLA 67

Query: 69  DICSNHTLDYPDPNVLVG-----QQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYE 123
           DI  NH +    P  + G     ++L MFP+E +VRGYL G   +    + +N  + +  
Sbjct: 68  DIVDNHLVSVDVPAEVAGRAMVVEELDMFPVECVVRGYLTG---SGWAEYQRN--QAVCG 122

Query: 124 YLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALS 183
             LP+ + +  +L  P+ TP  K+ +     D+ I    ++   ++  +    +   +L 
Sbjct: 123 IRLPEGLQNGSRLEEPIFTPAIKAPQGEH--DENIDYLRLVE--LVGPDVAAQLHDLSLR 178

Query: 184 LFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGIT 243
           +++R  ++A + G++L D+K+EFG      I+LADE+ TPDSSR+W+ ET++     G  
Sbjct: 179 VYQRAEEIARKRGILLADTKFEFGRRVDGTIVLADEVLTPDSSRFWDAETWQP----GKG 234

Query: 244 PIGLDKDFIRNWILTRCNPYR---DNIPDIPENIILRTSQTYIAAYEKITG 291
               DK ++R+W+       R      P +PE ++  TS+ Y  A+ ++TG
Sbjct: 235 ADSFDKQYVRDWLTNESGWDRASDQEPPALPEEVVKATSRRYEEAWARLTG 285


>gi|313668763|ref|YP_004049047.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           lactamica ST-640]
 gi|313006225|emb|CBN87687.1| putative phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Neisseria lactamica 020-06]
          Length = 287

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPGKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH--------TLDYPDPNVL-----VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH         L   +  VL     V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGDTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     +
Sbjct: 123 S--VCGIRLPEGMREAQQLPEVIFTPSTKAA--VGDHDENISFEEC--ERIIGKELAAEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + YE  
Sbjct: 177 RDKAVRLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQYEV- 235

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 236 ---GTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|254669728|emb|CBA03897.1| phosphoribosylaminoimidazole-succinocarboxamidesynthase [Neisseria
           meningitidis alpha153]
          Length = 287

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAHI 65

Query: 71  CSNH--------TLDYPDPNVL-----VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH         L   +  VL     V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGDTVYDVLPENEAKVLEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +     +
Sbjct: 123 S--VCGIQLPEGMQEAQQLPEVIFTPSTKAA--VGDHDENISFEEC--ERIIGKELAAEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D    + L DE+ TPDSSR+W  + Y   
Sbjct: 177 RAKAIQLYTEAAEYAKSRGIIICDTKFEFGLDTNGTLTLMDEVLTPDSSRFWPADQY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 -KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|323527243|ref|YP_004229396.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. CCGE1001]
 gi|323384245|gb|ADX56336.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. CCGE1001]
          Length = 296

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 92/308 (29%), Positives = 149/308 (48%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN++
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNEM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVGQQLQMFP-------------IELIVRGYLAGNT 106
             +WF     +  NH       +V+   +++                +E +VRGYLAG  
Sbjct: 61  ANFWFEKLQHVVPNHLTGVAPESVVAADEVEQVKGRAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   G   +    LP  + + QKLP P+ TP  K+       D+ I+ +E+  R
Sbjct: 119 -SGWKDYQATGS--VCGVQLPPGLQNAQKLPEPIFTPAAKAE--MGHHDENITYDEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNHGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+ T+        P +P+ ++ +T + Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLETQDWAKEPPAPKLPDEVVQKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|209518347|ref|ZP_03267172.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. H160]
 gi|209501266|gb|EEA01297.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Burkholderia sp. H160]
          Length = 296

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 95/308 (30%), Positives = 152/308 (49%), Gaps = 27/308 (8%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L ++ +  LP    GKVR+NY + +   + + TDRLSAFD  +   IP KG VLN +
Sbjct: 1   MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVIMGEPIPNKGRVLNAM 60

Query: 60  TQYWFHHTSDICSNH-------TLDYPDP------NVLVGQQLQMFPIELIVRGYLAGNT 106
             +WF     +  NH       ++  PD         +V ++L+   +E +VRGYLAG  
Sbjct: 61  ANFWFEKLQHVVPNHLTGVAPESVVAPDEVEQVKGRAVVVKRLEPILVEAVVRGYLAG-- 118

