PSIBLAST alignment of GI: 254780493 and protein with PDB id: 1a48

>gi|313507122|pdb|1A48|A Chain A, Saicar Synthase Length = 306
>gi|313507250|pdb|2CNQ|A Chain A, Atomic Resolution Structure Of Saicar-Synthase From Saccharomyces Cerevisiae Complexed With Adp, Aicar, Succinate Length = 306
 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 95/316 (30%), Positives = 162/316 (51%), Gaps = 39/316 (12%)

Query: 4   LSKAYIPE-LPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNI-ACIPYKGEVLNQITQ 61
           ++K  +   LP    GKVR+ Y +  GT + +ATDR+SA+D  +   IP KG +L ++++
Sbjct: 3   ITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSE 62

Query: 62  YWFHHTSDICSNHTLD----------------------YPDPNVLVGQQLQMFPIELIVR 99
           +WF   S+   NH +D                        +   L+  + ++ P+E+IVR
Sbjct: 63  FWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVR 122

Query: 100 GYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKSSESASGCDQPIS 159
           GY+ G+     +         ++    P  + ++Q+ P P+ TP+TK+ +     D+ IS
Sbjct: 123 GYITGSAWKEYVK-----TGTVHGLKQPQGLKESQEFPEPIFTPSTKAEQGE--HDENIS 175

Query: 160 PNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFGIDKK-QNIILAD 218
           P +     ++  +    ++  A+ L+ +    A E G+I+ D+K+EFGID+K   IIL D
Sbjct: 176 PAQ--AAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVD 233

Query: 219 EIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRNWILTRCNPYRDNIPDIPENIILRT 278
           E+ TPDSSR+W   +Y    + G +    DK F+R+W+         N   +P++I+ RT
Sbjct: 234 EVLTPDSSRFWNGASY----KVGESQDSYDKQFLRDWLTANKLNGV-NGVKMPQDIVDRT 288

Query: 279 SQTYIAAYEKITGLKF 294
              YI AYE +TG K+
Sbjct: 289 RAKYIEAYETLTGSKW 304