RPSBLAST alignment for GI: 254780493 and conserved domain: PLN02544

>gnl|CDD|178159 PLN02544, PLN02544, phosphoribosylaminoimidazole-succinocarboxamide synthase. Length = 370
 Score =  331 bits (851), Expect = 1e-91
 Identities = 138/304 (45%), Positives = 196/304 (64%), Gaps = 6/304 (1%)

Query: 9   IPELPNYYSGKVRENYFLSDGTRITIATDRLSAFDQNIACIPYKGEVLNQITQYWFHHTS 68
           +P L +   GKVR+ Y L D   + + TDR SAFD+ +A IP+KG+VLNQ + +WF++T 
Sbjct: 72  VPGLGSRRRGKVRDIYDLGD-YLVLVTTDRQSAFDRVLASIPFKGQVLNQTSAWWFNNTK 130

Query: 69  DICSNHTLDYPDPNVLVGQQLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPD 128
            I  N  +  PDPNV + ++  +FP+E +VRGY+ G+T TSL T Y  G R      LPD
Sbjct: 131 HITPNALVSSPDPNVTIAKKCSVFPVEFVVRGYMTGSTSTSLWTVYNKGVRNYCGNDLPD 190

Query: 129 NMSDNQKLPYPVITPTTKSSESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERG 188
            M  NQKLP  ++TPTTK+++     D PISP EI+  G++T+  ++ +SS AL+LF  G
Sbjct: 191 GMVKNQKLPANILTPTTKAADH----DVPISPEEIVEEGLMTQEDFDEVSSKALALFAFG 246

Query: 189 CKLALENGLILVDSKYEFGIDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLD 248
            ++A E+GLILVD+KYEFG D    I+L DE+HTPDSSRYW  ++YE+    G+ P  +D
Sbjct: 247 QEVAAEHGLILVDTKYEFGKDADGTILLIDEVHTPDSSRYWLADSYEERHAAGLEPENID 306

Query: 249 KDFIRNWILTRCNPYRDN-IPDIPENIILRTSQTYIAAYEKITGLKFIADNSELPPLERI 307
           K+F+R W    C+PY+D  +P+ P  ++   S  YI  YE ITG KF   +++ P  ERI
Sbjct: 307 KEFLRLWFKENCDPYKDEVLPEAPAELVCELSWRYIKLYETITGEKFEVPDTQEPIHERI 366

Query: 308 RNNL 311
             N+
Sbjct: 367 SRNV 370