Query: 107 KTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHR 166
            +    +   G   +    LP  + + QKLP P+ TP  K+       D+ I+  E+  R
Sbjct: 119 -SGWKDYQATGS--VCGVQLPPGLQNAQKLPEPIFTPAAKAEMGHH--DENITYEEMERR 173

Query: 167 GILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSS 226
             +      TI   ++ L++     A   G+I+ D+K+EFG+D    + L DE  T DSS
Sbjct: 174 --IGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDNNGKLYLMDEALTADSS 231

Query: 227 RYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAY 286
           R+W  + Y+     G  P   DK F+R+W+ T+        P +P++++ +T + Y  A 
Sbjct: 232 RFWPADQYQV----GTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDDVVAKTGEKYQEAL 287

Query: 287 EKITGLKF 294
           E++TG K 
Sbjct: 288 ERLTGHKL 295


>gi|237748716|ref|ZP_04579196.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oxalobacter formigenes OXCC13]
 gi|229380078|gb|EEO30169.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Oxalobacter formigenes OXCC13]
          Length = 292

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 151/306 (49%), Gaps = 29/306 (9%)

Query: 1   MRILSKAYIPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQI 59
           M  L K  I  LP  + GKVR+ Y + D   + + TDRLSAFD  +   IP KG +L  +
Sbjct: 1   MPGLMKTQIKSLPFLHRGKVRDIYAVGDDKLLVVQTDRLSAFDVIMEDPIPNKGRILTAM 60

Query: 60  TQYWFHHTSDICSNHTLDYPDPNVLVG--------------QQLQMFPIELIVRGYLAGN 105
           + +WF     +  NH  D  DP  LV               ++ +  PIE IVRGY+ G 
Sbjct: 61  SNFWFKKFGHLMPNHMTDI-DPESLVAPHERDQVRGRAIVVKKYKAIPIEAIVRGYIIG- 118

Query: 106 TKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIH 165
             T    + + G   I    LP  + + QKLP  + TP+TK+       DQ IS  ++  
Sbjct: 119 --TGWKDYQQTGA--ICGIKLPAGLKEAQKLPEVIFTPSTKAD--VGEHDQNISFEKM-- 170

Query: 166 RGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDS 225
           + I+     E +   A++L+    + A   G+++ D+K+EFG+D    I L DEI TPDS
Sbjct: 171 KEIVGAEVAEKVREMAITLYREAAEFAATKGILIADTKFEFGMDDDGKIYLIDEILTPDS 230

Query: 226 SRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAA 285
           SR+W + +YE     G++P   DK ++R+W+  +        P +P  +  +T++ Y  A
Sbjct: 231 SRFWPLSSYEV----GMSPPSFDKQYVRDWLSAQPWDKTAPAPRLPLEVAEKTTEKYNEA 286

Query: 286 YEKITG 291
              +T 
Sbjct: 287 LRLLTA 292


>gi|15676655|ref|NP_273799.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis MC58]
 gi|22001875|sp|Q9K063|PUR7_NEIMB RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide
           synthase; AltName: Full=SAICAR synthetase
 gi|7225987|gb|AAF41170.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis MC58]
 gi|325140089|gb|EGC62618.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Neisseria
           meningitidis CU385]
          Length = 287

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   Y GKVR+ Y + D   + +A+DRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 6   LVKIYFGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFKKLAHI 65

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    +E IVRGYLAG   +    + K G
Sbjct: 66  MPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAG---SGWKDYQKTG 122

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+ M + Q+LP  + TP+TK++      D+ IS  E     I+ +   E +
Sbjct: 123 S--VCGIQLPEGMQEAQQLPEVIFTPSTKAA--VGDHDENISFEECGR--IIGKELAEEV 176

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W  + Y   
Sbjct: 177 RAKAVRLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQY--- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
            + G  P   DK F+R+W+       +   P +P ++I +T + Y  A   +T
Sbjct: 234 -KVGTNPPSFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLT 285


>gi|331694312|ref|YP_004330551.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudonocardia dioxanivorans CB1190]
 gi|326949001|gb|AEA22698.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Pseudonocardia dioxanivorans CB1190]
          Length = 283

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 91/287 (31%), Positives = 149/287 (51%), Gaps = 24/287 (8%)

Query: 16  YSGKVRENYFLSDGTR----ITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           +SGKVR+ Y + +       + +A+DRLS +D  +   IP KG +L  ++ +WF   +D+
Sbjct: 5   HSGKVRDVYSVENEAGGDDLLLVASDRLSIYDVVLPTTIPDKGALLTALSLWWFDRLADL 64

Query: 71  CSNHTLDYPD-PNVLVGQQ-----LQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEY 124
             NH +   D P    G+      LQM P+E I RGYL G     L  + K G     E 
Sbjct: 65  VPNHVISATDVPPEFAGRAIRCRPLQMLPVECIARGYLTG---LGLKEYEKQGTVSGIE- 120

Query: 125 LLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSL 184
            LP  + +  KLP P+ TPTTK+       D+ ++ +E++    +     E + +  L++
Sbjct: 121 -LPPGLVEGSKLPEPIFTPTTKAPVGEH--DEFMTFDEVV--ATVGAPTAERLRALTLAV 175

Query: 185 FERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITP 244
           + RG  +A E+G+++ D+K EFG+D    I+L DE+ T DSSR+W  + ++     G   
Sbjct: 176 YSRGASIAAESGILVADTKLEFGLDPAGEIVLGDEVLTSDSSRFWPADQWQP----GRPQ 231

Query: 245 IGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITG 291
              DK ++R+W  T         P++P +++  T   Y+  YE+ITG
Sbjct: 232 FSFDKQYVRDWSATLDWDRTPPGPEVPVDVVAATRARYVEVYERITG 278


>gi|307262521|ref|ZP_07544166.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|306867898|gb|EFM99729.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
          Length = 285

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 149/293 (50%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D   + +ATDRLSAFD  +   IP KGE+L QI+ +WF   + I
Sbjct: 5   LKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILDDPIPRKGEILTQISNFWFQKLAHI 64

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE IVRGYL G   + L  + + G
Sbjct: 65  MPNHFTGDSVFDVLPKEEAEAIQHRAVVCKRLTPVKIESIVRGYLTG---SGLKDYKQTG 121

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              I    L + + +  KLP P+ TP++K+       D  IS  E   +  +       +
Sbjct: 122 T--ICGLKLLEGLVEASKLPQPIFTPSSKAE--VGNHDINISYEECERQ--IGAELAAKV 175

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+    + AL  G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W V+TY+  
Sbjct: 176 RDAAIALYTEAAEYALTKGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWSVDTYQ-- 233

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
             EG  P   DK F+R+W+       +   P +P ++I +T   Y  A + +T
Sbjct: 234 --EGTNPPSFDKQFVRDWLENSGWNKQAPAPKVPADVIEKTVAKYQEALDLLT 284


>gi|330469959|ref|YP_004407702.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Verrucosispora maris AB-18-032]
 gi|328812930|gb|AEB47102.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Verrucosispora maris AB-18-032]
          Length = 277

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 86/286 (30%), Positives = 151/286 (52%), Gaps = 21/286 (7%)

Query: 16  YSGKVRENYFLSDGTRITIATDRLSAFDQNIAC-IPYKGEVLNQITQYWFHHTSDICSNH 74
           +SGKVR+ Y   D   I +A+DR+S +D  +   IP KG++L  ++ +WF   +D+  +H
Sbjct: 5   HSGKVRDVYADGDDL-ILVASDRISVYDVVLPTPIPDKGKLLTALSLWWFEQLADLVPHH 63

Query: 75  TLDYPD-PNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            +   D P    G+     +L+M P+E + RG+L G     L  + + G     E  LP 
Sbjct: 64  VISATDVPAEFAGRAIRCRRLEMVPVECVARGFLTGG---GLKEYERTGAVSGVE--LPR 118

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            + +   LP P+ TP+TK+       DQP++  E++ +  +     E +    + ++ RG
Sbjct: 119 GLVEASILPEPIFTPSTKAPMGEH--DQPMTFAEVVDK--VGAQTAERLRQVTIDVYCRG 174

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            +LA + G+++ D+K E G      ++LADE+ TPDSSR+W  E+Y+     G      D
Sbjct: 175 TELAAQRGILVADTKIELGWAADGTLVLADEVLTPDSSRFWPAESYQP----GRAQFSYD 230

Query: 249 KDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKF 294
           K ++R+W  +     ++  P++P  ++  T   Y+  YEK+TG ++
Sbjct: 231 KQYVRDWAASSGWNKQEPAPEVPAEVVEATRARYVDVYEKLTGNRW 276


>gi|325919156|ref|ZP_08181213.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas gardneri ATCC 19865]
 gi|325550363|gb|EGD21160.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Xanthomonas gardneri ATCC 19865]
          Length = 308

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 100/316 (31%), Positives = 159/316 (50%), Gaps = 42/316 (13%)

Query: 4   LSKAYIPELPNYYSGKVRENYFL------SDGTR----ITIATDRLSAFDQNIA-CIPYK 52
           L ++ +P LP  + GKVR+ + +      +D       + +ATDRLSAFD  +   IP K
Sbjct: 5   LLRSDLPGLPLRHRGKVRDVFDIPRERLPADAPPGDYLLMVATDRLSAFDVVLPDPIPGK 64

Query: 53  GEVLNQITQYWFHHTSDICSNHTLD------YPD--------PNVLVGQQLQMFPIELIV 98
           GE+L Q++ +WFH T  +  NH +D       PD           +V ++L+  P+E I 
Sbjct: 65  GEMLCQVSNFWFHKTDHLMPNHLVDIRVEQVLPDGVDPALYAKRAVVTRKLKPVPVEAIA 124

Query: 99  RGYLAGNTKTSLLTFYKNGKR--KIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQ 156
           RGYL G+        +K+ +R  KI    LPD +   +KLP P+ TP+TK++      D+
Sbjct: 125 RGYLIGSG-------WKDYQRTGKISGIELPDGLRQAEKLPEPIFTPSTKAA--VGDHDE 175

Query: 157 PISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIIL 216
            I  + ++    +     E +    L ++      A E G++L D+K+EFG D    + +
Sbjct: 176 NIDFDAMVK--TVGAELAERVRDATLRIYRFAADFAAERGILLADTKFEFGTDADGRLYI 233

Query: 217 ADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIIL 276
            DE+ TPDSSRYW  + YE     G +P   DK F+R+++ T         P +P  +I 
Sbjct: 234 MDEMLTPDSSRYWPADQYEL----GTSPPSYDKQFVRDYLETLDWGKTAPGPSLPAEVIE 289

Query: 277 RTSQTYIAAYEKITGL 292
           RT   Y  A +++ G+
Sbjct: 290 RTRAKYAEALQRLAGI 305


>gi|320583935|gb|EFW98148.1| Phosphoribosylaminoimidazole-succinocarboxamide synthase [Pichia
           angusta DL-1]
          Length = 303

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 91/304 (29%), Positives = 160/304 (52%), Gaps = 40/304 (13%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHHTSDI 70
           LP    GKVR+ Y + D T + +ATDR+SA+D  +   I  KG++L Q++ +WF+  SD+
Sbjct: 12  LPLVARGKVRDIYQVDDNTLLFVATDRISAYDVIMENGIEDKGKILTQLSVFWFNLLSDV 71

Query: 71  CSNHTLDYPDPNV----------------LVGQQL-----QMFPIELIVRGYLAGNTKTS 109
             NH +   D ++                L G+ L     ++ P+E IVRGY+ G+    
Sbjct: 72  IPNHLVASSDEDIFAKLPKQLSEPKYKAQLAGRSLLVKKHKLVPLEAIVRGYITGSA--- 128

Query: 110 LLTFYKNGKRKIYEYLLP--DNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRG 167
               +K  K+    + LP    + +++    P+ TP+TK+ +     D+ ISP +     
Sbjct: 129 ----WKEYKKSGTVHGLPVKSGLQESEAFEKPIFTPSTKAEQGQH--DENISPEQAAQ-- 180

Query: 168 ILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSR 227
           ++       ++  A++L+ +    AL  G+IL D+K+EFG+++K  ++L DE+ TPDSSR
Sbjct: 181 LVGEKLCAEVAEKAIALYSKARDYALSRGIILADTKFEFGLNEKNELVLVDEVLTPDSSR 240

Query: 228 YWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYE 287
           +W+ + YE     G +    DK F+R+W+ +     ++ +  +   I+ +T+  Y  AYE
Sbjct: 241 FWDAKKYEL----GRSQDSFDKQFLRDWLTSNQLNGKEGVS-MTNEIVAKTAAKYKEAYE 295

Query: 288 KITG 291
            +TG
Sbjct: 296 ALTG 299


>gi|255725736|ref|XP_002547797.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Candida
           tropicalis MYA-3404]
 gi|240135688|gb|EER35242.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Candida
           tropicalis MYA-3404]
          Length = 294

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 93/298 (31%), Positives = 165/298 (55%), Gaps = 28/298 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIA-CIPYKGEVLNQITQYWFHH---- 66
            P    GKVR+ Y + + T + +ATDR+SA+D  ++  IP KG++L +++++WF      
Sbjct: 10  FPLIAKGKVRDIYQVDENTLLFVATDRISAYDVIMSNGIPQKGKILTKLSEFWFDFLPIE 69

Query: 67  ----TSDICSNHTLDYPDPNVLVGQ-----QLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
                 DI + +    P  + L G+     +L++ P+E+IVRGY+ G   +    + K+ 
Sbjct: 70  NHLIKGDIFTKYPQLEPYRDQLEGRSLLVRKLKLIPLEVIVRGYITG---SGWKEYTKS- 125

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
            + ++   + + + ++QKL  P+ TP+TK+ +     D+ IS  +     I+ +   + I
Sbjct: 126 -KTVHGKSIGEGILESQKLEPPIFTPSTKAEQGEH--DENISKEQ--ADKIVGKELCDRI 180

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
              A++L+ +    A   G+I+ D+K+EFG+D   NIIL DE+ TPDSSR+W    YE  
Sbjct: 181 EKIAINLYTKARDYAATKGIIIADTKFEFGLDDNNNIILVDEVLTPDSSRFWNASKYEI- 239

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKITGLKFI 295
              G +    DK F+R+W+ +     +D +  +PE+I  +T + Y+ AYE +TG K++
Sbjct: 240 ---GKSQESYDKQFLRDWLTSNGVAGKDGVA-MPEDIATKTKEKYVEAYECLTGDKWV 293


>gi|294789297|ref|ZP_06754535.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Simonsiella muelleri ATCC 29453]
 gi|294482722|gb|EFG30411.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase
           [Simonsiella muelleri ATCC 29453]
          Length = 285

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 95/293 (32%), Positives = 154/293 (52%), Gaps = 27/293 (9%)

Query: 12  LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQYWFHHTSDI 70
           L   YSGKVR+ Y + D T + +ATDRLSAFD  +   I  KGE+L QI+ +WF   + I
Sbjct: 5   LKKIYSGKVRDLYEIDDKTMLIVATDRLSAFDVILNEPIDGKGEILTQISNFWFGKLAHI 64

Query: 71  CSNHTLDYPDPNVL-------------VGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNG 117
             NH       +VL             V ++L    IE +VRGYL+G   +    + ++G
Sbjct: 65  LPNHFTGQTVYDVLPANEAKAIEKRAVVVKRLTPLKIEAVVRGYLSG---SGWKEYQQSG 121

Query: 118 KRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETI 177
              +    LP+N+   ++LP  + TP+TK+       D+ IS  + +   I+  +  E +
Sbjct: 122 A--VCGIRLPENLRQAEQLPEVIFTPSTKAE--VGDHDENISFEQCVD--IIGADLAEQV 175

Query: 178 SSYALSLFERGCKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKS 237
            + A+ L+    + A   G+I+ D+K+EFG+D+   + L DE+ TPDSSR+W ++TYE  
Sbjct: 176 RAKAIQLYTEAAEFAKMRGIIIADTKFEFGLDENGVLTLMDEVLTPDSSRFWAMQTYEV- 234

Query: 238 FREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRTSQTYIAAYEKIT 290
              G  P   DK F+R+W+ +     +   P +P +++ +T + Y  A   +T
Sbjct: 235 ---GKNPPSFDKQFVRDWLESSGWNKQPPAPKVPADVLRKTVEKYQEALNVLT 284


>gi|239942525|ref|ZP_04694462.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces roseosporus NRRL 15998]
 gi|239988989|ref|ZP_04709653.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces roseosporus NRRL 11379]
 gi|291445986|ref|ZP_06585376.1| phosphoribosylaminoimidazole-succinocarboxamide synthase
           [Streptomyces roseosporus NRRL 15998]
 gi|291348933|